Skip to main content
Journal of Virology logoLink to Journal of Virology
. 2020 Jan 17;94(3):e01327-19. doi: 10.1128/JVI.01327-19

Genome-Wide Mutagenesis of Hepatitis C Virus Reveals Ability of Genome To Overcome Detrimental Mutations

Deepak Singh a,#, Shalini Soni a,#, Shaheen Khan a, Aditya N Sarangi b, Ragothaman M Yennamalli c, Rakesh Aggarwal b, Naga Suresh Veerapu a,✉
Editor: Julie K Pfeifferd
PMCID: PMC7000968  PMID: 31723027

Hepatitis C virus (HCV) in vivo displays high genetic heterogeneity, which is partly due to the high reproduction and random substitutions during error-prone genome replication. It is difficult to introduce random substitutions in vitro because of limitations in inducing mutagenesis from the 5′ end to the 3′ end of the genome. Our study has overcome this limitation. We synthesized full-length genomes with few to several random mutations in the background of an HCV clone that can recapitulate all steps of the life cycle. Our study provides evidence of the capability of the HCV genome to overcome deleterious mutations and remain viable. Mutants that emerged from the libraries had diverse phenotype profiles compared to the parent, and putative adaptive mutations mapped to segments of the conserved nonstructural genome. We demonstrate the potential utility of our system for the study of sequence variation that ensures the survival and adaptation of HCV.

KEYWORDS: genome viability, genome-wide mutagenesis, hepatitis C virus, quasispecies, reverse genetic analysis, tolerance

ABSTRACT

To gain insight into the impact of mutations on the viability of the hepatitis C virus (HCV) genome, we created a set of full-genome mutant libraries, differing from the parent sequence as well as each other, by using a random mutagenesis approach; the proportion of mutations increased across these libraries with declining template amount or dATP concentration. The replication efficiencies of full-genome mutant libraries ranged between 71 and 329 focus-forming units (FFU) per 105 Huh7.5 cells. Mutant libraries with low proportions of mutations demonstrated low replication capabilities, whereas those with high proportions of mutations had their replication capabilities restored. Hepatoma cells transfected with selected mutant libraries, with low (4 mutations per 10,000 bp copied), moderate (33 mutations), and high (66 mutations) proportions of mutations, and their progeny were subjected to serial passage. Predominant virus variants (mutants) from these mutant libraries (Mutantl, Mutantm, and Mutanth, respectively) were evaluated for changes in growth kinetics and particle-to-FFU unit ratio, virus protein expression, and modulation of host cell protein synthesis. Mutantm and Mutantl variants produced >3.0-log-higher extracellular progeny per ml than the parent, and Mutanth produced progeny at a rate 1.0-log lower. More than 80% of the mutations were in a nonstructural part of the mutant genomes, the majority were nonsynonymous, and a moderate to large proportion were in the conserved regions. Our results suggest that the HCV genome has the ability to overcome lethal/deleterious mutations because of the high reproduction rate but highly selects for random, beneficial mutations.

IMPORTANCE Hepatitis C virus (HCV) in vivo displays high genetic heterogeneity, which is partly due to the high reproduction and random substitutions during error-prone genome replication. It is difficult to introduce random substitutions in vitro because of limitations in inducing mutagenesis from the 5′ end to the 3′ end of the genome. Our study has overcome this limitation. We synthesized full-length genomes with few to several random mutations in the background of an HCV clone that can recapitulate all steps of the life cycle. Our study provides evidence of the capability of the HCV genome to overcome deleterious mutations and remain viable. Mutants that emerged from the libraries had diverse phenotype profiles compared to the parent, and putative adaptive mutations mapped to segments of the conserved nonstructural genome. We demonstrate the potential utility of our system for the study of sequence variation that ensures the survival and adaptation of HCV.

INTRODUCTION

Hepatitis C virus (HCV) infection is a major global health concern, with approximately 71 million infected persons (1). Nearly 80% of individuals who acquire HCV infection are at risk of developing chronic hepatitis, 20% of those with chronic infection are at risk of developing cirrhosis, and 5% of those with HCV-related cirrhosis are at risk of progressing to hepatocellular carcinoma (2). HCV, an enveloped virus, contains an approximately 9,600-nucleotide (nt)-long, positive-sense single-strand RNA [ss(+) RNA] genome that translates into a polyprotein of ∼3,000 amino acids. The polyprotein undergoes co- and posttranslational cleavage into three structural proteins (C, E1, and E2) and seven nonstructural (NS) proteins (P7, NS2, NS3, NS4A, NS4B, NS5A, and NS5B). The NS5B protein is an error-prone RNA-dependent RNA polymerase (RdRp), responsible for the generation of progeny HCV genomes (3).

HCV isolates exhibit high genetic heterogeneity, with 7 major genotypes that differ by 25 to 30% at the nucleotide level and 67 subtypes that differ by 15 to 20% (4). Furthermore, intrahost circulating HCV genomes differ from each other by as much as 5% at the nucleotide level; these circulating viral variants are referred to as quasispecies or mutant clouds (5 – 7). HCV replicates at very high levels, with generation of approximately 1012 particles per day (8). A high replication rate combined with a high error rate of 10−3 to 10−4 per nucleotide of RdRp allows the virus to explore a vast niche of sequence space in the genome. Because of random substitutions, new viral variants continuously emerge during error-prone replication (9). The majority of substitutions are deleterious or impair viral fitness, and some are even lethal (10). In contrast, some variants with beneficial mutations are continuously selected on the basis of their replication capacity and adaptive potential to the ever-changing host environment in which the virus replicates. With the continuous emergence of new fit variants, it is conceivable that the HCV genome is capable of exploring its own sequence space for the need to conserve functions of viral structures and proteins.

Studies of the HCV life cycle, virus-host interactions, and development of antivirals have been made possible by the advent of HCV subgenomic replicon systems (11, 12), and subsequently, a robust full-genome HCV cell culture (HCVcc) system was established using the genotype 2a HCV cDNA clone JFH-1 (13) and the genotype 2a chimera J6/JFH-1 (14). The HCVcc system recapitulates all steps of the HCV life cycle. We believe that the JFH-1 HCVcc system is an ideal platform for studying the impact of random mutations in sequence space on the viability of the HCV genome.

In the present study, we tested whether a substantial increase in mutations can result in an increased sequence variation that is not associated with the complete loss of genetic information and thus results in the emergence of replication-competent genomes. This required a molecular technique that allows a massive increase in mutations during the replication of the HCV genome. Recently, we reported a molecular technique, full-length mutant RNA synthesis (FL-MRS) for random introduction of a few to several mutations in a controllable fashion in the hepatitis E virus (HEV) genome (15). The introduction of random mutations in the HCV genome may allow evaluation of the intrinsic mutational tolerance in the sequence space of the HCV genome (16).

In this study, we used FL-MRS to introduce random mutations in the HCV genome and created full-genome mutant libraries with various proportions of mutations. Mutant libraries representing full-genome HCV variants when expressed in hepatoma cells showed replicative capability and established persistent infections. Mutant libraries with high proportions of mutations were replication competent and survived extinction. In these cases, the surviving genomes showed differences in their phenotypic profiles, with respect to growth kinetics, multiplicity of infection, virus protein expression, and host protein synthesis shutoff, and showed an enrichment of putative adaptive mutations in the nonstructural region of HCV genome.

RESULTS

FL-MRS is a viable strategy that can contribute to the synthesis of full-genome mutant libraries.

First, we tested the possibility of inducing genome-wide mutagenesis by using FL-MRS. Error-prone PCRs (EP-PCRs) using decreasing template amounts of 100 ng, 50 ng, 25 ng, and 10 ng and all four deoxynucleoside triphosphates (dNTPs) at a 0.2 mM final concentration (100 ng 0.2AGCT, 50 ng 0.2AGCT, 25 ng 0.2AGCT, and 10 ng 0.2AGCT mutant libraries) were sustained and yielded 9.7-kb-long products (Fig. 1A, lanes 1 to 4). Previously, we were able to synthesize and diversify the HEV full-length genome of 7.2 kb by reducing the dATP and dGTP concentrations in EP-PCR (15). In this study, we first attempted to further induce genome-wide mutagenesis by reducing both dATP and dGTP concentrations; however, this failed to provide sustained yields. We then tried reducing only the dATP concentration. This yielded good results. EP-PCR of the HCV full-length genome using 10 ng template and final dATP concentrations of 0.15 and 0.10 mM with the other three dNTPs maintained at 0.2 mM (10 ng 0.15A-0.2GCT and 10 ng 0.10A-0.2GCT mutant libraries) provided sustained yields (Fig. 1A, lanes 5 and 6). Average yields of FL EP-PCR products obtained with balanced dNTPs, except for the 10 ng reaction template, and with imbalanced dNTP pools ranged between 8.4 ng/μl and 12.5 ng/μl (±4.53). The average yield of EP-PCR products obtained with 10 ng template and a balanced dNTP pool was 4.2 ng/μl (±0.8) (data not shown). There was no difference in amount of EP-PCR products generated using pJFH-1 or pJ6/JFH-1 as the templates.

FIG 1.

FIG 1

Agarose gel electrophoresis of EP-PCR products and proportions of mutations in full-genome mutant libraries. (A) The HCV genome was amplified using various amounts of template and a balanced dNTP pool (lanes 1 to 4) or reduced dATP final concentrations (lanes 4 and 6). Amplification conditions are described in Materials and Methods. The expected size of the amplified genomes (EP-PCR products) was 9.7 kb. Equal volumes of EP-PCR products were loaded, resolved on an 0.8% agarose gel, and visualized by staining with ethidium bromide. Lane M, 1-kb DNA size ladder. (B) Proportions of mutations per 10,000 bp in amplicons determined by Sanger sequencing or next-generation sequencing. Sanger sequencing of 50,000 nt of the parent showed zero background errors. Next-generation sequencing of the parent showed 15 errors per 10,000 single-nucleotide reads, and these background errors were subtracted from the total proportions of mutations (corresponding proportion of transitions and transversions) found in 10 ng 0.2AGCT, 10 ng 0.15A-02GCT, and 10 ng 0.10A-0.2GCT libraries. (C) Alignments of amino acid reads for residues 1 to 25 of the core gene product. Amino acids are shown with the single-letter code for the parent to mutant. Amino acids are numbered consecutively relative to the JFH-1 polyprotein. A dot indicates that the amino acid within a sequence is identical to that in the parent. Sequences with a plus sign indicate an altered start codon, and an asterisk indicates nonsense mutations.

