Skip to main content
IOS Press Open Library logoLink to IOS Press Open Library
. 2020 Jan 7;73(1):217–227. doi: 10.3233/JAD-191016

A New Serum Biomarker Set to Detect Mild Cognitive Impairment and Alzheimer’s Disease by Peptidome Technology

Koji Abe a,*, Jingwei Shang a, Xiaowen Shi a, Toru Yamashita a, Nozomi Hishikawa a, Mami Takemoto a, Ryuta Morihara a, Yumiko Nakano a, Yasuyuki Ohta a, Kentaro Deguchi b, Masaki Ikeda c, Yoshio Ikeda c, Koichi Okamoto d, Mikio Shoji d, Masamitsu Takatama d, Motohisa Kojo e, Takeshi Kuroda f, Kenjiro Ono f, Noriyuki Kimura g, Etsuro Matsubara g, Yosuke Osakada h, Yosuke Wakutani h, Yoshiki Takao h, Yasuto Higashi i, Kyoichi Asada j, Takehito Senga j, Lyang-Ja Lee j, Kenji Tanaka j
PMCID: PMC7029318  PMID: 31771070

Abstract

Background:

Because dementia is an emerging problem in the world, biochemical markers of cerebrospinal fluid (CSF) and radio-isotopic analyses are helpful for diagnosing Alzheimer’s disease (AD). Although blood sample is more feasible and plausible than CSF or radiological biomarkers for screening potential AD, measurements of serum amyloid- β (Aβ), plasma tau, and serum antibodies for Aβ1 - 42 are not yet well established.

Objective:

We aimed to identify a new serum biomarker to detect mild cognitive impairment (MCI) and AD in comparison to cognitively healthy control by a new peptidome technology.

Methods:

With only 1.5μl of serum, we examined a new target plate “BLOTCHIP®” plus a matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) to discriminate control (n = 100), MCI (n = 60), and AD (n = 99). In some subjects, cognitive Mini-Mental State Examination (MMSE) were compared to positron emission tomography (PET) with Pittsburgh compound B (PiB) and the serum probability of dementia (SPD). The mother proteins of candidate serum peptides were examined in autopsied AD brains.

Results:

Apart from Aβ or tau, the present study discovered a new diagnostic 4-peptides-set biomarker for discriminating control, MCI, and AD with 87% of sensitivity and 65% of specificity between control and AD (***p < 0.001). MMSE score was well correlated to brain Aβ deposition and to SPD of AD. The mother proteins of the four peptides were upregulated for coagulation, complement, and plasticity (three proteins), and was downregulated for anti-inflammation (one protein) in AD brains.

Conclusion:

The present serum biomarker set provides a new, rapid, non-invasive, highly quantitative and low-cost clinical application for dementia screening, and also suggests an alternative pathomechanism of AD for neuroinflammation and neurovascular unit damage.

Keywords: Alzheimer’s disease, biomarker, coagulation, complement, MALDI-TOF, mild cognitive impairment, neuroinflammation, peptidome, plasticity

INTRODUCTION

Dementia is an emerging problem in the world [1], where Alzheimer’s disease (AD) occupies more than 65% of dementia in the developed countries, followed by mild cognitive impairment (MCI), vascular dementia (VaD), and other types of dementia [2]. Diagnosis of AD is usually based on clinical criteria, but may be supported by biochemical markers such as a decreased amyloid-β (Aβ) 42 [3], and increased Aβ oligomer [4, 5] and tau protein in cerebrospinal fluid (CSF) [3]. Radiological analyses are also sometimes undertaken as supportive biomarkers of AD with single photon emission computed tomography (SPECT) for evaluating cerebral blood flow [6, 7] and positron emission tomography (PET) for Aβ using Pittsburgh compound B (PiB) [8–10] and tau [11–13]. However, blood samples are more feasible and plausible than CSF or radiological biomarkers for screening emerging number of potential AD and other dementias [14–16]. Several approaches have been reported for measuring serum Aβ [17, 18], plasma phosphorylated-tau [19], and serum miRNA-455-3p [20]. Serum levels of specific antibodies for Aβ1 - 42 monomer and soluble oligomer were not different among normal control, MCI, and AD [21].

Matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) technology can detect small- to medium-sized peptides (1,000–10,000 Da or 10–100 amino acids) in the serum. However, most previous peptidomic analyses required the removal of large amounts of plasma proteins with variable methods before the step of MS analysis, which overlooked hundreds of potentially important endogenous peptides that bind the plasma proteins [22, 23]. In order to compensate such drawbacks of previous peptidomic methodologies, we successfully developed a one-step direct transfer technology using a new target plate “BLOTCHIP®” before MALDI-TOF/MS analysis [24]. Furthermore, this new BLOTCHIP®-MS technology enabled the comprehensive investigation of serum peptides without missing protein-binding peptides, and thus provided a high throughput capacity for discovery of new peptide biomarkers [24]. The aim of the present study was, therefore, to newly discover and validate serum biomarker peptides and to demonstrate the potential usefulness of these candidate peptides for dementia diagnosis.

MATERIALS AND METHODS

Participants and serum

In the present study, participants were prospectively collected at the multicenter, and divided into three groups of cognitively normal control, MCI subject due to AD, and AD patients depending on cognitive function with respect to gender- and age-matching. Cognitive function was examined with Clinical Dementia Rating (CDR) [25, 26] and Mini-Mental State Examination (MMSE) [27]. The participants were clinically evaluated to be cognitively normal, MCI, or AD based on the NINDS-ADRDA criteria [28] or a diagnostic MCI entity [29]. From these participants, 8 ml of blood were collected into a glass test tube (Venoject II, Termo, Japan), which was placed for 1 h at room temperature (RT), and was centrifuged at 1,000 g for 10 min at RT. Resultant supernatant (serum) was divided into 4 Eppendorf tubes (1 ml each) and temporarily stored at –80°C until examination.