A wide range of proportions of mutations, 0.4, 4, 9, 33, 52, and 66 per 10,000 bp, were copied in 100 ng 0.2AGCT, 50 ng 0.2AGCT, 25 ng 0.2AGCT, 10 ng 0.2AGCT, 10 ng 0.15A-0.2GCT, and 10 ng 0.10A-0.2GCT mutant libraries, respectively (Fig. 1B). A 3.6-fold increase in proportion of mutations was observed between 25 ng 0.2AGCT (9 per 10,000 bp copied) and 10 ng 0.2AGCT (33 per 10,000 bp copied). Overall, 100 ng 0.2 AGCT, 50 ng 0.2AGCT, and 25 ng 0.2AGCT libraries consisted of low proportions of mutations (0.4, 4, and 9 mutations per 10,000 bp, respectively; the combined average was 4.5 mutations per 10,000 bp), whereas 10 ng 0.2AGCT, 10 ng 0.15A-0.2GCT, and 10 ng 0.10A-0.2GCT libraries consisted of high proportions of mutations (33, 52, and 66 mutations per 10,000 bp, respectively; the combined average was 50 mutations per 10,000 bp) (Fig. 1B). Sanger sequencing of clones derived from 100 ng 0.2AGCT, 50 ng 0.2 AGCT, and 25 ng 0.2 AGCT libraries showed that the sequences had unique mutations. We had made a similar observation earlier: Sanger sequencing of EP-PCR products that were derived from an HEV cDNA clone had unique mutations (15). Table 1 shows a transition-transversion matrix for genome-wide substitutions for all six libraries. Transition-to-transversion ratios were between 1.6 and 5.8. Predicted nonsynonymous-to-synonymous substitution ratios ranged between 0.5 and 0.8 (10 full-length HCV coding regions were simulated to calculate the ratio based on transition and transversion data). Predicted polyprotein viability (without stops) was the lowest for 10 ng 0.10A-0.2GCT (20%) and the highest for 100 ng 0.2AGCT and 50 ng 0.2AGCT (100%) (Table 1). A total of 874 sequence reads from the 10 ng 0.2AGCT library, 881 from 10 ng 0.15A-0.2GCT, and 1,026 from 10 ng 0.10A-0.2GCT that encode amino acids 1 to 25 of core genes were extracted and aligned to assess amino acid sequence variation. Figure 1C demonstrates the robustness inducing random mutations by our experimental approach to the study of genome tolerance for mutations. Sequence alignments showed a decrease in percentage of parent sequences from 94 to 89.7 and an increase in number of unique variants from 3 to 4.5. Variants with stops (Fig. 1C, sequences indicated by an asterisk) and an altered start codon (indicated by a plus) were found.

TABLE 1.

Sequencing analysis of mutant libraries of HCV synthesized by EP-PCR

Mutant library Original base No. of substitutions/10,000 bp copied at mutated base
Ts/Tv ratiod Nonsynonymous/synonymous ratioa % Polyprotein viabilityb
A G C T
100 ng 0.2AGCT A 0.20 0 0 1 (1/1) 0.67 100
G 0 0 0
C 0 0 0
T 0 0.20 0
50 ng 0.2AGCT A 0 0 0 1.7 (2.5/1.5) 0.68 100
G 0.35 0 0.70
C 0.30 0.70 0
T 0 1.40 0.70
25 ng 0.2AGCT A 0.95 0 0.32 1.6 (5.5/3.5) 0.55 90
G 1.60 0 1.90
C 1.60 0.64 0.64
T 0 0.95 0.32
10 ng 0.2AGCTc A 9.23 0.49 1.37 4.5 (27/6) 0.83 60
G 3.40 0.29 3.53
C 0.80 0.25 0.84
T 1.41 10.48 0.46
10 ng 0.15A-0.2AGCTc A 18.03 0.80 1.99 5.3 (44/8) 0.67 40
G 3.25 0.35 3.18
C 0.85 0.28 0.89
T 2.36 19.62 0.78
10 ng 0.10A-0.2GCTc A 23.71 1.09 2.57 5.8 (56/10) 0.83 20
G 3.11 0.37 3.07
C 0.56 0.31 0.57
T 3.05 25.96 1.05
a

Predicted nonsynonymous-to-synonymous substitution ratio. Ten full-genome sequences were simulated based on transition and transversion data.

b

Predicted polyprotein viability. Ten full-genome sequences were simulated based on transition and transversion data.

c

The numbers of nucleotide substitutions in the parent introduced by the Illumina platform were subtracted from the respective numbers of substitutions.

d

Transition-to-transversion ratio.

Genomes of mutant libraries are replicative.

Full-genome RNA variants of the same infectious parent generated using different degrees of mutagenesis are expected to have different in vitro growth characteristics. To determine the impact of genome-wide mutagenesis on replication capability of mutant libraries, we transfected each of the six libraries generated. NS5A-based immunostaining has been widely used for detection and quantitation of HCV infection in JFH-1 cell cultures. At 3 days posttransfection, cells were fixed and immunostained for NS5A, and the numbers of FFU per 100,000 cells were determined. Cells transfected with the parent were NS5A positive at about 90%. The average number of FFU observed for the six mutant libraries ranged between 71 and 329 (Fig. 2A). The number of FFU was inversely correlated with the proportion of mutations for libraries synthesized using a balanced dNTP pool and a template amount decreased in a stepwise manner, as follows: for 100 ng 0.2AGCU, 0.4 mutations and 329 FFU; for 50 ng 0.2AGCU, 4 mutations and 109 FFU; and for 25 ng 0.2AGCU, 9 mutations and 71 FFU. Genomes of 100 ng 0.2 AGCU produced significantly higher numbers of FFU (P < 0.001) than genomes of 50 ng 0.2AGCU. The FFU number was also correlated inversely with the proportion of mutations for libraries synthesized using 10 ng template and differing levels of dATP, as follows: for 10 ng 0.20AGCU, 33 mutations and 257 FFU; for 10 ng 0.15A-0.2GCU, 52 mutations and 191 FFU; and for 10 ng 0.10A-0.2GCU, 66 mutations and 136 FFU. These negative correlations between proportions of mutations and numbers of FFU are expected. However, despite a >2-fold increase in proportion of mutations, no such inverse correlation was observed between 50 ng 0.2AGCU (4 mutations and 109 FFU) or 25 ng 0.2AGCU (9 mutations and 71 FFU) and 10 ng 0.2AGCU (33 mutations and 257 FFU); the difference was statistically significant at P values of <0.001 and <0.01, respectively (Fig. 2A). Moreover, despite an 80-fold increase in proportion of mutations, there was no significant difference in number of FFU between 100 ng 0.2AGCU (0.4 mutations and 329 FFU) and 10 ng 0.2AGCU (33 mutations and 257 FFU). These comparative measures of numbers of FFU convey the relative capacities to initiate replication of the genomes of mutant libraries. NS5A staining patterns of cells transfected with libraries were similar to those of J6/JFH-1-infected cells (14).

FIG 2.

FIG 2

Replicative capability of full-genome mutant libraries generated using full-length mutant RNA synthesis. (A) Huh7.5 cells were transfected with the indicated libraries. After 72 h, transfected cells were immunostained for NS5A and the numbers of FFU were determined visually under an optical microscope. Results are shown as means (±standard deviations) of three independent experiments, each performed in triplicate. Numbers indicating the proportion of mutations in the respective libraries are near the bottom of the columns. Significant differences in FFU between libraries are indicated with asterisks (**, P < 0.01; ***, P < 0.001). n.s., not significant. (B) Representative images show NS5A-positive cells (scale bar, 1 μm). MAb 9E10 identifies HCV NS5A, a nonstructural protein found in the cytoplasm. Original magnification, ×10.

Replication-competent viruses emerged and recovered.

Upon transfection, the majority of parent transcripts are expected to establish a replication cycle and provide easy recovery of the parent virus when the cells are routinely passaged at a 1:3 split. However, for libraries harboring high proportions of mutations, a decrease in the recovery of replication-competent viruses is expected. Mutants of 50 ng 0.2AGCU were recovered easily at a 1:3 split; however, our attempts to recover mutants from cells transfected with 10 ng 0.10A-0.2GCU and 10 ng 0.2AGCU at a 1:3 split were unsuccessful. We therefore repeated the experiment by scaling up the transfected cells transferring to new, large growth areas during the initial virus passages, as shown in Fig. 3A, which resulted in the successful recovery of mutants; otherwise, genomes of 10 ng 0.10A-0.2GCU and 10 ng 0.2AGCU might be construed as replication incompetent.

FIG 3.

FIG 3

Scaling-up transfected Huh7.5 cells for virus recovery and early FFU kinetics posttransfection. (A) Schematic illustration of the passage cycles used to recover viruses from cells transfected with 10 ng 0.2AGCU and 10 ng 0.10A-2GCU libraries. Cell culture vessel growth areas are not shown to scale. (B) Numbers of FFU per 100,000 cells at each indicated passage for cells transfected with the respective libraries. These data are a representation from cell passages that resulted in successful virus recovery. (C) NS5A stainings of cells at the earliest passages when virus spread had reached the maximum (scale bar, 1 μm). Parallel transfections were carried out with JFH-1/GND RNA as a negative control.

In initial experiments, cells transfected with 10 ng 0.2AGCU and 50 ng 0.2AGCU did not survive due to cytopathy (detachment of cells from the monolayer; no signs of bacterial or fungal contamination) induced by the rapid virus spread that was observed mostly between passages 7 and 10. Figure 3B shows data from the experiments in which cells supported sustained replication of the virus population. After a transient decline during initial passages, the virus infection spread rapidly to 90 to 95% of cells by passage 9 (P9; about day 27 of intracellular replication) or P12 (about day 36 of intracellular replication) of cells transfected with 50 ng 0.2AGCU and 10 ng 0.2AGCU, respectively. Infection in cells transfected with 10 ng 0.10A-0.2GCU spread slowly, reaching a maximum of 70% by P17 (about day 50 of intracellular replication) (Fig. 3B). A transient decline in number of FFU during initial virus passages indicates elimination of a large replication-incompetent virus subpopulation (Fig. 3B). Based on the numbers of mutations in 10 ng 0.10A-0.2GCU, 10 ng 0.2AGCU, and 50 ng 0.2AGCU (Table 1) libraries, the populations or the mutants derived from these libraries were designated as being high (Mutanth), medium (Mutantm), or low (Mutantl), respectively. We extended virus passages to study the phenotypic traits of emerged virus variants and also whether these variants represented the mutant library from which they emerged. Figure 3C shows that virus spread reached the maximum at the earliest passage number for Mutanth, Mutantm, and Mutantl populations.

Virus genome copy numbers and infectious titers were measured at P17, P33, P47, and P53 for Mutanth and Mutantm populations and at P67 as well for Mutantl population. Detection of genomic RNA and infectious progeny released into the culture medium indicated a sustained infection over passages (Fig. 4A). Lack of variation in average virus RNA copy number and infectious titer indicates that the outcome of infection kinetics was determined by the input libraries (Fig. 4A). Virus populations of Mutanth at passages 0, 17, 47, and 53 were analyzed for adaptive changes in the NS3 gene. Figure 4B shows the ratio of nonsynonymous to synonymous substitutions across the input genomes (passage 0) and the mutant viruses as determined from the Sanger sequencing. The Sanger sequencing effectively selected for viable genomes, as evidenced by a purge of genomes with stop codons and deletions. Predominant Mutantl populations circulating at passage 53 (9 of 10 NS3 clones were identical) first appeared at passage 17 (1 out of 10 sequences). NS3 sequences without putative adaptive mutations appeared frequently at passages 17 and 47, showing selection against mutations for the sequence analyzed.

FIG 4.

FIG 4

HCV infectivity and genome copy numbers during serial passages in cell culture and amino acid changes during serial passage of Mutanth. (A) Huh7.5 cells were transfected with transcripts of the parent, Mutantl, Mutantm, and Mutanth. Extracellular HCV genome copy levels (quantified by real-time RT-PCR) and infectious viral titers (TCID50) of the supernatants as a function of passage number are shown. (B) The ratios of nonsynonymous-to-synonymous changes across the input genomes at passage 0 and the mutants at passages 17, 47, and 53 as determined by Sanger sequencing of 9 or 10 NS3 gene-positive clones (C1 to C10) are shown. Each bar represents a unique sequence or identical sequences. The gray bars represent the sequence that was dominant at passage 53. Ts, transition; Tv, transversion; del, deletion.

All virus passages were monitored for clonal diversity at 3 weeks prior to the last passage. Ten positive bacterial clones were sequenced, and the presence of a majority of identical sequences was taken as evidence of the presence of a predominant variant. All NS3 sequences were identical at 3 weeks prior to the last passage of Mutantl (last passage was P67), and for Mutanth (last passage was P53), 9 of 10 clones were identical at this time.

Enhanced growth of mutant viruses.

Two mutant populations, Mutantm and Mutantl, showed replication with production of progeny at rates of 1.8 × 109 and 1.1 × 1010 per ml, respectively, i.e., about 3-log and 4-log (1,307-fold and 7,852-fold, respectively) higher than the parent. Mutanth produced <6-fold less progeny than the parent (Table 2). No significant changes in 50% tissue culture infectious dose (TCID50) of mutant viruses were found in comparison to the parent TCID50.

TABLE 2.

Particle-to-FFU ratios for replication-competent mutantsa

Virus No. of genome copies/ml Fold change in no. of genome copies/ml relative to parent No. of genome copies/TCID50
Parentb 1.4 × 106 1.2 × 103
Mutanthc 2.1 × 105 −6.80 2.5 × 103
Mutantmd 1.8 × 109 1,307 3.3 × 103
Mutantle 1.1 × 1010 7,852 4.6 × 103
a

Huh7.5 cells were transfected with transcripts of parent and mutant libraries. Replication-competent viruses were serially passaged. Infectious titers were determined by the TCID50 method. Genome copies were measured by quantitative RT-PCR.

b

Passage 53 virus.

c

Passage 53 virus, derived from 10 ng 0.1A-0.2GCU library.

d

Passage 53 virus, derived from 10 ng 0.2AGCU library.

e

Passage 67 virus, derived from 50 ng 0.2AGCU library.

The majority of mutations were in nonstructural genes, and nonsynonymous mutations were predominant in mutant viruses.

Experimental studies with serial passage of replicative HCV clones in the presence of interferon have demonstrated that selection pressures do not apply to a single gene region but are genome wide (17). We compared genome-wide mutation counts in the predominant mutants circulating at passage 53 for Mutanth and Mutantm and at passage 67 for Mutantl to those of their respective input genomes (Fig. 5A) (Table 1). Though the counts in mutants did not directly reflect the mutation counts in the input genomes, they did show a general relation. Mutanth had a 2.3-fold lower mutation count (n = 29) than the count (n = 66) in the input, 10 ng 0.10A-0.2GCU. Mutantm had a 1.8-fold lower mutation count (n = 18) than the count (n = 33) in the input, 10 ng 0.2AGCU. These data are consistent with the notion that mutation selection was against mutations that are not required for virus life cycle processes. In contrast, Mutantl had a 2.7-fold-higher mutation count (n = 11) than the count (n = 4) in the input, 50 ng 0.2AGCU. We do not rule out the possibility that adaptive changes are gained during virus passages.

FIG 5.

FIG 5

FIG 5

Analysis of sequence heterogeneity across the HCV subtype 2a genome identified several conserved regions, and amino acid changes are distributed across the nonstructural part of the mutants’ genomes. (A) Amino acid changes (relative to the parent) in the polyprotein sequences of Mutanth (passage 53 virus), Mutantm (passage 53 virus), and Mutantl (passage 67 virus). Nonsynonymous mutations identified in conserved regions are colored red, and nonconserved regions are colored blue. Synonymous mutations are colored green. Amino acids are shown with the numerical position and single-letter code for the change from the parent to the mutant. Amino acids are numbered consecutively relative to the JFH-1 polypeptide. NSt/St, nonstructural/structural; nonsynonymous-c to nonsynonymous-nc, nonsynonymous conserved to nonsynonymous nonconserved. (B) An entropy plot obtained from the analysis of 16 complete polyprotein sequences is shown. Each bar represents sequence heterogeneity at a single amino acid site. A polyprotein region of a minimum of 10 consecutive amino acids and an entropy score of <0.15 for a single amino acid site are considered conserved (dotted red line). (C and D) Sequence alignments for Mutanth, Mutantm, and Mutantl corresponding to conserved (C) and nonconserved (D) coding regions were identified in the parent by using Shannon entropy. Amino acids are numbered relative to the JFH-1 polypeptide (47). Numbered nonsynonymous changes are in bold. A dot indicates that the amino acid within a sequence is identical to that of the parent.

Mapping of putative adaptive mutations showed a distribution across the genomes of the mutants and were predominant (≥80%) in the nonstructural part (Fig. 5A). We identified putative adaptive mutations mostly in regions of the NS2 to NS5A genes, which represent ∼60% of the entire genome. Mutanth had 26 out of 29 (90%), Mutantm had 15 out of 18 (83%), and Mutantl had 9 out of 11 (82%) mutations in the nonstructural part of the genome. No nucleotide changes were found in the 5′ untranslated region (UTR) and core gene of the three mutants; this may be due to larger functional and structural constraints in these regions (Fig. 5A).

One of the bases that drive genetic heterogeneity in vivo is selection of beneficial mutations with structural and functional advantages (17). The nonsynonymous-to-synonymous substitution ratio has been used as an indicator of selection pressure in RNA viruses (18). Nonsynonymous-to-synonymous substitution ratios for the three mutants, Mutanth, Mutantm, and Mutantl, were 3.1 (22:7), 3.5 (14:4), and 1.8 (7:4), respectively (Fig. 5A), higher than those predicted (Table 1). This provides evidence of selection pressure on input genomes.

Moderate to high nonsynonymous mutations mapped to conserved regions of the NS gene.

Sixteen subtype 2a full-genome sequences were obtained from HCV sequence databases, and sequence conservation was measured using Shannon entropy. The topography of the measurements (Fig. 5B) was consistent with a previous report for subtype 3a sequences (19). We defined coding regions with a minimum stretch of 10 amino acids with an entropy score of <0.15 as conserved, and those with an entropy score of ≥0.15 as nonconserved. In all, 96 distinct conserved regions with an average length of 19 amino acids were identified (Table 3) (the entropy score measured with the above-described cutoff criteria identified 92 conserved regions for 18 HCV subtype 3a sequences reported by Humphreys et al. [19]; data not shown). The longest of these was in the NS4B region and was 89 amino acids long. NS3 and NS5B proteins consisted of 23 and 18 conserved regions, respectively. Across all conserved genome regions, NS3 conserved regions had more putative adaptive mutations. Mutanth had 6 out of 9, Mutantm had 2 out of 6, and Mutantl had 3 out of 4 nonsynonymous changes. Mutanth NS5B had a single nonsynonymous change (T2782A) in conserved regions; the other two mutants had no mutations in the NS5B region, which indicates structural and functional constraints. The ratios of nonsynonymous mutations in conserved regions to nonsynonymous mutations in nonconserved regions for the three mutants Mutanth, Mutantm, and Mutantl were 2.7 (16:6), 0.75 (6:8), and 0.75 (3:4), respectively (Fig. 5A). Nonsynonymous changes identified in conserved and nonconserved regions along with parent and 16 subtype 2a protein alignments are shown in Fig. 5C and D, respectively. These data indicate that the HCV genome can tolerate mutations in conserved regions of the nonstructural part of the HCV genome. Our BLAST search found 2 of 22 nonsynonymous mutations of Mutanth in subtype 2a natural isolates, K370R (E1 conserved region; sequence deposited in GenBank under accession no. GQ290832) (data not shown) and T2782A (NS5B conserved region; GenBank accession no. AY746460) (Fig. 5A and C) and MG891162 (data not shown). N1771S (NS4B conserved region), 1 of 18 nonsynonymous mutations of Mutantm, was found in one natural isolate deposited in GenBank under accession no. KY620321 (data not shown). Two of 11 nonsynonymous mutations of Mutantl, K1152R (NS3 conserved region; GenBank accession no. HQ639943) (Fig. 5A and C) and S2357P (NS5A nonconserved region), were found in 11 natural isolates (Fig. 5A and D).

TABLE 3.