BLOTCHIP®-MS analysis

Serum peptidomic analysis was conducted by newly established one-step direct transfer technology “BLOTCHIP®-MS analysis”, a rapid quantitative technology for peptidomic analysis [24]. Serum samples (each 1.5μl) were subjected to 4–12% gradient sodium dodecyl sulfate (SDS)-polyacrylamide gel electrophoresis to separate peptides far from proteins. Next, peptides in the gel were electroblotted onto BLOTCHIP® (Protosera Inc., Osaka, Japan). MALDI matrix, α-cyano-4-hydroxycinnamic acid (CHCA) (Sigma-Aldrich Co., MO, USA), was applied directly onto BLOTCHIP®, and peptidome profiles were obtained in a linear mode of ultrafleXtreme TOF/TOF (Bruker Daltonics Inc. MA, USA), as previously described in detail [30]. All sample measurements were repeated 4 times.

All statistical analyses of MS spectral data were conducted using ClinProTools version 3.0 (Bruker Daltonics). MS spectra obtained were baseline-subtracted, normalized, recalibrated, and peak-picked within the software. Peak heights, which showed significant statistical differences between 2 groups (control subjects versus AD patients), were analyzed using the Wilcoxon test, a nonparametric test for 2-group comparisons. A probability of p < 0.05 was considered statistically significant.

Identification of candidate peptides

Several sera (each 500μl) containing high amount of each peptide were mixed for candidate peptide identification. Peptides were extracted using a Sep-Pak C18 solid-phase extraction cartridge (Waters Corporation, Milford, MA, USA) with 80% (v/v) acetonitrile (ACN) in water containing 0.1% trifluoroacetic acid (TFA), and the eluent was concentrated up to 100μL using a CC-105 centrifugal concentrator (TOMY SEIKO Co, Ltd., Tokyo, Japan). Next, the solution was diluted with 400μL of 2% (v/v) ACN in water containing 0.065% TFA (eluent A) and applied to an ÄKTA purifier (GE Healthcare UK Ltd, Buckinghamshire, England) equipped with a C18 silica-based column (XBridge Shield RP18 2.5 mL, 4.6 mmI.D.*150 mm, Waters Corporation). The eluate was fractionated into 20 fractions (1 mL each) by a liner gradient of 0–100% of 80% (v/v) ACN in water containing 0.05% TFA against eluent A at a flow rate of 1.0 mL/min. Each fraction was concentrated using a CC-105 centrifugal concentrator up to 10μL.

Then the peptide sequences were analyzed using MALDI-TOF/TOF (ultrafleXtreme TOF/TOF) and LC-MS/MS (Fusion; Thermo Fisher Scientific Inc., Waltham, MA, USA). MALDI-TOF/MS was used for smaller peptide with molecular weight (MW) less than 3,500 Da, and LC-MS/MS for larger peptide with MW of 3,500 Da or more. In search of MALDI-TOF/MS data, MASCOT software was used for a “MS/MS ions search”. Parent peptide and MS/MS ions tolerance parameters were set at±100 ppm and±0.7 Da, respectively. In search of LC-MS/MS data, MASCOT program was used (Matrix Science Inc., Boston, USA). Parent peptide and MS/MS tolerance parameters were set at±0.02–0.1 Da and±0.1–0.6 Da. Since relatively large peptides were analyzed with LC-MS/MS, the value of the parent peptide tolerance (±0.02–0.1 Da) was set to allow unanticipated modifications in the sequence. Swiss-Prot sequence database, of which taxonomy was limited to “human”, was selected for the searches. “oxidation”, “phosphorylation”, “N-acetylation”, and “C-cysteinylation” were selected as variable modifications.

PET imaging

Separately from the above serum analysis, 11 subjects (1 control, 3 MCI, and 7 AD) participated Aβ imaging with Pittsburgh compound B (PiB) detected by positron emission tomography (PET). 18F-labeled PiB (Florbetapir) was synthesized with NEPTIS® plug-01, intravenously injected for 9 participants at an Okayama University-affiliated hospital, and 60–90 min later PET images were detected for 30 min. For two AD patients at Oita University, 11C-PiB was injected to take PET images [9, 10]. As the whole cerebellar region of interest (ROI) for reference, an average of standard uptake value (SUV) from 6 cerebral cortical areas were calculated in order to analyze positive or negative for PiB-PET (positive for more than 1, negative for 1 or less). The sera of these 11 subjects were also measured for BLOTCHIP®-MS analysis.

Immunohistochemistry for human brain

After candidate serum peptides were detected, corresponding protein expressions were examined in AD brain sections. Five cases of pathologically-proven AD brains and 6 cases of control brains were fixed with formalin, embedded in paraffin, and cut on microtome in 5μm thickness. For Nissl staining, the sections were incubated in 0.1% cresyl violet for 5 min at room temperature, dehydrated gradually in ethanol, and coverslipped with micro cover glass. For single immunohistochemistry, brain sections were dewaxed in xylene and were hydrated in graded ethyl alcohol (100%, 95%, 80%, 70%, 50%) and then distilled water. For antigen retrieval, sections were microwaved in boiling 10 mM citric acid buffers of pH 6. After boiling again, sections were cooled at room temperature for 20 min prior to processing for immunohistochemistry. After incubation in 0.3% hydrogen peroxide/methanol followed by bovine serum albumin, the sections were stained overnight at 4°C with the following primary antibodies: rabbit anti-fibrinogen β chain (FBC) antibody (1:2500, Sigma, St. Louis, MO); rabbit anti-alpha-2-HS-glycoprotein (AHSG) antibody (1:50, Cloud-Clone Corp, Houston, TX, USA); rabbit anti-fibrinogen α chain (FAC) antibody (1:125, Sigma, St. Louis, MO); rabbit anti-plasma protease C1 Inhibitor (PPC1I) antibody (1:50, Proteintech Group, Chicago, IL). Brain sections were then washed with PBS and treated with suitable biotinylated secondary antibodies (1:500; Vector Laboratories, Burlingame, CA) for 2 h at room temperature. The slides were then treated with avidin-biotin-peroxidase complex (Vectastain ABC Kit; Vector) for 30 min and incubated with diaminobenzidine tetrahydrochloride (DAB). As for the negative control, we stained a set of brain sections in the same manner without the primary antibody. A light microscope (Olympus BX-51, Tokyo, Japan) was used to examine the sections.