Conserved regions identified in JFH-1 polyproteina

Protein and sequence no. Amino acid sequence Location in polyproteina Length (aa)
Core
    1 MSTNPKPQRKT 1–11 11
    2 FPGGGQIVGGVYLLPRRGPRLGVR 24–47 24
    3 RRQPIPKDRRSTGK 61–74 14
    4 PWPLYGNEGLGWAGWLLSPRGSRPSWGP 82–109 28
    5 GKVIDTLTCGFADLMGYIPVVGAPL 120–144 25
    6 FSIFLLALLSCIT 174–186 13
E1
    7 AAVLHVPGCVPCE 218–230 13
    8 CSALYVGDLCGGVMLAAQ 272–289 18
    9 ITGHRMAWDMMMNWSPT 313–329 17
    10 MRVPEVIIDI 338–347 10
    11 GAHWGVMFGLAYFSMQGAWAKV 350–371 22
E2
    12 NGSWHINRTALNC 417–429 13
    13 VTNPEDMRPYCWHYPP 478–493 16
    14 SVCGPVYCFTPSPVVVGTTD 503–522 20
    15 GVPTYTWGENETDVF 525–539 15
    16 GSWFGCTWMNSTGFTKTCGAPPCR 549–572 24
    17 RADFNASTDLLCPTDCFRKHP 574–594 21
    18 KCGSGPWLTP 600–609 10
    19 YPYRLWHYPCT 615–625 11
    20 PLLHSTTEWAILPC 668–681 14
    21 SDLPALSTGLLHLHQNIVDVQYMYGL 684–709 26
    22 LLFLLLADARVCAC 725–738 14
E2 and P7 junction
    23 WMLILLGQAEAALEKLV 740–756 17
NS2
    24 LWWLCYLLTL 847–856 10
    25 FCPGVVFDITKWLLA 884–898 15
    26 VPYFVRAHAL 913–922 10
    27 ALLALGRWTGTYIYDHL 941–957 17
    28 GLRDLAVAVEPIIFSPMEKKVI 967–988 22
    29 WGAETAACGDILHGLPVSARLG 990–1011 22
    30 LLGPADGYTSKGW 1015–1027 13
NS2 and NS3 junction
    31 LLAPITAYAQQTRGLLG 1029–1045 17
NS3
    32 GVLWTVYHGAGNKTLAG 1080–1096 17
    33 RGPVTQMYSSAEGDLVGW 1098–1115 18
    34 CGAVDLYLVTRNADVIPARRRGDKRGALLSPRP 1129–1161 33
    35 STLKGSSGGPVLCPRGH 1163–1179 17
    36 CSRGVAKSIDFIPVE 1189–1203 15
    37 PPAVPQTYQVGYLHAPTGSGKSTKVPVAYA 1220–1249 30
    38 QGYKVLVLNPSVAATLGFGAYL 1251–1272 22
    39 KAHGINPNIRTGVRTV 1274–1289 16
    40 ITYSTYGKFLADGGC 1295–1309 15
    41 GAYDIIICDECH 1312–1323 12
    42 LGIGTVLDQAE 1331–1341 11
    43 AGVRLTVLATATPPGS 1343–1358 16
    44 IKGGRHLIFCHSKKKCDELAAALR 1389–1412 24
    45 MGLNAVAYYRGLDVS 1414–1428 15
    46 QGDVVVVATDALMTG 1433–1447 15
    47 TGDFDSVIDCNVAV 1449–1462 14
    48 VDFSLDPTFTI 1466–1476 11
    49 TQTVPQDAVSRSQRRGRTGRGR 1478–1499 22
    50 YRYVSTGERASGMFDSV 1503–1519 17
    51 NTPGLPVCQDHLEFWEAV 1548–1565 18
    52 AYQATVCARAKAPPPSWD 1592–1609 18
    53 GPTPLLYRLG 1624–1633 10
    54 TKYIATCMQADLE 1646–1658 13
NS3 and NS4a junction
    55 MTSTWVLAGGVLAA 1660–1673 14
NS4a
    56 AAYCLATGCVSIIGRLH 1675–1691 17
NS4a and NS4b junction
    57 VVAPDKEVLYEAFDEMEECAS 1697–1717 21
NS4b
    58 QRIAEMLKSKIQGLLQQASKQAQD 1726–1749 24
    59 QASWPKVEQFWA 1755–1766 12
    60 HMWNFISGIQYLAGLS 1768–1783 16
    61 LPGNPAVASMMAFSAA 1785–1800 16
    62 TSPLSTSTTILLNI 1802–1815 14
    63 GGWLASQIAPPAGATGFVVSGLVGAA 1817–1842 26
    64 GLGKVLVDILAGYGAGISGALVAFKIMSGEKPSMEDV 1847–1883 37
    65 NLLPGILSPGALVVGVICAAILRRHVGPGEGAVQWMNRLIAFASRGNHVAPTHYVTESDASQRVTQLLGSLTITSLLRRLHNWITEDCP 1885–1973 89
NS5
    66 GSWLRDVWDWVCTILTDFKNWLTSKLFPK 1978–2006 29
    67 TRCPCGANISGNVR 2031–2044 14
    68 GSMRITGPKTCMN 2046–2058 13
    69 WQGTFPINCYTEGQC 2060–2074 15
    70 TAIWRVAASEYAEVT 2084–2098 15
    71 PSPEFFSWVDGVQIHRFAPTPKPFFRDEVSF 2121–2151 31
    72 AARRLARGSPPSEASSS 2190–2206 17
    73 SQLSAPSLRATC 2208–2219 12
    74 WARPDYNPPLVE 2288–2299 12
    75 VAGCALPPPK 2311–2320 10
    76 SSMPPLEGEPGDPDLE 2390–2405 16
    77 SDSGSWSTCSEE 2424–2435 12
NS5a and NS5b junction
    78 VCCSMSYSWTGALITPC 2440–2456 `17
NS5b
    79 LSNSLLRYHNKVY 2468–2480 13
    80 YDSVLKDIKLAASKVSAR 2506–2523 18
    81 LTPPHSARSKYGFGA 2533–2547 15
    82 QTPIPTTIMAKNEVFCV 2573–2589 17
    83 ARLIVYPDLGVRVCEKMALYD 2599–2619 21
    84 SYGFQYSPAQRVE 2632–2644 13
    85 DPMGFSYDTRCFDSTVTERDIRTEE 2655–2679 25
    86 CGYRRCRASGVLTTSMGNTITCYVKALAACKAAGIVAPTMLVCGDDLVVISESQG 2716–2770 55
    87 EEDERNLRAFTEAMTRYSAPPGDPPRPEYDLELITSCSSNVSVA 2772–2815 44
    88 RRYYLTRDPTTP 2822-2833 12
    89 ARAAWETVRHSP 2835–2846 12
    90 NSWLGNIIQYAPT 2848–2860 13
    91 QDTLDQNLNFEMYG 2878–2891 14
    92 ALRKLGAPPLR 2930–2940 11
    93 WKSRARAVRASLIS 2942–2955 14
    94 CGRYLFNWAVKTKLKLTPLPEAR 2963–2985 23
    95 LDLSSWFTVGAGGGDI 2987–3002 16
    96 VGVGLFLLPAR 3023–3033 11
a

Amino acid numbering according to JFH-1 polyprotein (49).

Enhanced virus protein synthesis correlates with alternations of host translation initiation factors.

The replicative capability of viruses is often determined by comparative quantitation of virus expression products. On day 5 postinfection, Mutantm and Mutantl produced significantly higher numbers of genome copies (P < 0.01 and P < 0.001, respectively) than the parent. The number of genome copies produced by Mutanth was comparable to that of the parent (Fig. 6A). The immunofluorescence signal in Mutantl was higher than that of the parent, while signal intensities were similar for Mutanth and the parent (Fig. 6B). On densitometry analysis, the immunofluorescence signal (anti-NS5A) from infection with Mutantl was significantly higher than that from Mutanth and parent infections (P < 0.001) (data not shown). Cells infected with Mutantl and Mutantm showed increased levels of core and NS3 protein expression compared to cells infected with the parent (Fig. 6C). Mutanth expressed virus proteins at levels similar to those for the parent. In previous studies, HCV genome translation has been shown to shut off host protein synthesis, which is 5′ cap dependent without affecting internal ribosome entry site (IRES)-dependent viral protein synthesis (20). In the case of Mutantl and Mutantm virus infections, expression levels of eIF2α and eIF3β and host translation initiation factors decreased (Fig. 6D). In agreement with previous studies, a decrease in eIF2α level was associated with an increase in phosphorylated eIF2α. No difference in eIF2α or eIF3β levels was found for Mutanth or the parent virus at day 5 postinfection (Fig. 6C). The enhanced growth kinetics of mutant viruses in hepatoma cells was associated with decreased host cell protein synthesis and increased eIF2α phosphorylation, as reported by other studies (20).

FIG 6.

FIG 6

Mutanth (passage 53 virus), Mutantm (passage 53 virus), Mutantl (passage 67 virus), and parent RNA (passage 53 virus) expression product profiles and their effect on host translation initiation factors upon infection. Huh7.5 cells were mock infected or infected with mutants and parent at an MOI of 0.04. (A) Extracellular HCV genome copy levels (quantified by real-time RT-PCR). Significant differences in genome copy levels between mutants and parent are indicated with asterisks (**, P < 0.01; ***, P < 0.001). n.s., not significant. (B) Cells were fixed with 4% PFA and stained with mouse monoclonal NS5A antibody, followed by secondary staining with goat anti-mouse antibody 568 and with DAPI. Scale bar, 50 μm (all panels). (C) Cell lysates normalized to the amount of cellular protein were resolved on SDS-PAGE gels and stained by Western blotting using anti-core and anti-NS3 antibodies. (D) Cell lysates on Western blots were stained with anti-eIF3β, anti-eIF2α, and anti-eIF2α-phospho antibodies.

Rearrangement of noncovalent interactions in mutant structures compensates for loss of short-range interactions.

Predictive structural analysis of NS3 protein was used as a proof of concept to understand how selected, putative adaptive mutations benefitted the virus and how mutant viruses remained viable and productive. The predicted structures of NS3 of three mutants obtained from Robetta were of high quality, as the sequence identity between the parent sequence and mutants was 97.94%. Among the five models provided by Robetta, the first model (Model1) was used for comparison, as the error per residue (in angstroms) was below 0.5 Å. The quality of the model was reassessed by plotting Ramachandran plots, and the models were found to have 99.8% of the residues generally allowed in regions of the plot. PROCHECK analysis was performed for all the predicted models, and the quality of the model obtained was comparable to that in the range of a medium- to high-resolution X-ray crystal structure. The resultant structures (Fig. 7) show the positions of mutations in the conserved regions (residues colored red) and in the nonconserved regions (residues colored blue) of NS3 (Table 4).

FIG 7.

FIG 7

Mutant structures and locations of the putative adaptive mutations in NS3 protein. The predicted model structures of Mutanth, Mutantm, and Mutantl are in cartoon representation showing the conserved (residues colored red) and nonconserved (residues colored blue), where the mutations are located in D1, D2, D3, and protease domain. Some mutations in Mutantm and Mutantl are located in the D1-D3 connecting region. Details of mutations are given in Table 4.

TABLE 4.

Spatial location of putative adaptive mutations in NS3 protein

Mutant Residue change in conserved regions (aa position in polyprotein)a Residue change in nonconserved regions (aa position in polyprotein)b Location
Mutanth F238L (1268) D1 domain
I286T (1316) D1 domain
D290G (1320) D1 domain
K373R (1403 RNA entry site
D396G (1426) RNA entry site
V567A (1597) D3 domain
I17T (1047) D1 domain
D25N (1055) Protease domain
D296G (1326) Protease domain
Mutantm C292Y (1322) D1 domain
I426T (1456) D2 domain
S188G (1218) D1-D3 connecting region
V295A (1325) D1-D3 connecting region
T505A (1535) D3 domain
R514G (1544) D1-D3 connecting region
Mutantl A78T (1108) Protease domain
K122R (1152) Protease domain
C289R (1319) D1 domain
V511A (1541) D1-D3 connecting region
a

Colored red in Fig. 5A and 7.

b

Colored blue in Fig. 5A and 7.

Plaxco and coworkers showed that contact order (CO) is a first-principle-based method to quantify the global protein topology, where the values obtained are correlated with folding rates in proteins (21). In other words, CO measures the stability of a protein by capturing long-range and short-range interactions. It has been shown that CO values in mutant structures are significantly higher than those in native structures (22). In the case of NS3 proteins of the native and mutants, we used a similar approach to quantify the changes in the structure by analyzing short-range interactions such as main chain-main chain hydrogen bonds and ionic interactions and long-range interactions such as hydrophobic interactions (Table 5). CO values of the NS3 protein of all three mutants were similar to (or slightly higher than) that of native NS3. This correlated with existing reports (23, 24) that to compensate for the loss of short-range covalent interactions, there is rearrangement of noncovalent interactions (short range and long range) to maintain the stability of the protein to function optimally.

TABLE 5.

Contact order of short-range and long-range interactions in NS3 native and mutant structures

Protein CO value for:
Main chain-main chain hydrogen bond interactions Ionic interactions Hydrophobic interactions
Native 16.70365 5.05713 35.81775
Mutanth 18.01585 5.538827 37.85895
Mutantm 18.03011 6.022187 38.99208
Mutantl 18.02536 7.019017 37.22979

DISCUSSION

The experimental genome-wide mutation rate for HCV has been shown to range between 10−3and 10−4 nucleotide substitutions per base per replication (25 – 27). The genetic heterogeneity and complexity of the resultant mutant clouds of HCV are dynamic, though they collectively contribute to traits of the virus, such as chronic infection and adaptation to the evolving host immune response and other adverse conditions, such as the presence of an antiviral drug (9, 28, 29). Mutant libraries, which contain a heterogeneous mixture of viral genomes, such as those generated in this study, are useful tools to understand the role of the sequence space available to HCV in adaptation and evolution. Using our chosen method, FL-MRS, through a stepwise reduction in template amount or one nucleoside triphosphate, we induced mutations at proportions of 0.4 to 66 per 10,000 bp. The mutant libraries provided us an overview of genetic flexibility in the HCV genome and its encoded proteins for virus replication. Our findings suggest that the HCV genome may readily tolerate mutations even at a high proportion and that the majority of putative adaptive mutations are in the nonstructural region of the viral genome. The mutants allowed us study their phenotypic characteristics, such as replication rate, in vitro infectivity, and host protein synthesis.

The FL-MRS technique reduces the fidelity of Taq DNA polymerase in a controllable fashion to induce random mutations during the synthesis of full-genome templates and virus transcripts (15). The products of EP-PCR are ideal for the synthesis of transcripts of a defined length, since EP-PCR uses a forward primer located upstream of the T7 promoter and a reverse primer that ends precisely at the last nucleotide of the HCV genome in the cDNA clone. Genome-wide insertional mutagenesis has been widely applied in recent years to understand genome tolerance in ss(+) RNA viruses, such as HCV (30), dengue virus (31), and Venezuelan equine encephalitis virus (32). These studies revealed insights of functional profiling of HCV as a demonstration of genome tolerance (30) and discovered tolerant sites for insertion of a reporter tag (31). However, insertional mutagenesis leads to a net increase in length of the gene of interest, a sequence heterogeneity alien to ss(+) RNA virus genomes. Insertional mutagenesis is also laborious and time-consuming, involves bacterial transformation and ligation of plasmids, and is difficult to iterate. In comparison, our FL-MRS method provides a simple, rapid, and bacterium-free approach, except that it requires careful primer design and initial optimization of EP-PCR conditions for amplification of the target genome of interest.

The generated full-genome mutant libraries allowed us decipher the relationship between the proportions of mutations and viability. Parent virus established infection in >90% of cells upon transfection (day 3), whereas the few FFU yielded by the genomes of libraries that were closest to the parent sequence suggest that most new mutations impose structural and functional constraints on the genome (33, 34). The correlation between the increase in proportions of mutations among libraries that are genetically closer to the parent (i.e., libraries with low proportions of mutations) and the decrease in their viable-genome fractions suggests increased deleterious/lethal effects of mutations on genome viability. The fact that genomes of libraries not closely similar to the parent genome (i.e., libraries with high proportions of mutations) are replication competent despite high proportions of mutations indicates that the HCV genome (i) is capable of overcoming lethal/deleterious mutational effects, (ii) can tolerate a high mutation count, and (iii) can retain viability. Initial failures to rescue viable Mutanth and Mutantm variants reflect deep structural and functional constraints imposed by the mutations in these hypermutated genomes.

HCV causes chronic infection and is constantly exposed to immune pressure in the infected individual. Therefore, the virus genome needs to fix beneficial amino acids in order to escape from the host immune pressure and antiviral exposure but also remain viable and infectious. We identified putative adaptive mutations mostly in regions of the NS2 to NS5A genes, which represent ∼60% of the entire genome. High nonsynonymous-to-synonymous substitution ratios for the mutants signify the strong selection pressure for nonsynonymous mutations over synonymous mutations. Earlier, serially passaged wild-type murine hepatitis virus (WT-MHV) acquired 17 nonsynonymous changes out of 23 mutations (35). In our study, the experimental determination of the nonsynonymous-to-synonymous substitution ratios was possible due to not only the extreme supply of mutations but also the mutational tolerance in protein regions, which may impart a large adaptation potential along with conservation of phenotypic traits. Viruses develop mutations, termed second-site compensatory mutations, to compensate for and restore phenotypic traits such as infectivity and replication (36). The putative adaptive mutations found in mutants might be compensatory and conferred phenotypic traits. To identify conserved and nonconserved regions in the sequence space of the HCV genome, we considered 16 genotype 2a full-genome sequences, which may not have captured sufficient sequence diversity. The absence of a majority (90%) of putative adaptive mutations (found in genomes of all three mutants at the last passage) in natural subtype 2a isolates indicates that these mutations are unlikely to be generated in a replication cycle with the parental sequence. Genomes with artificially increased mutations away from parental sequence may remain viable by the selection of random, beneficial mutations.

Mutantm and Mutantl variants were associated with increased replicative capability evidenced by enhanced levels of genome copy and viral proteins, while Mutanth expression levels were comparable to those of the parent. HCV proteins are multifunctional and interact with each other and multiple host proteins (37). Enhanced replication in association with beneficial mutations may benefit IRES-dependent viral RNA translation and substantially subverted cap-dependent host RNA translation, and this subversion has been associated with increased phosphorylation of the α subunit of eukaryotic initiation factor 2 (eIF2α) (17, 37) and decreased levels of eIF2α and eIF3β. Random, beneficial mutations might contribute to differences in core and NS3 expression levels of mutants and modulation of host protein synthesis. We do not rule out the possibility of gaining adaptive changes and translational efficiency during passages of the three mutants. Mutants were blocked from entry by anti-CD81 and anti-Claudin-1 (at 5.0 μg each; data not shown), which indicates that the mutant viruses followed the classical HCV entry pathway.

Mutants from the libraries of proviral HIV plasmids with random mutations in the envelope (Env) gene when subjected to viral growth in cell culture were shown to undergo strong purifying selection against stop codons and many nonsynonymous mutations; portions of the Env protein shown to gain beneficial mutations and virus remained infectious (33). We also made similar observations, purging out stop codons and deletion-containing genomes and nonsynonymous changes that may not have functional benefits during serial passages of the Mutanth population. Insertional mutagenesis revealed that genes coding for hemagglutinin (HA) and NS1 proteins of influenza virus (38) and the NS1 protein of dengue virus (31) are more tolerant than other parts of their genomes. We identified mutations in the genomes of mutants other than those in the 5′ UTR and the core and NS5B genes (except one mutation in Mutanth). However, in complete contrast, these three regions were shown to have high tolerance for 15-nucleotide (nt) insertions (30).

To understand the impact of putative adaptive mutations on virus protein structure and function, we chose the NS3 protein and performed predictive structural analysis. NS3 contains a helicase domain and an appended serine protease domain, playing a critical role in virus replication that makes it an important drug target (3). Proteins upon mutation undergo subtle rearrangements of interactions, which can be short range (main chain-main chain interactions and ionic interactions) or long range (hydrophobic interactions), which may impose functional and structural constraints (39, 40). To remain functional, these new interactions must compensate for the loss of interactions due to the mutation. Similar quantitated data of long-range and short-range interactions for native (parent) and mutant structures suggest that selected random, beneficial mutations in the NS3 sequence space restored NS3 protein function and stability. Similarly, deep mutational scanning effectively selected for beneficial mutations with long-range changes that led to functional Env (33, 41).