For each measurement, we analyzed four randomly selected regions in each section. For the semiquantitative analysis, the number of FBC, AHSG, FAC, and PPC1I-positive cells were calculated in the cerebral cortex and hippocampus (HI).

Statistical analysis

Diagnostic performance of the peptides was evaluated using R statistical computing environment software [31]. Receiver operating characteristic (ROC) analysis was performed with package ‘Epi’ [32] within R software. Areas under the curve (AUC) values were calculated from ROC curve as an indicator of the diagnostic value. The optimal cutoff thresholds for diagnosis were determined according to Youden’s index [33]. Multiple binomial logistic regression analysis of peptides was conducted for detection of the best combination of peptides discriminating the two groups using R package ‘Aod’. Relative PET value was calculated to be positive as above 1, and negative as 1 or less. Correlation coefficient was also calculated by Pearson product-moment correlation coefficient between MMSE and relative PET value or serum probability of dementia (SPD). Immunohistochemical data were analyzed in GraphPad Prism (version 7.0, GraphPad Software Inc., San Diego, CA, SCR_002798) and presented as mean±SD. Two-way analysis of ANOVA was used to examine the differences in the expression of immunohistochemistry analysis between groups and brain areas followed by Sidak’s multiple comparisons test. In all statistical analyses, data with p < 0.05 were considered to be significant.

The present study was approved by the Ethical Committee of Graduate School of Medicine, Dentistry and Pharmaceutical Science, Okayama University (#OKU-1603-031 = peptidome, #OKU-1709-004 = PET, #OKU-1904-019 = pathology), Gunma University (CIRU-1665), and Oita University (B12-013).

RESULTS

Participants and candidate peptides

Totally 259 participants were collected for the present study, consisted of 100 normal control subjects, 60 MCI due to AD, and 99 AD patients (Table 1). Mean ages of these three groups were 80.0–81.9 years old, that were not significantly different. Mean MMSE were 28.6±1.5, 26.0±2.5 (**p < 0.01 versus control), and 18.4±4.9 (**p < 0.01 versus control, # #p < 0.01 versus MCI) in control, MCI and AD, respectively. Among these three groups, four peptides were identified to show significantly different between control versus MCI, MCI versus AD, and control versus AD (Table 2). The four peptides were 27 amino acid fragment (Peptide #1) of fibrinogen β chain (FBC), 27 amino acid fragment (Peptide #2) of α2-HS-glycoprotein (AHSG), 47 amino acid fragment (Peptide #3) of fibrinogen α chain (FAC), and 34 amino acid fragment (Peptide #4) of plasma protease C1 inhibitor (PPC1I) (details in Table 2).

Table 1.

Participants summary of the present study

Normal control MCI due to AD AD patients
No. of subjects n = 100 n = 60 n = 99
Female gender 60% 43% 56%
Age (y) 80.0±3.9 80.9±3.7 81.9±3.9
MMSE 28.6±1.5 26.0±2.5** 18.4±4.9**,# #

Data are expressed mean±SD. **p < 0.01 versus control, ##p < 0.01 versus MCI.

Table 2.

List of 4 identified peptides

Peptide # Mother protein (abbreviation) Calculated monoisotopic mass [M+H]+ Amino acid number (N-/C- terminus) Swiss-Prot accession number Peptide sequence
1 Fibrinogen β chain (FBC) 2882.54 27 (45–71) P02675 GHRPLDKKREEAPSLRPAPPPISGGGY
2 α2-HS-glycoprotein (AHSG) 2858.53 27 (341–367) P02765 TVVQPSVGAAAGPVVPPCPGRIRHFKV (C18 = cysteinylation)
3 Fibrinogen α chain (FAC) 5078.35 47 (528–574) P02671 TFPGFFSPMLGEFVSETESRGSESGIFTNTK ESSSHHPGIAEFPSRG (P3 = oxidation)
4 Plasma protease C1 inhibitor (PPC1I) 4151.17 34 (467–500) P05155 TLLVFEVQQPFLFVLWDQQHKF PVFMGRVYDPRA

Diagnostic performances of four peptides

Diagnostic performance of single marker peptide is summarized in Table 3, in which AUC was 0.710 for Peptide #1, 0.615 for Peptide #2, 0.616 for Peptide #3, and 0.594 for Peptide #4, respectively, with variable sensitivity (37–83%) and specificity (36–87%). Some of them showed a low sensitivity but high specificity (Peptide #3), and a high sensitivity but low specificity (Peptide #4). Peptide #2 showed a significantly lower fold change (0.84) compared to the three other increases of Peptide #1, #3, and #4 (Table 3). A multiple binomial logistic regression model was constructed by using the four peptides. After the examination of samples of a training data set (100 control subjects and 99 AD patients), an optimized model with the highest diagnostic performance was obtained as follows: Probability = 1/(1+e∧(–(–0.5473 + 3.719E-04 [Peptide #1] - 7.584E-05 [Peptide #2] + 1.302E-04 [Peptide #3] + 4.411E-05 [Peptide #4]))) (Equation 1).

Table 3.

Diagnostic performance of single marker peptide

Peptide # Mother protein (abbreviation) AUC Sensitivity (%) Specificity (%) Elecro- signal cut off Fold change (AD/Control) p (Mann-Whitney’s U test)
1 Fibrinogen β chain (FBC) 0.710 76 58 3,550 1.44 ***p < 0.001 (3.1×10–7)
2 α2-HS-glycoprotein (AHSG) 0.615 62 59 28,274 0.84 **p < 0.01 (0.005)
3 Fibrinogen α chain (FAC) 0.616 37 87 7,995 1.16 **p < 0.01 (0.005)
4 Plasma protease C1 inhibitor (PPC1I) 0.594 83 36 1,886 1.60 *p < 0.05 (0.021)

With this 4-peptide multi-marker set (Table 4), AUC of control versus MCI was 0.662, of MCI versus AD 0.672, and of control versus AD 0.804 with providing high sensitivity (72–87%) and high specificity (59–65%). To assess validity of the logistic model, k-fold cross validation was conducted. In k-fold cross-validation, the dataset was randomly divided into k subsets with equal size for each group. In this study, k = 5 was chosen. Logistic model using multiple peptides was trained for 5 times with each time leaving out one of the subsets from training. The omitted subset was applied for calculation of the diagnostic values, e.g., AUC. These values were compared with the diagnostic performance of the logistic regression model. By using 5-fold cross validation, AUC of control versus AD was estimated to be 0.796, which was close to the value without cross-validation, 0.804. Fold changes of MCI/control, AD/MCI, and AD/control were 1.39, 1.37, and 1.90, respectively (Table 4).