The full-genome mutant libraries used in this study represent artificial genetic tools; nevertheless, libraries enabled cross dissection of spatially resolved sequence information for comprehensive analysis of mutational tolerance in the HCV genome. The data presented in this study were derived from a limited number of viable variants but certainly reflect variant selection strategy for adaptation. Future studies involving endpoint dilution and infection strategy (42) for the isolation of multiple single variants may help us better understand the mutational tolerance in the HCV genome; however, that is unlikely to alter the overall stance of our study findings.

In summary, this paper documents the ability of the HCV genome to overcome deleterious/lethal mutations by selection of random, beneficial mutations and to remain viable because of a high reproduction rate. Our ability to experimentally increase the mutations in the HCV genome and infect cells in vitro with the genomes so generated, combined with advanced sequencing technologies, has given rise to new opportunities to study the evolution of HCV and direct antiviral resistance.

MATERIALS AND METHODS

Plasmids and Huh7.5 cell culture.

Plasmid pJFH-1, encoding an HCV genotype 2a strain (13), and pJFH-1/GND, a replication-deficient GND control (GDD catalytic motif of NS5B mutated to GND) were kind gifts from Takaji Wakita, University of Tokyo. Huh7.5 cells and pJ6/JFH-1 were obtained as a kind gift from Charles Rice, Rockefeller University (14). Huh7.5 cells were cultured at 37°C in 5% CO2 using Dulbecco’s modified Eagle medium (DMEM; Invitrogen) supplemented with 10% heat-inactivated fetal bovine serum (FBS; Invitrogen), 100 U/ml penicillin, and 100 μg/ml streptomycin.

Synthesis and sequencing of full-genome mutant libraries.

The full-length (FL) JFH-1 or J6/JFH-1 genome was randomly mutagenized using error-prone PCR (EP-PCR) to create full-genome mutant libraries. A 9,737-bp-long fragment consisting of the FL HCV genome was amplified in a 50-μl reaction mixture containing primers J-For (5′-GTTTTCCCAGTCAGCACGTTGTAAAACGACGGC-3′) (33 mer; located 8 nt upstream of the T7 promoter sequence) and J-Rev (5′-CATGATCTGCAGAGAGACCAGTTACGGCACTCTC-3′) (34 mer; located at the end of the 3′ UTR of the HCV genome) at 0.2 μM (each), 1.5 mM MgCl2, 2 μl KB Extender, 2 U Platinum Taq DNA polymerase (Invitrogen), dNTPs at a final concentration of 0.2 mM, and 100-, 50-, 25-, and 10-ng amounts of template. The resultant full-genome libraries were designated 100 ng 0.2AGCT, 50 ng 0.2AGCT, 25 ng 0.2AGCT, and 10 ng 0.2AGCT. EP-PCRs with 10 ng template were further imbalanced with final concentrations of dATP at 0.15 and 0.10 mM and the other three dNTPs at a final concentration of 0.2 mM. The resultant full-genome libraries from these reactions were designated 10 ng 0.15A-0.2GCT and 10 ng 0.10A-0.2GCT. The cycling conditions were as follows: 1 cycle of 2 min at 94°C; 30 cycles of 30 s at 94°C, 25 s at 60°C, and 8 min at 72°C; and 1 cycle of 10 min at 72°C. The EP-PCR products were separated using a 0.8% agarose gel, and yields were measured against known amounts of a 1-kb DNA ladder. The 100 ng 0.2AGCT, 50 ng 0.2AGCT, and 25 ng 0.2AGCT libraries (from pJFH-1) synthesized from three independent EP-PCRs were pooled and digested with restriction enzymes EcoRI and NotI and released 2.96-kb fragments cloned into a compatible vector, and bacterial colonies positive for the insert were subjected to Sanger sequencing. A total of 50,000 nt of sequence data per library was obtained. The parent was also subjected to Sanger sequencing. The 10 ng 0.2AGCT, 10 ng 0.15A-0.2GCT, and 10 ng 0.10A-0.2GCT libraries (from pJ6/JFH-1) synthesized from three independent EP-PCRs were pooled and purified using a MinElute PCR purification kit (Qiagen) and submitted for Illumina-based next-generation sequencing (NGS) at the Xcelris Genomics, Ahmedabad, India. Insertion of pJ6/JFH-1 (released by digestion with EcoRI and XbaI) was subjected to NGS to assess background errors imparted by the Illumina platform. Trimmomatic-0.30 was used for quality filtration to generate high-quality data, and the quality value (QV) was set to ≥20. Raw reads from all four conditions were processed using an NGS QC toolkit (43) to exclude those with an average Phred quality score below 30. For each condition, 1,000,000 read pairs were extracted randomly 4 times, resulting in 16 subsets. Read pairs in each subset were aligned against the J6/JFH-1 sequence using a BWA aligner (44). Reads that did not align with the parent were filtered out. The resulting SAM alignment files were converted to BAM format and subsequently sorted and indexed using SAMtools (45). Base counts at individual positions were done using the bam-read count tool (https://github.com/genome/bam-readcount), with a minimum mapping quality of 20 and a minimum base quality of 20. Proportions of reads with A, G, C, and T at each location under each of the four conditions were tabulated, and the rates of misincorporation of individual bases were assessed.

Viral RNA synthesis.

One microgram of column-purified (10 ng of the 0.2 AGCT library was vacuum concentrated) EP-PCR products and XbaI-linearized plasmid DNA (pJFH-1 and pJFH-1/GND) were subjected to in vitro transcription per the instructions of the manufacturer (RiboMAX large-scale RNA production system; T7) (Promega). RNase-free DNase-treated transcripts were then purified using an RNA cleanup procedure, and their integrity was analyzed in a 0.8% 3-(N-morpholino)propanesulfonic acid formaldehyde-denaturing agarose gel.

Transfection of Huh7.5 cells.

To determine the relative replicative capabilities of six mutant libraries, Huh7.5 cells at 70% confluence (achieved 16 h after seeding) in 35-mm culture dishes were transfected with 5 μg of normalized viral FL transcripts using Lipofectamine 2000 (Invitrogen) and incubated in complete DMEM supplemented with 3% FBS. At 3 days posttransfection, virus-infected foci were determined using a focus-forming assay (FFA) and results were expressed in number of focus-forming units (FFU) per 100,000 target cells. Anti-NS5A monoclonal antibody (9E10) was used for detection of FFU as described below. Parent RNA (pJFH-1) was the positive control, and JFH-1/GND was the negative control of replication. One FFU was defined as 1 or more NS5A-positive cells, separated from other NS5A-positive cells by at least 2 NS5A-negative cells. Posttransfection, percentages of NS5A-positive cells were indicated in cases of virus spread reaching >50%.

Isolation of mutants with altered HCV growth.

To isolate HCV mutants, serial passage of HCV was initiated on Huh7.5 cells at 70% confluence in a 35-mm cell culture dish. Cells were transfected with selected libraries, i.e., 10 ng 0.10A-0.2GCU, 10 ng 0.2AGCU, 50 ng 0.2AGCU, parent, or mock. Multiple transfections of mutant libraries were done; however, transfected cells did not survive due to cytotoxicity induced by rapid virus spread, especially between passages 7 and 10. All virus passages and sequence data shown are from a single transfection experiment where cells supported sustained virus replication. Cells transfected with 50 ng 0.2AGCU and parent were passaged at 1:3 split for 67 and 53 passages, respectively. Cells transfected with 10 ng 0.1A-0.2GCU and 10 ng 0.2AGCU libraries were scaled up as shown in Fig. 3A. Before cell split, virus supernatants were harvested and stored at –80°C for further analysis. At 3 weeks prior to the last passage (passage 53 for 10 ng 0.1A-0.2GCU, 10 ng 0.2AGCU, and parent libraries, and passage 67 for 50 ng 0.2AGCU library), viral RNA was isolated using a QIAamp viral RNA minikit (Qiagen) from all virus passages, cDNAs were synthesized using Superscript III reverse transcriptase (Invitrogen), the NS3 gene was amplified (coding nt 3080 to 4796) using high-fidelity PCR, and products were column purified, with an “A” overhang added, followed by another round of purification, ligated with TA vector, and used to transform Escherichia coli DH5a. The NS3 gene was amplified and cloned as described above from virus passages 0 (input), 17, 47, and 53 of the 10 ng 0.10A-0.2GCU library. Before the last virus passage, transfected cells were expanded; large volumes of virus supernatants were collected and stored. Virus supernatants were concentrated, as indicated, using 100-kDa-molecular-size-cutoff centrifugal filters. Virus titers were determined using the 50% tissue culture infectious dose (TCID50) method, and the complete genome sequence of the predominant variant was determined by Sanger sequencing. In parallel, mock-transfected cells were maintained to monitor contamination of cells with virus.

Infectious virus titer determination.

For titration of infectious HCV, an FFA was performed on Huh7.5 cells as described previously (14). Briefly, serially diluted virus supernatants applied to 6.5 × 103 Huh7.5 cells were plated in a 96-well plate (seeded 16 h prior to infection). Three days postinfection, the cells were washed twice with phosphate-buffered saline (PBS), fixed, permeabilized with ice-cold methanol, washed three times again, and incubated in blocking solution (PBS-T containing 1% bovine serum albumin and 0.2% skim milk) for 30 min at room temperature. Endogenous peroxidase activity was blocked by incubating the cells with 3% H2O2 in PBS for 5 min. The cells were then incubated for 1 h with 1:20,000-diluted anti-NS5A mouse monoclonal antibody (MAb) 9E10 (stock was 1 mg/ml; a gift of Charles Rice, Rockefeller University), washed three times in PBS-T, and incubated with horseradish peroxidase (HRP)-conjugated goat anti-mouse IgG (1:4,000 dilution), followed by incubation with 3,3′-diaminobenzidine (DAB) substrate. FFU were visualized using a light microscope, and the TCID50 was determined (46).

Huh7.5 cell infections.

Naïve Huh7.5 cells, 0.4 × 106, were mock infected or infected with mutant viruses or the parent at a fixed TCID50 of 16,000 (multiplicity of infection [MOI] of 0.04). Cells and supernatants were collected on day 5 postinfection.

Quantification of HCV genome using qRT-PCR.

Quantitative reverse transcription-PCR (qRT-PCR) was carried out to quantify genome copies in virus supernatants. Viral RNA was isolated using a QIAamp viral RNA minikit (Qiagen) and subjected to qRT-PCR using a TaqMan RNA-to-CT 1-step kit (Invitrogen), per the manufacturer’s instructions, and previously described primer (R6-130-S17 and R6-290-R19) and probe (R6-148-S21FT) sequences (47). Run conditions were as follows: 48°C for 20 min, 95°C for 10 min, and then 40 cycles of 95°C for 15 s and 60°C for 1 min. A standard curve was obtained with known amounts of HCV transcripts used for quantification. Negative controls (without template RNA and RNA from mock-infected cells) were run in parallel with each reaction to ascertain the absence of contamination with undesired templates.