Table 4.

Diagnostic performance of the four-peptide multi-marker set

Sample data AUC Sensitivity (%) Specificity (%) Probability cut off Fold change p (Mann-Whitney’s U test)
Control versus MCI 0.662 72 59 0.357 MCI/Control = 1.39 ***p < 0.001 (6.2×10–4)
MCI versus AD 0.672 77 62 0.477 AD/MCI = 1.37 ***p < 0.001 (2.8×10–4)
Control versus AD 0.804 87 65 0.385 AD/Control = 1.90 ***p < 0.001 (1.3×10–13)

Figure 1 shows SPD depending on the peptide data among the three groups, which is overlaid by 259 cases of MMSE. These three groups show significantly different SPD between control versus MCI, MCI versus AD, and control versus AD (***p < 0.001). A good correlation was found in the increase of SPD and the decrease of MMSE among clinically diagnosed three groups (Fig. 1).

Fig.1.

Fig.1

Serum probability of dementia (SPD, boxes) and MMSE (circles) in 100 normal control (NC) subjects, 60 MCI due to AD subjects, and 99 AD patients. Note serial increase of SPD and decrease of MMSE from NC, MCI to AD. Open circle represent NC, grey MCI, and black AD.

Amyloid PET and brain pathology

Table 5 summarizes SPD data of 11 amyloid PET subjects. One control subject (female) was Aβ-PiB negative, who showed 0.33 SPD. Among three MCI subject (1 male and 2 females), two were Aβ-PiB negative (0.82 and 0.48 SPD) and one was Aβ-PiB positive with 0.55 SPD. Seven AD patients (5 males and 2 females) were all Aβ-PiB positive with SPD of 0.19–0.57. Of note was a case of MCI with high SPD (0.82), who was Aβ-PiB negative MCI with MMSE of 29, but converted into AD with MMSE of 23 in 2 years. Two other MCI cases with moderate SPD of 0.48 (Aβ-PiB negative) and 0.55 (Aβ-PiB positive) kept stable MMSEs for subsequent 3 and 18 months, respectively, until expiring the visit to our hospital. Figure 2 depicts Aβ-PiB PET negative (Fig. 2A) or positive (Fig. 2B) examples, and correlation coefficients of MMSE versus PET data (Fig. 2C) and MMSE versus SPD data (Fig. 2D) of these 11 subjects, showing a strong correlation of MMSE versus PET (r = –0.75, p = 0.0070) among all 11 subjects (Fig. 2C, oblique dotted line) and a correlation of MMSE versus SPD (r = –0.67, p = 0.0908) in 7 AD patients (Fig. 2D, oblique solid line). Correlation coefficient of MMSE versus SPD was r = –0.03 for all 11 subjects (Fig. 2D, dotted line).

Table 5.

Relative Aβ-PET value and serum probability of dementia (SPD) in 11 subjects

Normal control MCI AD
1 2 3 1 2 3 4 5 6 7
Age (y) 77 78 85 86 68 71 67 78 71 67 56
MMSE (/30) 30 29 29 27 27 20 18 26 20 24 17
PET result – – – + + + + + + + +
Relative PET value 0.94 0.94 0.95 1.42 1.06 1.45 1.47 1.53 1.54 1.96 2.53
SPD 0.33 0.82 0.48 0.55 0.19 0.54 0.57 0.24 0.24 0.50 0.49

Fig.2.

Fig.2

Amyloid PET and SPD with MMSE in 11 PET subjects for 1 NC, 3 MCI, and 7 AD. Panels A and B shows Aβ negative- and positive-example, (C) MMSE versus relative PET value of negative with 1 or less and positive with more than 1, and (D) MMSE versus SPD. Note the cortical Aβ deposit in PET-positive example (B), the strong correlation of relative PET value with MMSE in all 11 subjects (r = –0.75, p = 0.0070, panel C, oblique dotted line), and a significant correlation of SPD with MMSE in 7 AD patients (r = –0.67, p = 0.0908, panel D, oblique dotted line). Correlation coefficient of SPD versus MMSE was r = –0.03, p = 0.9198 for all 11 subjects (D, dotted line). Open circle represents NC, grey MCI, and black AD. + or – of grey MCI and control are Aβ-PET positive or negative, respectively.

Figure 3 shows histochemical analysis of human brain sections in the cerebral cortex (mainly frontal lobe) and HI. Both FBC and FAC were weakly stained in neurons of cortex and HI of control brains, but were strongly induced in AD brain. AHSG was obviously stained in neurons of cortex and HI of control brains, but was weaker in AD brains. PPC1I was clearly stained in neurons of control brains, which enhanced in AD brains. Quantitative analysis showed significant increases of positive cell numbers in the AD than control brains for FBC, FAC, and PPC1I, but a significant decrease for AHSG (Fig. 3, *p < 0.05 and **p < 0.01 versus Control).

Fig.3.

Fig.3

Immunohistochemical pathology of four mother proteins in AD brain. In comparison to control brains, note significant increases of three proteins (FBC, FAC, and PPC1l) and a decrease of AHSG in AD brain. Scale bar = 50μm (*p < 0.05 and **p < 0.01 versus Control).

DISCUSSION

The present study discovered a new serum biomarker with a new peptidome technology. The 4-peptide biomarker set presented a significant difference among age- and gender-matched normal control, MCI, and AD groups with high sensitivity and specificity (Tables 1–4, Fig. 1). Cognitive MMSE score was well correlated to brain Aβ deposition (Fig. 2C) and to SPD of AD (Figs. 1 and 2D), and thus provides a new screening for dementia with a quick, a small amount of serum (1.5μl), a very low invasive, and a low-cost test. The diagnostic performance of each peptide showed a characteristic balance of sensitivity and specificity to discriminate three subject groups (Table 3), each of which mutually compensated to enable a high sensitivity/specificity with high AUC as the set diagnosis (Table 4).

The present new peptidome technology took BLOTCHIP®-MS method which omits deproteination step, allowing a quick and whole peptides analysis not only for free peptides but also protein-binding peptides in the serum. This method can pick comprehensive serum peptides without missing protein-binding peptides, that were previously lost after deproteination step. Furthermore, such whole peptides were separated by a simple electrophoresis, and then on-step directly transferred to the high throughput MS analysis. Selection of test tube for blood collection was also very important in the present study. Many hospitals commonly use test tubes which are coated by thrombin to facilitate coagulation and getting serum in a short time. However, our pilot study proved the use of thrombin-coated test tube greatly interfered with the analysis data. Thus, the present study chose a test tube for blood collection that is simply coated by silica (Venoject II), also commonly available in most clinics.

Surprisingly, these peptides were not fragments of Aβ or tau, but were related to coagulation and complement/inflammation systems. The mother protein levels (FBC, FAC, PPC1I) of these three peptides (Peptides #1,3,4) were upregulated and AHSG was downregulated in the human AD patients (Fig. 3). Because frequencies of atrial fibrillation (Af) and the use of anti-coagulative drugs were only between 0 and 4.0% in the control, MCI, and AD groups, the present result is not simply due to the secondary effect of having Af nor the anti-coagulative drug use. FBC and FAC are essential coagulation materials and key contributor of AD pathology [34, 35]. PPC1I is a serpin superfamily, which regulates a pivotal coagulation/neuroinflammation in damaged brain [36, 37], and anti-inflammatory AHSG is regulated under control of pro-inflammatory tumor necrosis factor-α [38, 39]. Thus, the present data strongly suggest a new pathomechanism of AD, that is not simple Aβ and tau hypotheses but are in good accordance to our recent reports that suggested a neurovascular unit (NVU) damage and a neuroinflammation/plasticity of AD brain [40–43].

In fact, a recent report suggested an important role of pericyte for maintaining cerebral circulation and pleiotrophin secretion at NVU [44]. Our previous studies also reported that the mother proteins of these peptides (FAC and PPC1I) were upregulated and AHSG was downregulated in AD model mice, which were enhanced by chronic hypoperfusion [38, 45]. These previous mice reports were confirmed in human AD brain samples in the present study (Fig. 3), suggesting the constant activation of coagulation/plasticity and neuroinflammation process both in simple AD and AD plus hypoperfusion brains. In fact, our recent report showed that PiB-PET positive MCI showed elevations of inflammatory cytokines macrophage inflammatory protein-1β and stem cell growth factor-β in CSF [46]. Furthermore, matrix metalloproteinases involve multiple roles as inflammatory components of AD brain [47], which may be detected by a new PET tracer for microglial activation [48]. A recent report showed that Aβ interacted with fibrinogen and induced its oligomerization [49], which may well support the present data.

Increasing numbers of dementia patients demand a simple and quick screening test for early diagnosis. A recent report to detect serum Aβ showed a good correlation to brain Aβ deposition detected by PiB with a combination of immunoprecipitation (IP) plus MALDI-TOF/MS [50]. However, the IP-MS is limited to the measurement of known peptides and is not a popular diagnostic method due to enormous expense and equipment to generate and maintain antibodies. On the other hand, the present BLOTCHIP®-MS analysis requires no pretreatment of blood samples, because whole peptides are effectively dissociated from major blood proteins during one-dimensional polyacrylamide gel electrophoresis process. Thus, the present one dimension/MALDI-TOF (1-DE/MS) system eliminates staining, extracting, loading and many other time-consuming steps taken in 2-DE/MS, thereby greatly reducing analysis time while providing high throughput peptidomic analysis.

The present study provides a new diagnostic biomarker set for MCI and AD by a new peptidome technology, but also suggests an important pathomechanism of AD for neuroinflammation and NVU damage relating to coagulation/plasticity, that could develop a new approach for a disease modifying therapy or to prevent a conversion from MCI to AD. A standardized kit for automated quantitative assessment with ProtoKey® assay [51–54] with this 4-peptides set will enable a rapid, non-invasive, highly quantitative and low-cost clinical application in the near future.

The authors thank all the participants of the present study and Ms. Kadota A. for her enormous contribution of serum preparations. The present study was partly supported by a Grant-in-Aid for Scientific Research (B) 17H0419619, (C) 15K0931607, and 17K1082709, and by Grants-in-Aid from the Research Committees (Kaji R, Toda K, and Tsuji S) from the Japan Agency for Medical Research and Development 7211700176, 7211700180, and 7211700095.

Asada K, Senga T, Lee LJ, and Tanaka K provided BLOTCHIP®-MALDI-TOF/MS analysis at The Membrane Protein and Ligand Analysis Center, Protosera Inc., Osaka, Japan.

Authors’ disclosures available online (https://www.j-alz.com/manuscript-disclosures/19-1016r1).

REFERENCES

  • [1]. Abbott A (2011) Dementia: A problem for our age. Nature 475, S2–S4. [DOI] [PubMed] [Google Scholar]
  • [2]. Hishikawa N, Fukui Y, Sato K, Kono S, Yamashita T, Ohta Y, Deguchi K, Abe K (2016) Characteristic features of cognitive, affective and daily living functions of late-elderly dementia. Geriatr Gerontol Int 16, 458–465. [DOI] [PubMed] [Google Scholar]
  • [3]. Kanai M, Matsubara E, Isoe K, Urakami K, Nakashima K, Arai H, Sasaki H, Abe K, Iwatsubo T, Kosaka T, Watanabe M, Tomidokoro Y, Shizuka M, Mizushima K, Nakamura T, Igeta Y, Ikeda Y, Amari M, Kawarabayashi T, Ishiguro K, Harigaya Y, Wakabayashi K, Okamoto K, Hirai S, Shoji M (1998) Longitudinal study of cerebrospinal fluid levels of tau, A beta1-40, and A beta1-42(43) in Alzheimer’s disease: A study in Japan. Ann Neurol 44, 17–26. [DOI] [PubMed] [Google Scholar]
  • [4]. Takamura A, Okamoto Y, Kawarabayashi T, Yokoseki T, Shibata M, Mouri A, Nabeshima T, Sun H, Abe K, Urisu T, Yamamoto N, Shoji M, Yanagisawa K, Michikawa M, Matsubara E (2011) Extracellular and intraneuronal HMW-AbetaOs represent a molecular basis of memory loss in Alzheimer’s disease model mouse. Mol Neurodegener 6, 20. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [5]. Takamura A, Kawarabayashi T, Yokoseki T, Shibata M, Morishima-Kawashima M, Saito Y, Murayama S, Ihara Y, Abe K, Shoji M, Michikawa M, Matsubara E (2011) Dissociation of β-amyloid from lipoprotein in cerebrospinal fluid from Alzheimer’s disease accelerates β-amyloid-42 assembly. J Neurosci Res 89, 815–821. [DOI] [PubMed] [Google Scholar]
  • [6]. Iizuka T and Kameyama M (2017) Cholinergic enhancement increases regional cerebral blood flow to the posterior cingulate cortex in mild Alzheimer’s disease. Geriatr Gerontol Int 17, 951–958. [DOI] [PubMed] [Google Scholar]
  • [7]. Yoshii F, Kawaguchi C, Kohara S, Shimizu M, Onaka H, Ryo M, Takahashi W (2018) Characteristic deterioration of ADAS-Jcog subscale scores and correlations with regional cerebral blood flow reductions in Alzheimer’s disease. Neurol Sci 39, 909–918. [DOI] [PubMed] [Google Scholar]
  • [8]. Cohen ADand Klunk WE (2014) Early detection of Alzheimer’s disease using PiB and FDG PET. Neurobiol Dis 72, 117–122. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [9]. Yamane T, Ishii K, Sakata M, Ikari Y, Nishio T, Ishii K, Kato T, Ito K, Senda M; J-ADNI Study Group (2017) Inter-rater variability of visual interpretation and comparison with quantitative evaluation of 11C-PiB PET amyloid images of the Japanese Alzheimer’s Disease Neuroimaging Initiative (J-ADNI) multicenter study. Eur J Nucl Med Mol Imaging 44, 850–857. [DOI] [PubMed] [Google Scholar]
  • [10]. Takemaru M, Kimura N, Abe Y, Goto M, Matsubara E (2017) The evaluation of brain perfusion SPECT using an easy Z-score imaging system in MCI subjects with brain amyloid-β deposition. Clin Neurol Neurosurg 160, 111–115. [DOI] [PubMed] [Google Scholar]
  • [11]. Ishiki A, Okamura N, Furukawa K, Furumoto S, Harada R, Tomita N, Hiraoka K, Watanuki S, Ishikawa Y, Tago T, Funaki Y, Iwata R, Tashiro M, Yanai K, Kudo Y, Arai H (2015) Longitudinal assessment of tau pathology in patients with Alzheimer’s disease using 18F-THK-5117 positron emission tomography. PLoS One 10, e0140311. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [12]. Shimada H, Kitamura S, Shinotoh H, Endo H, Niwa F, Hirano S, Kimura Y, Zhang MR, Kuwabara S, Suhara T, Higuchi M (2016) Association between Aβ and tau accumulations and their influence on clinical features in aging and Alzheimer’s disease spectrum brains: A 11C-PBB3-PET study. (Amst) 6, 11–20. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [13]. Lemoine L, Gillberg PG, Svedberg M, Stepanov V, Jia Z, Huang J, Nag S, Tian H, Ghetti B, Okamura N, Higuchi M, Halldin C, Nordberg A (2017) Comparative binding properties of the tau PET tracers THK5117, THK5351, PBB3, and T807 in postmortem Alzheimer brains. Alzheimers Res Ther 9, 96. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [14]. Van Giau V, An SS (2016) Emergence of exosomal miRNAs as a diagnostic biomarker for Alzheimer’s disease. J Neurol Sci 360, 141–152. [DOI] [PubMed] [Google Scholar]
  • [15]. Chouraki V, Preis SR, Yang Q, Beiser A, Li S, Larson MG, Weinstein G, Wang TJ, Gerszten RE, Vasan RS, Seshadri S (2017) Association of amine biomarkers with incident dementia and Alzheimer’s disease in the Framingham Study. Alzheimers Dement 13, 1327–1336. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [16]. Schipke CG, Günter O, Weinert C, Scotton P, Sigle JP, Kallarackal J, Kabelitz D, Finzen A, Feuerhelm-Heidl A (2019) Definition and quantification of six immune- and neuroregulatory serum proteins in healthy and demented elderly. Neurodegener Dis Manag 9, 193–203. [DOI] [PubMed] [Google Scholar]
  • [17]. Wang D, Di X, Fu L, Li Y, Han X, Wu H, Cai L, Meng X, Jiang C, Kong W, Su W (2016) Analysis of serum β-amyloid peptides, α2-macroglobulin, complement factor H, and clusterin levels in APP/PS1 transgenic mice during progression of Alzheimer’s disease. Neuroreport 27, 1114–1119. [DOI] [PubMed] [Google Scholar]
  • [18]. Williams SM, Schulz P, Sierks MR (2016) Oligomeric α-synuclein and β-amyloid variants as potential biomarkers for Parkinson’s and Alzheimer’s diseases. Eur J Neurosci 43, 3–16. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [19]. Tatebe H, Kasai T, Ohmichi T, Kishi Y, Kakeya T, Waragai M, Kondo M, Allsop D, Tokuda T (2017) Quantification of plasma phosphorylated tau to use as a biomarker for brain Alzheimer pathology: Pilot case-control studies including patients with Alzheimer’s disease and down syndrome. Mol Neurodegener 12, 63. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [20]. Kumar S, Vijayan M, Reddy PH (2017) MicroRNA-455-3p as a potential peripheral biomarker for Alzheimer’s disease. Hum Mol Genet 26, 3808–3822. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [21]. Klaver AC, Coffey MP, Smith LM, Bennett DA, Finke JM, Dang L, Loeffler DA (2011) ELISA measurement of specific non-antigen-bound antibodies to Aβ1-42 monomer and soluble oligomers in sera from Alzheimer’s disease, mild cognitive impaired, and noncognitively impaired subjects. J Neuroinflammation 8, 93. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [22]. Lowenthal MS, Mehta AI, Frogale K, Bandle RW, Araujo RP, Hood BL, Veenstra TD, Conrads TP, Goldsmith P, Fishman D, Petricoin EF 3rd, Liotta LA (2005) Analysis of albumin-associated peptides and proteins from ovarian cancer patients. Clin Chem 51, 1933–1945. [DOI] [PubMed] [Google Scholar]
  • [23]. Granger J, Siddiqui J, Copeland S, Remick D (2005) Albumin depletion of human plasma also removes low abundance proteins including the cytokines. Proteomics 5, 4713–4718. [DOI] [PubMed] [Google Scholar]
  • [24]. Tanaka K, Tsugawa N, Kim YO, Sanuki N, Takeda U, Lee LJ (2009) A new rapid and comprehensive peptidome analysis by one-step direct transfer technology for 1-D electrophoresis/MALDI mass spectrometry. Biochem Biophys Res Commun 379, 110–114. [DOI] [PubMed] [Google Scholar]
  • [25]. Hughes CP, Berg L, Danziger WL, Coben LA, Martin RL (1982) A new clinical scale for the staging of dementia. Br J Psychiatry 140, 566–572. [DOI] [PubMed] [Google Scholar]
  • [26]. Morris JC (1993) The Clinical Dementia Rating (CDR): Current version and scoring rules. Neurology 43, 2412–2414. [DOI] [PubMed] [Google Scholar]
  • [27]. Folstein MF, Folstein SE, McHugh PR (1975) “Mini-mental state". A practical method for grading the cognitive state of patients for the clinician. J Psychiatr Res 12, 189–198. [DOI] [PubMed] [Google Scholar]
  • [28]. Mchann G, Drachman D, Folstein M, Katzman R, Price D, Stadlan EM (1984) Clinical diagnosis of Alzheimer’s disease: Report of the NINCDS-ADRDA Work Group under the auspices of Department of Health and Human Services Task Force on Alzheimer’s Disease. Neurology 34, 939–944. [DOI] [PubMed] [Google Scholar]
  • [29]. Petersen RC (2004) Mild cognitive impairment as a diagnostic entity. J Intern Med 256, 183–194. [DOI] [PubMed] [Google Scholar]
  • [30]. Araki Y, Nonaka D, Tajima A, Maruyama M, Nitto T, Ishikawa H, Yoshitake H, Yoshida E, Kuronaka N, Asada K, Yanagida M, Nojima M, Yoshida K, Takamori K, Hashiguchi T, Maruyama I, Lee LJ, Tanaka K (2011) Quantitative peptidomic analysis by a newly developed one-step direct transfer technology without depletion of major blood proteins: Its potential utility for monitoring of pathophysiological status in pregnancy-induced hypertension. Proteomics 11, 2727–2737. [DOI] [PubMed] [Google Scholar]
  • [31]. Dean CB, Nielsen JD (2007) Generalized linear mixed models: A review and some extensions. Lifetime Data Anal 13, 497–512. [DOI] [PubMed] [Google Scholar]
  • [32]. Carstensen BMP, Laara E, Hills M (2013) Epi: A package for statistical analysis in epidemiology. R package Version 1.1.49. [Google Scholar]
  • [33]. Youden WJ (1950) Index for rating diagnostic tests. Cancer 3, 32–35. [DOI] [PubMed] [Google Scholar]
  • [34]. Hattori K, Ota M, Sasayama D, Yoshida S, Matsumura R, Miyakawa T, Yokota Y, Yamaguchi S, Noda T, Teraishi T, Hori H, Higuchi T, Kohsaka S, Goto Y, Kunugi H (2015) Increased cerebrospinal fluid fibrinogen in major depressive disorder. Sci Rep 5, 11412. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [35]. Cortes-Canteli M, Strickland S (2009) Fibrinogen, a possible key player in Alzheimer’s disease. J Thromb Haemost 7 Suppl 1, 146–150. [DOI] [PubMed] [Google Scholar]
  • [36]. Walker DG, Yasuhara O, Patston PA, Mcgeer EG, Mcgeer PL (1995) Complement C1 inhibitor is produced by brain-tissue and is cleaved in Alzheimer disease. Brain Res 675, 75–82. [DOI] [PubMed] [Google Scholar]
  • [37]. Timmer NM, Kuiperij HB, de Waal RMW, Verbeek MM (2010) Do amyloid beta-associated factors co-deposit with Abeta in mouse models for Alzheimer’s disease? heimers Dis 22, 345–355. [DOI] [PubMed] [Google Scholar]
  • [38]. Shi X, Ohta Y, Liu X, Shang J, Morihara R, Nakano Y, Feng T, Huang Y, Sato K, Takemoto M, Hishikawa N, Yamashita T, Abe K (2019) Acute anti-inflammatory markers ITIH4 and AHSG in mice brain of a novel Alzheimer’s disease model. heimers Dis 68, 1667–1675. [DOI] [PubMed] [Google Scholar]
  • [39]. Smith ER, Nilforooshan R, Weaving G, Tabet N (2011) Plasma fetuin-A is associated with the severity of cognitive impairment in mild-to-moderate Alzheimer’s disease. heimers Dis 24, 327–333. [DOI] [PubMed] [Google Scholar]
  • [40]. Zhai Y, Yamashita T, Nakano Y, Sun Z, Morihara R, Fukui Y, Ohta Y, Hishikawa N, Abe K (2016) Disruption of white matter integrity by chronic cerebral hypoperfusion in Alzheimer’s disease mouse model. J Alzheimers Dis 52, 1311–1319. [DOI] [PubMed] [Google Scholar]
  • [41]. Zhai Y, Yamashita T, Nakano Y, Sun Z, Shang J, Feng T, Morihara R, Fukui Y, Ohta Y, Hishikawa N, Abe K (2016) Chronic cerebral hypoperfusion accelerates Alzheimer’s disease pathology with cerebrovascular remodeling in a novel mouse model. J Alzheimers Dis 53, 893–905. [DOI] [PubMed] [Google Scholar]
  • [42]. Shang J, Yamashita T, Zhai Y, Nakano Y, Morihara R, Fukui Y, Hishikawa N, Ohta Y, Abe K (2016) Strong impact of chronic cerebral hypoperfusion on neurovascular unit, cerebrovascular remodeling, and neurovascular trophic coupling in Alzheimer’s disease model mouse. J Alzheimers Dis 52, 113–126. [DOI] [PubMed] [Google Scholar]
  • [43]. Shang J, Yamashita T, Zhai Y, Nakano Y, Morihara R, Li X, Tian F, Liu X, Huang Y, Shi X, Sato K, Takemoto M, Hishikawa N, Ohta Y, Abe K (2019) Acceleration of NLRP3 inflammasome by chronic cerebral hypoperfusion in Alzheimer’s disease model mouse. Neurosci Res 143, 61–70. [DOI] [PubMed] [Google Scholar]
  • [44]. Nikolakopoulou AM, Montagne A, Kisler K, Dai Z, Wang Y, Huuskonen MT, Sagare AP, Lazic D, Sweeney MD, Kong P, Wang M, Owens NC, Lawson EJ, Xie X, Zhao Z, Zlokovic BV (2019) Pericyte loss leads to circulatory failure and pleiotrophin depletion causing neuron loss. Nat Neurosci 22, 1089–1098. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [45]. Shi X, Ohta Y, Liu X, Shang J, Morihara R, Nakano Y, Feng T, Huang Y, Sato K, Takemoto M, Hishikawa N, Yamashita T, Abe K (2019) Chronic cerebral hypoperfusion activates the coagulation and complement cascades in Alzheimer’s disease mice. Neuroscience 416, 126–136. [DOI] [PubMed] [Google Scholar]
  • [46]. Abe Y, Kimura N, Takahashi R, Gotou M, Mizukami K, Uchida H, Matsubara E (2017) Relationship between cytokine levels in the cerebrospinal fluid and 11C-Pittsburgh compound B retention in patients with mild cognitive impairment. Geriatr Gerontol Int 17, 1907–1913. [DOI] [PubMed] [Google Scholar]
  • [47]. Wang XX, Tan MS, Yu JT, Tan L (2014) Matrix metalloproteinases and their multiple roles in Alzheimer’s disease. Biomed Res Int 2014, 908636. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [48]. Yokokura M, Terada T, Bunai T, Nakaizumi K, Takebayashi K, Iwata Y, Yoshikawa E, Futatsubashi M, Suzuki K, Mori N, Ouchi Y (2017) Depiction of microglial activation in aging and dementia: Positron emission tomography with [(11)C]DPA713 versus [(11)C](R)PK11195. J Cereb Blood Flow Metab 37, 877–889. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [49]. Ahn HJ, Zamolodchikov D, Cortes-Canteli M, Norris EH, Glickman JF, Strickland S (2010) Alzheimer’s disease peptide beta-amyloid interacts with fibrinogen and induces its oligomerization. Proc Natl Acad Sci U S A 107, 21812–21817. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [50]. Nakamura A, Kaneko N, Villemagne VL, Kato T, Doecke J, Dore V, Fowler C, Li QX, Martins R, Rowe C, Tomita T, Matsuzaki K, Ishii K, Ishii K, Arahata Y, Iwamoto S, Ito K, Tanaka K, Masters CL, Yanagisawa K (2018) High performance plasma amyloid-b biomarkers for Alzheimer’s disease. Nature 554, 249–254. [DOI] [PubMed] [Google Scholar]
  • [51]. Addona TA, Abbatiello SE, Schilling B, Skates SJ, Mani DR, Bunk DM, Spiegelman CH, Zimmerman LJ, Ham AJ, Keshishian H, Hall SC, Allen S, Blackman RK, Borchers CH, Buck C, Cardasis HL, Cusack MP, Dodder NG, Gibson BW, Held JM, Hiltke T, Jackson A, Johansen EB, Kinsinger CR, Li J, Mesri M, Neubert TA, Niles RK, Pulsipher TC, Ransohoff D, Rodriguez H, Rudnick PA, Smith D, Tabb DL, Tegeler TJ, Variyath AM, Vega-Montoto LJ, Wahlander A, Waldemarson S, Wang M, Whiteaker JR, Zhao L, Anderson NL, Fisher SJ, Liebler DC, Paulovich AG, Regnier FE, Tempst P, Carr SA (2009) Multi-site assessment of the precision and reproducibility of multiple reaction monitoring-based measurements of proteins in plasma. Nat Biotechnol 27, 633–641. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • [52]. Percy AJ, Mohammed Y, Yang J, Borchers CH (2015) A standardized kit for automated quantitative assessment of candidate protein biomarkers in human plasma. Bioanalysis 7, 2991–3004. [DOI] [PubMed] [Google Scholar]
  • [53]. Uchiyama K, Naito Y, Yagi N, Mizushima K, Higashimura Y, Hirai Y, Okayama T, Yoshida N, Katada K, Kamada K, Handa O, Ishikawa T, Takagi T, Konishi H, Nonaka D, Asada K, Lee LJ, Tanaka K, Kuriu Y, Nakanishi M, Otsuji E, Itoh Y (2015) Peptidomic analysis via one-step direct transfer technology for colorectal cancer biomarker discovery. Bioinfom S5, 005. [Google Scholar]
  • [54]. Uchiyama K, Naito Y, Yagi N, Mizushima K, Higashimura Y, Hirai Y, Dohi O, Okayama T, Yoshida N, Katada K, Kamada K, Handa O, Ishikawa T, Takagi T, Konishi H, Nonaka D, Asada K, Lee LJ, Tanaka K, Kuriu Y, Nakanishi M, Otsuji E, Itoh Y (2018) Selected reaction monitoring for colorectal cancer diagnosis using a set of five serum peptides identified by BLOTCHIP®-MS analysis. J Gastroenterol 53, 1179–1185. [DOI] [PubMed] [Google Scholar]

Articles from Journal of Alzheimer's Disease are provided here courtesy of IOS Press

RESOURCES