Western blotting.

At day 5 postinfection, cells were pelleted by centrifugation and lysed in radioimmunoprecipitation assay buffer at 4°C for 15 min. The protein concentration was estimated with the Bradford assay reagent (Pierce), and the lysates were resolved by electrophoresis on 12% SDS polyacrylamide gels and then electroblotted onto polyvinylidene difluoride membranes (Millipore, Billerica, MA). Viral and cellular proteins were detected by overnight incubation at 4°C with one of the following primary antibodies: mouse MAb core (C7-50; diluted 1:3,000), mouse MAb NS3 (1:2,000), rabbit polyclonal Ab eIF3β (1:1,000), mouse MAb eIF2α (1:200), and rabbit polyclonal Ab eIF2α phospho specific (Invitrogen) (1:500). After washing, the blots were exposed to 1:3,000-diluted appropriate secondary antibodies conjugated with HRP for 1 h at room temperature. The reaction products were visualized using enhanced chemiluminescence reagent (Bio-Rad) according to the manufacturer’s instructions. The loading control was β-actin.

Immunofluorescence assay.

At day 5 postinfection, cells were fixed in 4% paraformaldehyde and permeabilized with PBS containing 0.1% Triton X-100 for 5 min and washed three times for 5 min each in PBS. Nonspecific antigens were blocked (3% bovine serum albumin and 10% normal goat serum in PBS), and the cells were incubated with anti-NS5A MAb (1:25,000) (9E10) at room temperature for 2 h and then washed three times for 5 min each in PBS. This was followed by incubation with secondary antibody conjugated to Alexa Fluor 568 for 30 min and counterstaining with 1 μg/ml 4′,6-diamidino-2-phenylindole (DAPI). After washes, the coverslips were mounted on slides, which were then analyzed by fluorescence microscopy, using a Nikon A1 spinning-disk confocal microscope. Densitometry analysis of immunofluorescence staining was performed on digitized images using ImageJ.

Blocking of HCV entry.

Anti-CD81 (clone M38) and anti-Claudin-1 (clone 2H10D10) MAbs were purchased from Invitrogen. Huh7.5 cells seeded in 48-well plates 16 h earlier were mock treated or treated with 0.5, 1.0, 2.5, and 5.0 μg of anti-CD81 and anti-Claudin-1 for 30 min at 37°C and 5% CO2 with intermittent shaking (twice) for 2 min and then infected at an MOI of 0.04 with parent or mutant viruses. Infection was quantified 3 days later by an FFA.

HCV genome sequencing.

Genomes of HCV mutants from the last passages of all libraries and the parent were isolated from 140 μl of cell culture supernatant using a QIAamp viral RNA extraction kit (Qiagen). cDNAs were synthesized from 5 μl of undiluted or 1:5-diluted eluates using Superscript III (Invitrogen), and the complete genome was PCR amplified in 12 overlapping fragments. Primer sequences have been described previously (48). Carryover contamination was monitored using negative controls. Chromatograms were processed, sequences were assembled, and contigs were generated using the CLC Main Workbench.

Shannon entropy.

Sequence conservation among 16 full-length HCV subtype 2a sequences (derived from the HCV sequence databases of the LANL and euHCVdb) was measured using entropy. The entropy score for each amino acid site was calculated by using the Shannon Heterogeneity In Alignments Tool v1.0 (http://evolve.zoo.ox.ac.uk/Evolve/SHiAT.html) (19). Amino acids are numbered relative to the JFH-1 polyprotein (GenBank accession number AB047639) (49).

Mutant structure prediction and CO calculations.

The three-dimensional (3D) structures of the NS3 proteins of Mutanth, Mutantm, and Mutantl were determined using the Robetta method (http://new.robetta.org) to obtain high-quality structures (50). For the three mutants, the template used was the native structure, JFH-1, whose coordinates were retrieved from the Protein Data Bank (PDB ID 5WDX). By use of a comparative modeling approach, a sampling of 1,000 models was obtained. Contact order (CO) calculations were performed as described previously (21). Specifically, the total list of noncovalent interactions was taken and the distance between interacting residues (in terms of sequence numbers) was calculated. The sum of all distances was divided by the total length of the NS3 protein (631 residues) for normalization. The Protein Interactions Calculator (http://pic.mbu.iisc.ernet.in/job.html) tool (51) was used to identify main chain-main chain hydrogen bonds, ionic interactions, and hydrophobic interactions in the NS3 structures of the parent and mutants.

Statistical analysis.

All statistical analyses were performed by using GraphPad Prism7. The Kruskal-Wallis test followed by post hoc analysis by Dunn’s test was used for multiple comparisons.

Data availability.

The models are deposited in ModelArchive (Mutanth, https://www.modelarchive.org/doi/10.5452/ma-o9v3l; Mutantm, https://www.modelarchive.org/doi/10.5452/ma-r30z5; Mutantl, https://www.modelarchive.org/doi/10.5452/ma-3ybvk).

ACKNOWLEDGMENTS

We are grateful to Jordan Feld (Toronto Center for Liver Disease) for useful discussions.

This study was supported by grant BT/PR10906/MED/29/860/2014 to N.S.V. and R.A. from the Department of Biotechnology, Ministry of Science and Technology, Government of India. D.S., S.S., and S.K. were supported by graduate scholarships from Shiv Nadar University.

No author has any financial, professional, or personal potential conflicts that are relevant to the article.

REFERENCES

  • 1.World Health Organization. 2017. Global hepatitis report. World Health Organization, Geneva, Switzerland. [Google Scholar]
  • 2.Westbrook RH, Dusheiko G. 2014. Natural history of hepatitis C. J Hepatol 61:s58–s68. doi: 10.1016/j.jhep.2014.07.012. [DOI] [PubMed] [Google Scholar]
  • 3.Manns MP, Buti M, Gane E, Pawlotsky JM, Razavi H, Terrault N, Younossi Z. 2017. Hepatitis C virus infection. Nat Rev Dis Primers 3:17006. doi: 10.1038/nrdp.2017.6. [DOI] [PubMed] [Google Scholar]
  • 4.Smith DB, Bukh J, Kuiken C, Muerhoff AS, Rice CM, Stapleton JT, Simmonds P. 2014. Expanded classification of hepatitis C virus into 7 genotypes and 67 subtypes, updated criteria assignment web resource. Hepatology 59:318–327. doi: 10.1002/hep.26744. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Eigen M. 1971. Self-organization of matter and the evolution of biological macromolecules. Naturwissenschaften 58:465–523. doi: 10.1007/bf00623322. [DOI] [PubMed] [Google Scholar]
  • 6.Eigen M, Schuster P. 1977. The hypercycle. A principle of natural self-organization. Part A: Emergence of the hypercycle. Naturwissenschaften 64:541–565. doi: 10.1007/bf00450633. [DOI] [PubMed] [Google Scholar]
  • 7.Forns X, Purcell RH, Bukh J. 1999. Quasispecies in viral persistence and pathogenesis of hepatitis C virus. Trends Microbiol 7:402–410. doi: 10.1016/s0966-842x(99)01590-5. [DOI] [PubMed] [Google Scholar]
  • 8.Neumann AU, Lam NP, Dahari H, Gretch DR, Wiley TE, Layden TJ, Perelson AS. 1998. Hepatitis C viral dynamics in vivo and the antiviral efficacy of interferon-alpha therapy. Science 282:103–107. doi: 10.1126/science.282.5386.103. [DOI] [PubMed] [Google Scholar]
  • 9.Bowen DG, Walker CM. 2005. The origin of quasispecies: cause or consequence of chronic hepatitis C viral infection. J Hepatol 42:408–417. doi: 10.1016/j.jhep.2004.12.013. [DOI] [PubMed] [Google Scholar]
  • 10.Pellerin M, Lopez-Aguirre Y, Penin F, Dhumeaux D, Pawlotsky JM. 2004. Hepatitis C virus quasispecies variability modulates nonstructural protein 5A transcriptional activation, pointing to cellular compartmentalization of virus-host interactions. J Virol 78:4617–4627. doi: 10.1128/jvi.78.9.4617-4627.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Blight KJ, Kolykhalov AA, Rice CM. 2000. Efficient initiation of HCV RNA replication in cell culture. Science 290:1972–1974. doi: 10.1126/science.290.5498.1972. [DOI] [PubMed] [Google Scholar]
  • 12.Lohmann V, Körner F, Koch J, Herian U, Theilmann L, Bartenschlager R. 1999. Replication of subgenomic hepatitis C virus RNAs in a hepatoma cell line. Science 285:110–113. doi: 10.1126/science.285.5424.110. [DOI] [PubMed] [Google Scholar]
  • 13.Wakita T, Pietschmann T, Kato T, Date T, Miyamoto M, Zhao Z, Murthy K, Habermann A, Kräusslich HG, Mizokami M, Bartenschlager R, Liang TJ. 2005. Production of infectious hepatitis C virus in tissue culture from a cloned viral genome. Nat Med 11:791–796. doi: 10.1038/nm1268. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Lindenbach BD, Evans MJ, Syder AJ, Wölk B, Tellinghuisen TL, Liu CC, Maruyama T, Hynes RO, Burton DR, McKeating JA, Rice CM. 2005. Complete replication of hepatitis C virus in cell culture. Science 309:623–626. doi: 10.1126/science.1114016. [DOI] [PubMed] [Google Scholar]
  • 15.Agarwal S, Baccam P, Aggarwal R, Veerapu NS. 2018. Novel synthesis and phenotypic analysis of mutant clouds for hepatitis E virus genotype 1. J Virol 92:e01932-17. doi: 10.1128/JVI.01932-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Qi H, Wu NC, Du Y, Wu TT, Sun R. 2015. High-resolution genetic profile of viral genomes: why it matters. Curr Opin Virol 14:62–70. doi: 10.1016/j.coviro.2015.08.005. [DOI] [PubMed] [Google Scholar]
  • 17.Elena SF, Sanjuán R. 2005. Adaptive value of high mutation rates of RNA viruses: separating causes from consequences. J Virol 79:11555–11558. doi: 10.1128/JVI.79.18.11555-11558.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Contreras AM, Hiasa Y, He W, Terella A, Schmidt EV, Chung RT. 2002. Viral RNA mutations are region specific and increased by ribavirin in a full-length hepatitis C virus replication system. J Virol 76:8505–8517. doi: 10.1128/jvi.76.17.8505-8517.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Humphreys I, Fleming V, Fabris P, Parker J, Schulenberg B, Brown A, Demetriou C, Gaudieri S, Pfafferott K, Lucas M, Collier J, Huang KH, Pybus OG, Klenerman P, Barnes E. 2009. Full-length characterization of hepatitis C virus subtype 3a reveals novel hypervariable regions under positive selection during acute infection. J Virol 83:11456–11466. doi: 10.1128/JVI.00884-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Perales C, Beach NM, Gallego I, Soria ME, Quer J, Esteban JI, Rice C, Domingo E, Sheldon JJ. 2013. Response of hepatitis C virus to long-term passage in the presence of alpha interferon: multiple mutations and a common phenotype. J Virol 87:7593–7607. doi: 10.1128/JVI.02824-12. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Plaxco KW, Simons KT, Baker D. 1998. Contact order, transition state placement and the refolding rates of single domain proteins. J Mol Biol 10:985–994. doi: 10.1006/jmbi.1998.1645. [DOI] [PubMed] [Google Scholar]
  • 22.Rader AJ, Yennamalli RM, Harter AK, Sen TZ. 2012. A rigid network of long-range contacts increases thermosstability in a mutant endoglucanase. J Biomol Struct Dyn 30:628–637. doi: 10.1080/07391102.2012.689696. [DOI] [PubMed] [Google Scholar]
  • 23.Bigman LS, Levy Y. 2018. Stability effects of protein mutations: the role of long-range contacts. j Phys Chem B 122:11450–11459. doi: 10.1021/acs.jpcb.8b07379. [DOI] [PubMed] [Google Scholar]
  • 24.Bandyopadhyay B, Mondal T, Unger R, Horovitz A. 2019. Contact order is a determinant for the dependence of GFP folding on the chaperonin GroEL. Biophys J 116:42–48. doi: 10.1016/j.bpj.2018.11.019. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Abe K, Inchauspe G, Fujisawa K. 1992. Genomic characterization and mutation rate of hepatitis C virus isolated from a patient who contracted hepatitis during an epidemic of non-A, non-B hepatitis in Japan. J Gen Virol 73:2725–2729. doi: 10.1099/0022-1317-73-10-2725. [DOI] [PubMed] [Google Scholar]
  • 26.Ogata N, Alter HJ, Miller RH, Purcell RH. 1991. Nucleotide sequence and mutation rate of H strain of hepatitis C virus. Proc Natl Acad Sci U S A 88:3392–3396. doi: 10.1073/pnas.88.8.3392. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Geller R, Estada Ú, Peris JB, Andreu I, Bou JV, Garijo R, Cuevas JM, Sabariegos R, Mas A, Sanjuán R. 2016. Highly heterogeneous mutation rates in the hepatitis C virus genome. Nat Microbiol 1:16045. doi: 10.1038/nmicrobiol.2016.45. [DOI] [PubMed] [Google Scholar]
  • 28.Farci P, Shimoda A, Coiana A, Diaz G, Peddis G, Melpolder JC, Strazzera A, Chien DY, Munoz SJ, Balestrieri A, Purcell RH, Alter HJ. 2000. The outcome of acute hepatitis C predicted by the evolution of the viral quasispecies. Science 288:339–344. doi: 10.1126/science.288.5464.339. [DOI] [PubMed] [Google Scholar]
  • 29.Pawlotsky JM. 2011. Treatment failure and resistance with direct-acting antiviral drugs against hepatitis C virus. Hepatology 53:1742–1751. doi: 10.1002/hep.24262. [DOI] [PubMed] [Google Scholar]
  • 30.Arumugaswami V, Remenyi R, Kanagavel V, Sue EY, Ho TN, Liu C, Fontanes V, Dasgupta A, Sun R. 2008. High-resolution functional profiling of hepatitis C virus genome. PLoS Pathog 4:e1000182. doi: 10.1371/journal.ppat.1000182. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Eyre NS, Johnson SM, Eltahla AA, Aloi M, Aloia AL, McDevitt CA, Bull RA, Beard MR. 2017. Genome-wide mutagenesis of dengue virus reveals plasticity of the NS1 protein and enables generation of infectious tagged reporter viruses. J Virol 91:e01455-17. doi: 10.1128/JVI.01455-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Beitzel BF, Bakken RR, Smith JM, Schmaljohn CS. 2010. High-resolution functional mapping of the Venezuelan equine encephalitis virus genome by insertional mutagenesis and massively parallel sequencing. PLoS Pathog 6:e1001146. doi: 10.1371/journal.ppat.1001146. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Haddox HK, Dingens AS, Hilton SK, Overbaugh J, Bloom JD. 2018. Mapping mutational effects along the evolutionary landscape of HIV envelope. Elife 28:e34420. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Visher E, Whitefield SE, McCrone JT, Fitzsimmons W, Lauring AS. 2016. The mutational robustness of influenza A virus. PLoS Pathog 12:e1005856. doi: 10.1371/journal.ppat.1005856. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Graepel KW, Lu X, Case JB, Sexton NR, Smith EC, Denison MR. 2017. Proofreading-deficient coronaviruses adapt for increased fitness over long-term passage without reversion of exoribonuclease-inactivating mutations. mBio 7:e01503-17. doi: 10.1128/mBio.01503-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Noviello CM, López CS, Kukull B, McNett H, Still A, Eccles J, Sloan R, Barklis E. 2011. Second-site compensatory mutations of HIV-1 capsid mutations. J Virol 85:4730–4738. doi: 10.1128/JVI.00099-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Walsh D, Mohr I. 2011. Viral subversion of the host protein synthesis machinery. Nat Rev Microbiol 9:860–875. doi: 10.1038/nrmicro2655. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Heaton NS, Sachs D, Chen CJ, Hai R, Palese P. 2013. Genome-wide mutagenesis of influenza virus reveals unique plasticity of the hemagglutinin and NS1 proteins. Proc Natl Acad Sci U S A 110:20248–20253. doi: 10.1073/pnas.1320524110. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Pace CN, Fu H, Fryar KL, Landua J, Trevino SR, Shirley BA, Hendricks MM, Iimura S, Gajiwala K, Scholtz JM, Grimsley GR. 2011. Contribution of hydrophobic interactions to protein stability. J Mol Biol 408:514–528. doi: 10.1016/j.jmb.2011.02.053. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Pace CN, Fu H, Lee Fryar K, Landua J, Trevino SR, Schell D, Thurlkill RL, Imura S, Scholtz JM, Gajiwala K, Sevcik J, Urbanikova L, Myers JK, Takano K, Hebert EJ, Shirley BA, Grimsley GR. 2014. Contribution of hydrogen bonds to protein stability. Protein Sci 23:652–661. doi: 10.1002/pro.2449. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Kwong PD, Wyatt R, Majeed S, Robinson J, Sweet RW, Sodroski J, Hendrickson WA. 2000. Structures of HIV-1 gp120 envelope glycoproteins from laboratory-adapted and primary isolates. Structure 8:1329–1339. doi: 10.1016/s0969-2126(00)00547-5. [DOI] [PubMed] [Google Scholar]
  • 42.Sugiyama N, Murayama A, Suzuki R, Watanabe N, Shiina M, Liang TJ, Wakita T, Kato T. 2014. Single strain isolation method for cell culture-adapted hepatitis C virus by end-point dilution and infection. PLoS One 9:e98168. doi: 10.1371/journal.pone.0098168. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Patel RK, Jain M. 2012. NGS QC Toolkit: a toolkit for quality control of next generation sequencing data. PLoS One 7:e30619. doi: 10.1371/journal.pone.0030619. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Li H, Durbin R. 2010. Fast and accurate long-read alignment with Burrows-Wheeler transform. Bioinformatics 26:589–595. doi: 10.1093/bioinformatics/btp698. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Li H, Handsaker B, Wysoker A, Fennell T, Ruan J, Homer N, Marth G, Abecasis G, Durbin R. 2009. The Sequence Alignment/Map format and SAMtools. Bioinformatics 25:2078–2079. doi: 10.1093/bioinformatics/btp352. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Reed LJ, Muench H. 1938. A simple method of estimating fifty percent end points. Am J Hyg 27:493–497. doi: 10.1093/oxfordjournals.aje.a118408. [DOI] [Google Scholar]
  • 47.Takeuchi T, Katsume A, Tanaka T, Abe A, Inoue K, Tsukiyama-Kohara K, Kawaguchi R, Tanaka S, Kohara M. 1999. Real-time detection system for quantification of hepatitis C virus genome. Gastroenterology 116:636–642. doi: 10.1016/s0016-5085(99)70185-x. [DOI] [PubMed] [Google Scholar]
  • 48.Russell RS, Meunier JC, Takikawa S, Faulk K, Engle RE, Bukh J, Purcell RH, Emerson SU. 2008. Advantages of a single-cycle production assay to study cell culture-adaptive mutations of hepatitis C virus. Proc Natl Acad Sci U S A 105:4370–4375. doi: 10.1073/pnas.0800422105. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Kato T, Furusaka A, Miyamoto M, Date T, Yasui K, Hiramoto J, Nagayama K, Tanaka T, Wakita T. 2001. Sequence analysis of hepatitis C virus isolated from a fulminant hepatitis patient. J Med Virol 64:334–339. doi: 10.1002/jmv.1055. [DOI] [PubMed] [Google Scholar]
  • 50.Kim DE, Chivian D, Baker D. 2004. Protein structure prediction and analysis using the Robetta server. Nucleic Acids Res 32:W526–W531. doi: 10.1093/nar/gkh468. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Tina KG, Bhadra R, Srinivasan N. 2007. PIC: protein interactions calculator. Nucleic Acids Res 35:W473–W476. doi: 10.1093/nar/gkm423. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

The models are deposited in ModelArchive (Mutanth, https://www.modelarchive.org/doi/10.5452/ma-o9v3l; Mutantm, https://www.modelarchive.org/doi/10.5452/ma-r30z5; Mutantl, https://www.modelarchive.org/doi/10.5452/ma-3ybvk).


Articles from Journal of Virology are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES