Abstract
Bacteriocins are antimicrobial peptides produced by bacteria, and their production is regarded as a desirable probiotic trait. We found that Lactobacillus gasseri LM19, a strain isolated from human milk, produces several bacteriocins, including a novel bacteriocin, gassericin M. These bacteriocins were purified from culture and synthesised to investigate their activity and potential synergy. L. gasseri LM19 was tested in a complex environment mimicking human colon conditions; it not only survived, but expressed the seven bacteriocin genes and produced short-chain fatty acids. Metagenomic analysis of these in vitro colon cultures showed that co-inoculation of L. gasseri LM19 with Clostridium perfringens gave 16S ribosomal RNA metagenomic profiles with more similarity to controls than to vessels inoculated with C. perfringens alone. These results indicate that L. gasseri LM19 could be an interesting candidate for maintaining homeostasis in the gut environment.
Electronic supplementary material
The online version of this article (10.1007/s00253-020-10493-3) contains supplementary material, which is available to authorized users.
Keywords: Bacteriocin, Antimicrobial, SCFA, Gassericin, Colon model, Lactobacillus gasseri
Introduction
Beneficial bacteria have consistently been harnessed throughout human history. Most recently, the rise of antimicrobial resistance among pathogens, a greater demand for healthy foods and an increasing appreciation of the importance of the human gut microbiota have brought attention back to natural sources of new antimicrobials, food preservatives and probiotics. The search for natural antimicrobials can involve a variety of approaches (Lewis 2013), including taking advantage of the fact that bacteria from a specific environmental niche are able to compete against other bacteria from the same niche (Czárán et al. 2002; Kelsic et al. 2015). Such bacterial antagonism can be through non-specific strategies, like the production of organic acids. Some organic acids, particularly the short-chain fatty acids (SCFA), acetate, propionate and butyrate, are produced in millimolar quantities in the gastrointestinal (GI) tracts of animals and humans and, in addition to their antagonistic activities, confer other health benefits (LeBlanc et al. 2017; Singh et al. 2018). Target-specific antagonistic activities can be provided by compounds such as bacteriocins (Garcia-Gutierrez et al. 2018), a heterogeneous group of ribosomally synthesised peptides. They represent a potential alternative to traditional antibiotics because of their frequent low toxicity, high potency, ability to be bioengineered, low likelihood of resistance development and the possibility of being produced in situ by probiotics (Cotter et al. 2013; Field et al. 2015; Hegarty et al. 2016).
Lactobacillus spp. are members of the lactic acid bacteria (LAB) and contribute to the production of many fermented foods, as well as being important components of the human gut microbiota and sources of antimicrobial peptides (Collins et al. 2017). Lactobacillus gasseri is one of six species which previously comprised the Lactobacillus acidophilus complex (Fujisawa et al. 1992; Sarmiento-Rubiano et al. 2010). These species are considered ecologically and commercially important and have been extensively studied, frequently revealing antimicrobial and other probiotic properties (Abramov et al. 2014; Karska-Wysocki et al. 2010; Kim et al. 2007; Selle and Klaenhammer 2013; Yamano et al. 2007). L. gasseri strains have been isolated from the gut of animals and humans, vaginal tract, human milk and oral cavity and have been found to produce different classes of bacteriocins, frequently referred to as gassericins. Gassericin A is a cyclic class IIc bacteriocin produced by L. gasseri LA39, from an infant faecal sample (Kawai et al. 1994; Pandey et al. 2013). Gassericins B1, B2, B3 and B4 were isolated from vaginal isolate L. gasseri JCM 2124, with B1 and B3 being identical to the α and β peptides of the two-component bacteriocin acidocin J1132 from L. acidophilus (Tahara et al. 1997). Production of gassericin T (GasT) was first reported in L. gasseri SBT 2055, a strain isolated from adult human faeces (Kawai et al. 2000). Although bacteriocins of class IIb have previously been shown to have one active peptide and one inactive complementary factor, the second peptide from the same cluster, GatX, was also shown to have antimicrobial activity (Mavrič et al. 2014). Acidocins LF221A and LF221B were isolated from L. acidophilus LF221 (later renamed L. gasseri LF221), from infant faeces (Bogovic-Matijasic et al. 1998). L. gasseri K7 was also isolated from the faeces of a breast-fed baby and two two-peptide bacteriocin-encoding operons were found in its genome (Zorič Peternel et al. 2010). These potential peptides showed high homology to acidocins LF221A and LF221B and gassericin T peptides, respectively (Mavrič et al. 2014). The gassericin E operon was identified in L. gasseri EV1461, isolated from the vagina of a healthy woman; it encodes both antimicrobial gassericin E, with high similarity to gassericin T, and gene gaeX, whose product is identical to GatX and gassericin K7 B (Maldonado-Barragán et al. 2016). Recently, genes encoding gassericin T (GatA and GatX) and the novel gassericin S, with similarity to acidocin LF221A (GasA and GasX), were found in the genome of L. gasseri LA327, isolated from the colon of a human adult (Kasuga et al. 2019). This study demonstrated synergistic activity between the two components of gassericin T, and those of gassericin S, but not between gassericin S and gassericin T (Kasuga et al. 2019).
In this study, we aimed to characterise the antimicrobial and probiotic potential of a novel strain, L. gasseri LM19, isolated from human milk. We found that L. gasseri LM19 exhibits antimicrobial activity against different enteropathogens and possesses three bacteriocin clusters in its genome, including one encoding a novel bacteriocin, designated gassericin M. We examined antimicrobial activity and synergy using both purified and synthesised peptides. In order to examine potential probiotic use, we also demonstrated that L. gasseri LM19 survives, expresses all the bacteriocin genes, and produces SCFA in detectable amounts in a complex faecal environment mimicking colon conditions. In addition, it can help to maintain the composition of the microbiome in the presence of the pathogen Clostridium perfringens.
Methods
Isolation and whole genome sequencing of L. gasseri LM19
L. gasseri LM19 was originally isolated from breast milk on MRS agar (Oxoid España SA, Madrid, Spain) at 37 °C and has been deposited in the National Collection of Industrial, Food and Marine Bacteria (NCIMB, Aberdeen, UK) with the accession number NCIMB 15251. Whole genome sequence was provided by MicrobesNG (Birmingham, UK) using Illumina® HiSeq and a 250 bp paired end protocol. Genome coverage was × 30. Reads were trimmed using Trimmomatic 0.30 with a sliding window quality cutoff of Q15 (Bolger et al. 2014), and the quality was assessed using software Samtools (Li et al. 2009), BedTools (Quinlan and Hall 2010), and BWA mem (Li and Durbin 2010). SPAdes 3.7 (Bankevich et al. 2012) was used for de novo assembly, and annotation was performed using Prokka 1.11 (Seemann 2014).
Bioassay-based screening for antimicrobial activity
Antimicrobial overlay assays, cross streaks, drop tests, filter disc tests and well diffusion assays were performed as described previously (Garcia-Gutierrez 2019), supplementing plates with 2% w/v NaHCO3 to counteract inhibition from lactic acid. Well diffusion assays incorporated 100 μl of an overnight culture of the incubator strains. Bacterial strains used were from culture collections (ATCC, American Type Culture Collection, Manassas, Virginia, USA; DSMZ, Deutsche Sammlung von Mikroorganismen und Zellkulturen, Braunschweig, Germany; NCTC, National Collection of Type Cultures, London, UK) or in-house collections. Strains and culture conditions were: L. gasseri LM19 (MRS, 37 °C, anaerobic, static), Salmonella enterica LT2 (LB, 37 °C, anaerobic, static), Escherichia coli ATCC 25922 (LB, 37 °C, anaerobic, static), Cronobacter sakazakii DSMZ 4485 (BHI, 37 °C, anaerobic, static), C. perfringens NCTC 3110 (BHI, 37 °C, anaerobic, static), Listeria innocua NCTC 11288 (BHI, 37 °C, anaerobic, static), Lactobacillus delbrueckii subsp. bulgaricus (L. bulgaricus) 5583 (MRS, 37 °C, anaerobic, static), L. bulgaricus LMG 6901 (MRS, 37 °C, aerobic, static), Campylobacter jejuni NCTC 11168 (Brucella medium, 37 °C, microaerobic, static), and Micrococcus luteus FI10640 (MRS, 37 °C, aerobic, static). Media was sourced from Oxoid (Hampshire, UK).
In silico identification of bacteriocin gene clusters
The L. gasseri LM19 genome was analysed with software to identify putative bacteriocin clusters: BAGEL 3 and BAGEL 4 (van Heel et al. 2013) to target bacteriocin clusters and antiSMASH to target secondary metabolites (Weber et al. 2015). Genome data was visualised using Artemis (Carver et al. 2012). DNA and amino acid sequences identified as putative bacteriocin genes and proteins were analysed using BLAST (Altschul et al. 1990) using default parameters. Geneious Tree Builder v11.1 (Biomatters Ltd., Auckland, New Zealand) was used to compare the gassericins.
Detection and purification of antimicrobial peptides
L. gasseri LM19 was grown anaerobically at 37 °C in 2 l MRS broth for 24–48 h. The culture was centrifuged (8000×g, 20 min, 10 °C), and cells and supernatant were analysed independently. The cell pellet was resuspended in 400 ml IPA (70% propan-2-ol, 0.1% trifluoroacetic acid) for 3–4 h at room temperature, centrifuged again and the supernatant retained for further purification. This sample was tested for antimicrobial activity using L. bulgaricus LMG 6901 as an indicator and was also analysed directly by matrix assisted laser deionisation-time of flight-mass spectrometry (MALDI-TOF-MS; Axima TOF2 MALDI-TOF mass spectrometer in positive-ion reflectron mode, Shimadzu Biotech, Manchester, UK) to determine the masses of the potential peptides. For further purification, IPA was removed by rotary evaporation until the sample volume was 120 ml; this was applied to a 2 g 12 ml Strata® C18-E solid-phase extraction (C18-SPE) column (Phenomenex, Macclesfield, Cheshire, UK), pre-equilibrated with methanol and water following manufacturer’s instructions. The column was washed with 20 ml 30% ethanol, then 20 ml 30% acetonitrile and the active fraction was eluted with 30 ml IPA. The IPA was removed as before and 4 ml aliquots were applied to a semi preparative Jupiter C5 Reversed Phase HPLC column (10 × 250 mm, 10 μm, 300 Å, Phenomenex) (“HPLC fractionation I”) running a 30–70% acetonitrile, 0.1% formic acid (FA) gradient over 95 min where buffer A is 0.1% FA and buffer B is 100% acetonitrile, 0.1% FA. Flow rate was 2.5 ml/min, and fractions were collected at 1-min intervals and further analysed by MALDI-TOF-MS.
For purification from the cell-free supernatant, the supernatant was applied to an Econo-column (BioRad, Watford, UK) containing 60 g Amberlite XAD 16 N. The column was washed with 400 ml 35% ethanol followed by 400 ml 30% acetonitrile and antimicrobial activity eluted with 450 ml IPA. IPA was removed by rotary evaporation until the sample volume was 145 ml; this was applied to a 5 g 20 ml C18-SPE column pre-equilibrated with methanol and water. The column was washed with 30 ml 30% ethanol followed by 30 ml 30% acetonitrile and antimicrobial activity eluted with 30 ml IPA and fractionated by semi-preparative reversed phase HPLC as before. To increase purity, some HPLC fractions were reapplied to the C5 semi prep column, running shallower gradients (“HPLC fractionation II”) (30–40% acetonitrile, 0.1% FA gradient over 95 min for GamX and Bact_2, 30–45% gradient for GamA, and 35–65% gradient for Bact_1, GamM and GamY).
Additionally, the six peptides were synthesised using microwave-assisted solid phase peptide synthesis on a Liberty Blue microwave peptide synthesiser (CEM Corporation, Charlotte, NC, USA). GamA and GamM were synthesised on H-Lys (BOC)-HMPB-ChemMatrix® resin, GamX was synthesised on H-Asn(Trt)-HMPB-ChemMatrix® resin, Bact_1 and Bact_2 on H-Arg(PBF)-HMPB-ChemMatrix® resin and GamY on Fmoc-Phe-Wang (Novobiochem®, Darmstadt, Germany) resin. Crude peptide was purified using RP-HPLC on a Semi Preparative Vydac C4 (10 × 250 mm, 5 μ, 300 Å) column (Grace, Chicago, Illinois, USA) running acetonitrile, 0.1% trifluoroacetic acid gradients specific to the peptide of interest. Fractions containing the desired molecular mass were identified using MALDI-TOF-MS and were pooled and lyophilised on a Genevac HT 4X lyophiliser (Genevac Ltd., Ipswich, UK). All naturally produced peptides and synthetic peptides were assayed by well-diffusion assay using L. bulgaricus DPC6901.
Fermentation studies
L. gasseri LM19 was inoculated at 1% in 20 ml of prepared in-house MRS without glucose (10 g/l trypticase peptone (Difco, Wokingham, UK), 2.5 g/l yeast extract (Difco), 3 g/l K2HPO4, 3 g/l KH2PO4, 2 g/l tri-ammonium citrate, 0.2 g/l pyruvic acid, 0.3 g/l cysteine-HCl, 0.575 g/l MgSO4.7H2O, 0.12 g/l MnSO4.7H2O, 0.034 g/l FeSO4 7H2O and 1 ml Tween 80 (all from Sigma-Aldrich, Gillingham, UK)), or batch model media, prepared as described previously (Parmanand et al. 2019). The pH was adjusted to 6.8 in both media and filter sterilised carbohydrate (glucose, lactose, galactose, inulin, starch or pectin [Sigma]) was added at 2% after autoclaving. Fermentations were incubated in anaerobic conditions at 37 °C over 48 h, conducted in triplicate and 2 ml samples collected at 24 h and 48 h. One millilitre was used for enumeration by plate count, pH measurement using a pH-000-85282 probe (Unisense, Aarhus, Denmark) and, once filter sterilised, well diffusion assay and 1 ml for RNA extraction.
Nucleic acid extraction and sequencing
Samples for RNA extraction were mixed with two volumes of RNAlater (Sigma-Aldrich), centrifuged for 10 min at 18,000×g at 4 °C and pellets stored at − 80 °C. Extraction was performed using the RNeasy extraction kit (Qiagen, Manchester UK) with minor modifications. Pellets were resuspended in 1 ml RLT buffer, supplemented with 10 μl β-mercaptoethanol (Millipore) and transferred to lysing matrix E tubes (MP Biomedicals, Loughborough, UK). Samples were lysed in a FastPrep-24 homogeniser (MP Biomedicals) by applying 2 pulses of 30 s and intensity 6.0 with 1 min on ice between pulses. Samples were centrifuged for 10 min at 17,000×g and the supernatant transferred to clean 15 ml tubes and mixed with an equal volume of 70% ethanol. Seventy percent of the mixture, including any precipitate, was transferred to spin tubes and centrifuged at 8000×g for 1 min and following steps were as the manufacturer’s instructions. RNA was eluted in 100 μl RNase-free water and quantified by NanoDrop 2000 (Thermo Scientific, Gloucester, UK). DNase treatment was performed using the Turbo DNA-free™ kit (Invitrogen, Inchinnan, UK).
Genomic DNA was extracted using genomic tip-20 and genomic buffer set kits (Qiagen). Metagenomic DNA was extracted using the FastDNA Spin Kit for Soil (MP Biomedicals) following manufacturer’s guidelines. Total DNA concentration was measured by Qubit 3 (Invitrogen). The V4 region of the 16S rRNA gene was used for high-throughput sequencing using the Illumina MiSeq platform. Data analysis was conducted using Quantitative Insights into Microbial Ecology (QIIME2 version 2018.11) (Bokulich et al. 2018).
Quantitative PCR (qPCR)
qPCR was used to detect the presence or absence of C. perfringens (Nagpal et al. 2015) and L. gasseri LM19 bacteriocin genes (Treven et al. 2013). Primers (Table 1, Sigma Genosys, Haverhill, UK) were designed using Primer 3 (v. 0.4.0) (Untergasser et al. 2012) and Netprimer (Premier Biosoft, San Francisco, California, USA) and tested using genomic DNA. Thermal cycling was performed using a Verity 96 well Thermal Cycler (Applied Biosystems, Cheshire, UK) using GoTaq G2 DNA polymerase (Promega, Chilworth, UK) according to manufacturer’s instructions. Reaction conditions were 20 s at 95 °C, 40 cycles of 1 s at 95 °C, 20 s at 60 °C and 15 s at 95 °C, and a melt curve of 15 min at 65 °C. dNTPs were provided by Bioline (London, UK). PCR products were visualised using 2% agarose gels. A standard curve for C. perfringens NCTC 3110 was constructed by extracting gDNA as described previously (Ladero et al. 2011) from a culture with known colony-forming units (cfu)/ml of C. perfringens NCTC 3110 then performing serial dilutions. Each DNA concentration was measured using qPCR to determine the cycle signal associated with each cell concentration.
Table 1.
Gene | Accession number | Primer | Sequence (5′–3′) | Product size | Reference/accession no. |
---|---|---|---|---|---|
gyrase A L. gasseri LM19 | 7791_LM19_00854 | LGgyrAF | TTGATTGCCTTAACCCTTCG | 136 | This work |
LGgyrAR | TTCCCATTGAACGAACATCA | ||||
bact_1 | 7791_LM19_00792 | Cluster 1.1F | TATTGGTGCATGGAGAGGTG | 124 | This work |
Cluster 1.1R | CCAGCCCACACATTGTACTG | ||||
bact_2 | 7791_LM19_00793 | Cluster1.2F | TTGGGGTAGTGTTGCAGGAT | 97 | This work |
Cluster1.2R | TGATGTTGCAGCTCCGTTAG | ||||
helveticin J-like | 7791_LM19_00025 | Cluster2F | CTTGGGTACAAAGCGGAGAA | 176 | This work |
Cluster2R | GCCTGCTCGGTTAAGATAAG | ||||
gamA (=gasT) | 7791_LM19_00116 | Cluster3.1F | CTGGATGGGCTCTTGGAAAT | 112 | This work |
Cluster3.1R | TTTCCGAATCCACCAGTAGC | ||||
gamX (=gatX) | 7791_LM19_00117 | Cluster3.2F | TGGGGGAATGCTGTAATAGG | 100 | This work |
Cluster3.2R | CTCCTAAGCCACAGGCAGTC | ||||
gamY | 7791_LM19_00122 | GamYF | ACTCAAATCGTAGGAGGAAAAGG | 150 | This work |
GamYR | AAAGCATGCACCTGAACCA | ||||
gamM | 7791_LM19_00123 | GasMF | AGCAGGAGGAGCATTTTCAA | 90 | This work |
GasMR | CCTGCTGCACCACCTAAAAT | ||||
Immunity gene gamI3 | 7791_LM19_00118 | Cluster 3.3F | CAGATGAAGAAGCATTACTTGAAAA | 102 | This work |
Cluster 3.3R | TTCCAGGCCAAGTATTAGTTGTA | ||||
C. perfringens 16S | MN960263 | s-Clper-F | GGGGGTTTCAACACCTCC | 170 | (Nagpal et al. 2015) |
ClPER-R | GCAAGGGATGTCAAGTGT |
Quantitative reverse transcription PCR (RT-qPCR)
cDNA synthesis was carried out using the QuantiTect® Reverse Transcription Kit (Qiagen, UK) using 100 ng RNA per reaction. RT-qPCR was performed using 384-well plates (4titude Ltd., Dorking, UK) in the ViiA™ 7 System (Applied Biosystems) with the SensiFAST™ SYBR® No-ROX Kit (Bioline, London, UK). Reaction mix composition was, in 6 μl, 0.6 μl of cDNA template, 3 μl of 2x SensiFAST SYBR® No-ROX mix, 0.24 μl of each primer (10 μM stock) and 1.92 μl of water. Reaction conditions were as qPCR. Reactions were set up in duplicate and the baseline for change was 2-fold relative to housekeeping gene gyrase A.
Transformation of L. gasseri LM19
Electro-competent cells of L. gasseri LM19 were made based on the method described previously (Holo and Nes 1989). Competent cells were resuspended in 2.25 ml 10% glycerol/0.5 M sucrose, aliquoted in volumes of 40 μl and either used immediately or frozen on dry ice. Five hundred nanograms of plasmid pUK200 (Wegmann et al. 1999) were added to 40 μl of electro-competent cells. The mixture was incubated for 1 min on ice and transferred to a pre-chilled electroporation cuvette (Geneflow Limited, Lichfield, UK). A pulse of 1500 V, 800 Ω and 25 μF was applied using a BioRad electroporator (Watford, UK). Four hundred fifty microlitres of pre-chilled MRS/ 20 mM MgCl2/2 mM CaCl2 were added to the cuvette, and the mixture transferred to a chilled 2-ml tube and incubated for 2 h at 37 °C. Aliquots were plated on MRS with 7.5 μg/ml chloramphenicol and incubated overnight at 37 °C. Transformants were confirmed by colony PCR using Go Taq G2 polymerase and primers p181 (5′-GCGAAGATAACAGTGACTCTA-3′ and p54 (5′-CGGCTCTGATTAAATTCTGAAG-3′).
In vitro colonic batch model fermentation
Fermentations to simulate human colon conditions were performed as described previously (Parmanand et al. 2019). Experiments were carried out using three different faecal donors, one fermentation for each donor. Each faecal fermentation comprised 4 vessels—control, inoculation with L. gasseri, inoculation with C. perfringens, co-inoculation with both L. gasseri and C. perfringens. Overnight cultures of L. gasseri LM19 pUK200 and C. perfringens NCTC 3110 were added to the vessels at 1% each. Six-millilitre samples were extracted at 0 h, 4 h, 8 h, 24 h and 48 h for DNA and RNA extractions, SCFA analysis and, from those vessels where L. gasseri had been added alone, enumeration of L. gasseri LM19 pUK200 by plate count on MRS supplemented with 7.5 μg/ml chloramphenicol.
SCFA analysis
SCFA were measured using proton NMR (Parmanand et al. 2019). The metabolites were quantified using Chenomx NMR Suite v8.12 (Chenomx Inc., Edmonton, Canada) with the TSP concentration set to 0.1 mM.
Statistical analysis
Significant differences between groups were established using a paired t test, assuming normal distribution, equal variances. Both sides of the distribution were considered. Significance was considered when the p value was < 0.05.
Results
Antimicrobial activity
The antimicrobial activity of L. gasseri LM19 was assessed against Gram-positive and Gram-negative pathogens (Table 2). The assay method affected the outcome, with the targets typically being more sensitive to LM19 grown on agar than to its cell free supernatant. The growth of C. perfringens NCTC 3110 and L. bulgaricus 5583 was inhibited by overlay assays. Cross-streaks showed antimicrobial activity against all Gram-positive indicators and C. sakazakii, while supernatants exhibited activity by filter disc against L. bulgaricus, C. jejuni and M. luteus. Well-diffusion assay only inhibited the growth of L. bulgaricus. As L. bulgaricus was the most sensitive indicator, it was used in subsequent tests.
Table 2.
Overlay | Cross-streak | Drop test | Filter disc | Well-diffusion | |
---|---|---|---|---|---|
S. enterica LT2 | – | – | – | – | – |
E. coli ATCC 25922 | – | – | – | – | – |
C. sakazakii NCTC 11467 | – | ++ | – | – | – |
C. perfringens NCTC 3110 | + | + | – | – | – |
L. innocua NCTC 11288 | – | ++ | – | – | – |
L. bulgaricus 5583 | +++ | +++ | – | ++ | +++ |
C. jejuni NCTC 11168 | np | np | np | + | np |
M. luteus FI10640 | – | ++ | – | + | – |
−, no activity; + 1 mm radius inhibition zone; ++, 1–5 mm radius inhibition zone; +++, > 5 mm inhibition zone; np, not performed
Identification of bacteriocin gene clusters in the genome of L. gasseri LM19
The sequenced genome of L. gasseri LM19 was assembled into contigs and submitted to the NCBI under accession number SHO00000000. AntiSMASH 3.0 indicated the presence of a single Microcin M-like cluster, while BAGEL 4, which specifically targets regions with bacteriocin similarities, found three clusters predicted to encode a number of potential bacteriocins. Manual investigation confirmed the presence of two clusters, whose putative structural peptides showed a high similarity to antimicrobial peptides from class IIb bacteriocins (clusters 1 and 3), and a helveticin-like protein (cluster 2). The latter contained no other bacteriocin-associated genes on the basis of Blastp analysis; the product of the single gene showed 31.9% identity and 43.1% amino acid consensus to helveticin J, which was originally characterised in Lactobacillus helveticus following heterologous expression (Joerger and Klaenhammer 1986).
Cluster 1 (939 bp) has 99% nucleotide identity to the class IIb gassericin K7A cluster (EF392861). The cluster was predicted to encode two short peptides with leader sequences (Bact_1 and Bact_2) and a putative immunity protein (Fig. 1a). Bact_1 and Bact_2 show 100% amino acid similarity with the gassericin S structural peptides GasA and GasX respectively (Kasuga et al. 2019), while the surrounding genes do not resemble any other genes associated with bacteriocin production. The putative immunity protein showed 97% amino acid homology to those of the acidocin LF221A and gassericin S clusters (Kasuga et al. 2019; Majhenič et al. 2004).
Cluster 3 is 9736 bp and the first open reading frames (orfs) 1–8 show a high nucleotide homology to the gassericin T cluster from L. gasseri LA158 (AB710328, 99% over 100% coverage) and the gassericin E cluster from EV1461 (KR08485, 99% over 95% coverage) (Fig. 1a). There are two structural peptide-encoding genes, gamA and gamX, that are preceded by homologues of the gassericin E cluster as described previously (Maldonado-Barragán et al. 2016). It is likely that they perform the same predicted functions as their gassericin E homologues, i.e. gamP, gamK, gamR for regulation, gamT and gamC for transport and, after the structural peptides, gamI for immunity, although a homologue to gaeX is missing. The predicted GamA peptide has the same sequence as GasT, Gas K7B cf. and acidocin LF221B cf. and has a single amino acid difference (W-L) from GasE (Table 3). The second putative peptide, GamX, has the same sequence as GatX and GaeX, all of which differ by a single amino acid (G-A) from Gas K7 B and acidocin LF221B (Table 3).
Table 3.
Gassericin | Amino acid sequence | Molecular mass (Da) | Reference |
---|---|---|---|
A | MIEKVSKNELSRIYGGNNVNWGSVAGSCGKGAVMGIYFGNPILGCANGAATSLVLQTASGIYKNYQKKR | 5652 | (Kawai et al. 1994; Pandey et al. 2013) |
B1 | (N-terminal) NPKVAHCASQIGRSTAWGAVSGAATGTAVGQAVGA-X | 6217 | (Tahara et al. 1997) |
B2 | (N-terminal) MISKPEKNTLRL-X | 4400 | (Tahara et al. 1997) |
B3 | (N-terminal) GNPKVAHCASQIGRSTAW-X | 6273 | (Tahara et al. 1997) |
B4 | (N-terminal) NPKVAHCASQIGRSTAW-X | 5829 | (Tahara et al. 1997) |
GatX | MALKTLEKHELRNVMGGNKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN | 4763 | (Mavrič et al. 2014) |
Acidocin LF221A α | MIEKVSKNELSRIYGGNNVNWGSVAGSCGKGAVMEIYFGNPILGCANGAATSLVLQTASGIYKNYQKKR | 3393 | (Bogovic-Matijasic et al. 1998) |
Acidocin LF221A β(cf) | MKVLNECQLQTVVGGKNWSVAKCGGTIGTNIAIGAWRGARAGSFFGQPVSVGTGALIGASAGAIGGSVQCVGWLAGGGR | 5523 | (Bogovic-Matijasic et al. 1998) |
Acidocin LF221B α | MALKTLEKHELRNVMGGNKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN | 3393 | (Bogovic-Matijasic et al. 1998) |
Acidocin LF221B β | MKNFNTLSFETLANIVGGRNNWAANIGGVGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK | 5542 | (Bogovic-Matijasic et al. 1998) |
K7 A | MIEKVSKNELSRIYGGNNVNWGSVAGSCGKGAVMEIYFGNPILGCANGAATSLVLQTASGIYKNYQKKR | 5523 | (Zorič Peternel et al. 2010) |
K7 A (cf) | MKVLNECQLQTVVGGKNWSVAKCGGTIGTNIAIGAWRGARAGSFFGQPVSVGTGALIGASAGAIGGSVQCVGWLAGGGR | 3393 | (Zorič Peternel et al. 2010) |
K7 B | MALKTLEKHELRNVMGGNKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN | 4777 | (Zorič Peternel et al. 2010) |
K7 B (cf) | MKNFNTLSFETLANIVGGRNNWAANIGGAGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK | 5542 | (Zorič Peternel et al. 2010) |
GasE | MKNFNTLSFETLANIVGGRNNLAANIGGVGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK | 5469 | (Maldonado-Barragán et al. 2016) |
GamA (=GasT) | MKNFNTLSFETLANIVGGRNNWAANIGGVGGATVAGWALGNAVCGPACGFVGAHYVPIAWAGVTAATGGFGKIRK | 5542 | This work, (Kawai et al. 2000) |
GamX (=GaeX) | MALKTLEKHELRNVMGGNKWGNAVIGAATGATRGVSWCRGFGPWGMTACGLGGAAIGGYLGYKSN | 4763 | This work |
Bact_1 (=GasS) | MKVLNECQLQTVVGGKNWSVAKCGGTIGTNIAIGAWRGARAGSFFGQPVSVGAGALIGASAGAIGGSVQCVGWLAGGGR | 6060 | This work, (Kasuga et al. 2019) |
Bact_2 (=GasX) | MIEKVSKNELSRIYGGNNVNWGSVAGSCGKGAVMGIYFGNPILGCANGAATSLVLQTASGIYKNYQKKR | 5451 | This work, (Kasuga et al. 2019) |
GamY | MKTLNEQELTQIVGGKGNKGINWANVRCASAVTIGALGGGLAGPGGMVGGFLLGSGACF | 4105 | This work |
GamM | MRKINKEELVEITGGFNAAKCAVGTAGGAFSIARGSAAFGVPGMVIGGILGGAAGALASCK | 4124 | This work |
X, sequence not available; cf., complemental factor; leader sequences are marked in bold where known
In cluster 3, there are 7 further orfs including two additional putative structural genes, designated as gamM and gamY, which appear to encode a further two-component bacteriocin. These putative peptides also show some similarity to other two-peptide component gassericins, but to a lesser extent (Fig. 1b). GamY shows similarity to GamM, with 25.4% identity and 47.6% consensus, and they both have similarity to K7 A cf. (27.5% identity and 38.8% consensus; 25.3% identity, 44.3% consensus, respectively) and to GamA (18.7% identity, 33.3% consensus with GamM). Surrounding gamY and gamM are two genes encoding putative immunity proteins, GamI2 and GamI3, with homology to an enterocin A immunity domain (pfam 08951, 2.8e−7 and 1.1e−6, respectively), a putative transport accessory protein, GamC2, with some similarity to TIGR01295 bacteriocin transport accessory protein (1.18e−9), and thioredoxin superfamily cd02947 (5.21e−7), and two orfs with no matches. The genes on either side of the cluster show amino acid homology to transporters involved in solute or cation transport, and so are not predicted to be part of the cluster.
Identification of antimicrobial peptides in culture
Extraction of both cells and culture supernatants with IPA demonstrated the presence of antimicrobial activity in both samples (Fig. 2a), while MALDI TOF MS analysis of cell extracts demonstrated the presence of peptide masses that were consistent with those predicted by in silico analysis for GamM (4125 Da), GamY (4105 Da), Gam A (5541 Da), Bact_2 (5450 Da), Bact_1 (6059 Da) and Gam X (4765 Da) (Table 3, Fig. 2b). Further purification of these cell extracts by HPLC and analysis of fractions showing antimicrobial activity allowed separation of many of these masses (Fig. 3), identifying masses corresponding to putative GamX (4763 Da, Fig. 3a), GamA, (5541 Da, Fig. 3b), co-eluted GamY and GamM (4107 and 4126 Da respectively, Fig. 3c) and Bact_1 (6057 Da, Fig. 3d), while further purification (HPLC fractionation II) allowed the separation of GamM (4126 Da, Fig. 3e).
MS analysis of culture supernatant samples from HPLC fractionation I which showed antimicrobial activity identified a mass for Bact_2 (5451 Da, Fig. 3f).
Antimicrobial activity of fractions and synergy between synthetic peptides
The antimicrobial activities of three sets of fractions were compared, fractions from HPLC fractionation I of cell extracts (Supplemental Fig. S1), from HPLC fractionation II of these fractionation I samples (Supplemental Fig. S2), and synthetic peptides resuspended in milli Q water at 1 mg/ml. MS profiles of all samples demonstrate that fractions contained separated masses corresponding to all six peptides, although the level of GamX was very low from HPLC fractionation I and HPLC fractionation II gave very small yields of GamY and GamM (Supplemental Fig. S3). All synthetic peptides except GamY showed antimicrobial activity, with the highest activity coming from GamA and Bact_2 (Fig. 4a). Samples from HPLC fractionations also gave clear antimicrobial activity, with GamA and Bact_2 again giving the largest zones of inhibition, and here the fractions containing the mass for GamY showed clear activity (Fig. 4a). The low activity of GamX and, from the second fractionation, GamM, might be due to the low yields of the peptides, and variation in activity between fractionations I and II may also be due to differing yields in fractions (Supplemental Fig. S3). Figure 4b and c show synergy assays between synthetic peptides. We observed clear synergy between Bact_1 and Bact_2 and a possible synergy between Bact_1 and GamA. No synergy was observed between GamM and GamY or between GamA and GamX. Control tests confirmed that IPA did not affect bacterial growth (data not shown).
Complex carbohydrates can favour viability and antimicrobial activity of L. gasseri LM19
L. gasseri LM19 was grown in colon batch model medium, simulating gut conditions, or home-made MRS, alone or supplemented with simple sugars (glucose, lactose and galactose) or complex polymers (inulin, starch and pectin). In general, more viable cells were recovered from MRS; growth on simple sugars was highest at 24 h but, at 48 h, complex carbohydrates gave higher counts (Fig. 5a). Interestingly, growth in the absence of a carbon source at 48 h was similar to that with simple sugars. On batch model medium, cell counts with glucose were lower than with all other treatments, galactose produced the highest counts at 24 h while starch and pectin improved growth at 48 h. Antimicrobial activity from batch model medium with glucose was almost as high as that from MRS despite a ~ 3 log difference in cfu (Fig. 5b). Glucose and galactose supplementation showed the highest antimicrobial activity at 24 h, while complex carbohydrates inulin and pectin produced the highest activity after 48 h.
The changes in activity with carbon supplementation over time suggest control of antimicrobial production in different nutritional environments. Examination of bacteriocin gene expression by RT-qPCR in MRS also showed that an absence of carbon supplementation increased the expression of gamM and gamY significantly at 48 h. Starch supplementation increased the expression of both genes at 24 h, as did inulin at 48 h. Galactose supplementation also produced a significant increase in expression of gamM at 48 h and gamY at 24 and 48 h (Fig. 5c). Other bacteriocin genes did not show notable changes in expression, except for an increase in expression of the helveticin J-like gene in the presence of starch at 24 h (Supplementary Table S1).
In vitro colon model fermentations with L. gasseri LM19
Survival of L. gasseri LM19 and C. perfringens in an in vitro colon model
L. gasseri LM19 was transformed with a plasmid conferring chloramphenicol resistance to allow selection and enumeration of this strain within a mixed microbial community. Transformation of electrocompetent cells gave an efficiency of 1.07 × 102 transformants/ng of DNA. Fermentations with three different faecal donors were performed on three separate occasions with four vessels per fermentation inoculated with L. gasseri LM19-pUK200, C. perfringens NCTC 3110, L. gasseri with C. perfringens, or a media control. Viable L. gasseri counts were measured in the treatment vessel inoculated with L. gasseri LM19-pUK200 alone by selective plating. The numbers recovered increased from 5.30, 5.22 and 5.22 log10 cfu/ml in donors 1, 2 and 3, respectively at 4 h, to 6.12, 6.39 and 6.36 log10 cfu/ml at 8 h and 7.30, 7.31 and 7.47 log10 cfu/ml at 24 h. However, after 48 h, levels of recovery dropped to 3.66, 4.00 and 3.72 log10 cfu/ml. It was not possible to assess L. gasseri LM19 counts in the C. perfringens co-inoculated vessel, as C. perfringens was able to grow on the selective plates. However, analysis of L. gasseri LM19 housekeeping gene gyrase A mRNA levels by RT-qPCR showed that copy numbers were similar in vessels treated with either L. gasseri LM19 alone or with L. gasseri with C. perfringens (data not shown).
C. perfringens levels were measured by qPCR, which detects DNA from both live and dead cells. Addition of L. gasseri LM19 did not have a negative effect on the C. perfringens population in the fermentation with faecal sample from donor 1; there was a tendency to lower C. perfringens counts in co-culture at 24 h with donors 2 and 3, but the changes were not significant (Fig. 6a).
Bacteriocin gene expression
RT-qPCR was used to detect expression of the bacteriocin genes bact_1, bact_2, helveticin-J like, gamA, gamX, gamM and gamY, compared to housekeeping gene gyrase A. This showed detectable levels of bacteriocin gene expression at 24 h both in the vessel where L. gasseri LM19 was inoculated alone and in co-culture with C. perfringens (Fig. 6b). Primers specific to C. perfringens only identified a signal in the two vessels where C. perfringens had been inoculated. At 48 h, expression of only helveticin-J like, gamM and gamY genes was detected (data not shown).
Impact of L. gasseri LM19 on gut microbiota composition
Changes in the colon model microbiota were analysed by 16S rRNA metagenomic profiling. Analysis of relative abundance at order, family and genus level was conducted. The initial bacterial composition was, as expected, different between the three donors (Fig. 6c). Bacterial populations from donor 1 remained relatively stable over 24 h. The addition of L. gasseri LM19, C. perfringens or both did not result in a significant increase in proportions of Lactobacillales or Clostridiales, and all 3 treatments resulted in similar increases in Bifidobacteriales and Coriobacteriales relative to the control, with the L. gasseri LM19 with C. perfringens co-treatment being more similar to the L. gasseri LM19 only condition.
The initial population from donor 2 was constituted mainly of Clostridiales, with some Bacteroidales, Coriobacteriales and Bifidobacteriales. A change can be observed at 24 h in both the control and the samples where L. gasseri LM19 or L. gasseri LM19 with C. perfringens were added, with an increase in Lactobacillales along with a small increase in Enterobacteriales. The decrease in relative abundance of Bifidobacteriales and Coriobacteriales in the control, L. gasseri and C. perfringens with L. gasseri treatments was statistically significant (p < 0.05) and not observed in the C. perfringens sample. C. perfringens alone appeared to prevent the overgrowth of Lactobacillales, while Clostridiales were decreased, being replaced by Enterobacteriales, Bacteroidales, Coriobacteriales and Bifidobacteriales. It was noted that addition of L. gasseri LM19 with C. perfringens gave a profile with more similarity to the control or L. gasseri LM19 only samples.
In L. gasseri LM19 treatment of donor 3 samples, Bifidobacteriales and Enterobacteriales increased over time in a similar way to the control, but Clostridiales were almost completely replaced by Lactobacillales. This rise was not as large when the L. gasseri LM19 was co-inoculated with C. perfringens, while addition of C. perfringens alone did not manage to maintain levels of Clostridales, with increases seen in Enterobacteriales, Bifidobacteriales and Lactobacillales. In this case, the L. gasseri LM19 with C. perfringens co-treatment at 24 h was more similar to the control, with the exception of the presence of Lactobacillales, suggesting that the C. perfringens effect on the microbial composition was changed by the inoculation with L. gasseri.
Presence of L. gasseri LM19 increases SCFA content in a colon model environment
Increases in the production of formic, acetic, propionic and butyric acids were observed in the three faecal fermentations in colon model conditions inoculated with L. gasseri LM9 alone compared to controls. However, there was a high variability in SCFA production between the three donors (Fig. 6d). In donor 1, production of SCFA, ethanol, succinate and, at 8 h only, lactate was increased compared to the control. In donor 2 there were notable increases in lactic acid from 4 h. Given the similar relative abundance of Lactobacillales (Fig. 6d) in control and L. gasseri treatment, this suggests an influence of L. gasseri LM19 on the native microbiota. SCFA content in vessels inoculated with C. perfringens indicated that this bacterium also had the capacity to increase SCFA levels, while values from the co-inoculated vessels indicated that SCFA synthesis from each bacterium was not notably affected by co-inoculation (data not shown).
Discussion
In this study, we report the ability of a representative of the human breast milk microbiota to exhibit antagonistic activity against different enteropathogens and to produce both previously identified bacteriocins and one novel bacteriocin. We observed that different carbon sources have an influence on the expression of these bacteriocin genes. L. gasseri LM19 survived and expressed these antimicrobial genes in a complex faecal environment under simulated colon conditions. This can be considered an important feature, since not all strains that exhibit probiotic traits are able to survive in colon conditions and, therefore, deliver their activity in situ. Additionally, we observed other characteristics that are considered useful, such as the production of SCFA.
Gassericins are antimicrobial peptides produced by L. gasseri. Several gassericins have been identified as two-peptide class II bacteriocins, and some isolates have been shown to contain pairs of two-peptide operons. These two-peptide bacteriocins also show similarities with other two-peptide bacteriocins isolated from species previously grouped with L. gasseri (Tahara et al. 1996). The genome of L. gasseri LM19 encodes a helveticin J-like protein and two gene clusters of two-peptide bacteriocins, encoding peptides that show homology to acidocin LF221A and Gas K7A (Bact_1 and Bact_2) or to acidocin LF221B and Gas K7B (Gam A and GamX). Additionally, in the second half of one of these clusters, we observed the presence of structural genes encoding GamM and GamY, corresponding to a new two-component bacteriocin that showed a greater variation in sequence to previously described gassericins. Although these structural genes were co-located with several putative immunity genes, there were no separate genes for regulation or transport, which suggests that like Gam A and GamX they may use the gamPKR and gamTC located in the same cluster.
MALDI TOF MS analysis of cell extracts confirmed that masses for all 6 peptides were present. Further HPLC fractionation showed that the masses could be separated and associated with antimicrobial activity. However, yields of the single peptides in fractions varied, and the presence of traces of other peptides could not be ruled out, so a direct comparison between activities was problematic. Accordingly, synthetic peptides were produced and assayed. With both HPLC fractions and synthetic peptides, GamA and Bact_2 consistently gave the highest antimicrobial activity, but the activity of synthetic GamM was still notable. It is interesting that synthetic GamY did not show activity, while HPLC fractions containing the GamY mass did—this may be due to trace levels of other peptides in the fraction, which may either contribute their own activity or interact with GamY to facilitate its activity, or to a requirement for some further peptide processing which was not replicated by synthesis. Similarly, the activity for synthetic Bact_1 was lower than that from fractions containing the Bact_1 mass, presumably for the same reasons. Synergistic activity was reported previously between GasT and GatX and between the two components of gassericin S (here Bact_1 and Bact_2), respectively (Kasuga et al. 2019). It is possible that GamY requires the presence of one of the other peptides, possibly GamM, for activity. However, examination of possibly synergy between peptides did not identify any activity from GamY when next to GamM. There was very clear synergy between Bact_1 and Bact_2, and possible synergistic activity between GamA and Bact_1, but the GasT and GatX homologues from this study, GamA and GamX, did not appear to affect each other.
Due to the production of multiple bacteriocins, the activity of single peptides, peptide pairs or possible synergistic reactions are challenging to assess. The antagonistic effect on tested pathogens suggest that these bacteriocins may have different targets or modes of action, as both Gram-positive and Gram-negative bacteria are affected and the nature of the test had an impact on the sensitivity. Although the expression of genes for GamM and GamY was shown to increase notably with different carbon sources, the antimicrobial activity of the culture did not follow the pattern of gamM and gamY expression, indicating that the whole activity encompasses several if not all bacteriocins. Further analysis of a series of multigene knockouts which synthesise single peptides or pairs of peptides should give a clearer analysis of peptide activity and interaction.
The presence of bacteria in human breast milk has been reported previously and the existence of a bacterial entero-mammary pathway has recently been proposed (Rodríguez 2014). These bacteria might have a gut origin and that could explain their ability to survive in GI tract conditions and exhibit antagonistic traits against other gut bacteria, such as enteropathogens, that might share the same environment. This may also explain their ability to utilise complex carbohydrate polymers which are likely to be found in the gut environment, and the observed up-regulation of bacteriocin genes gamM and gamY in a low-sugar environment or with certain complex carbohydrates might produce a competitive advantage. In previous work it was demonstrated that another potentially probiotic L. gasseri, strain K7, which produced 2 two-peptide bacteriocins K7 A, K7 A (cf), K7 B and K7 B (cf), was able to survive in faecal samples. Its bacteriocins were also the focus of examination by conventional PCR and RT-PCR (Treven et al. 2013). In that instance, the authors noted that bacteriocin genes were amplified by PCR from other LAB species present in the environment. However, in our controls and treatments where L. gasseri LM19 was not present, no PCR products were detected.
L. gasseri LM19 showed mixed effects on a strain of C. perfringens added to faecal fermentations of three different donors, causing a slight decrease in C. perfringens in only 2 out of 3 fermentations. This might indicate that the surrounding microbiota plays a synergistic or antagonistic role on the effect of L. gasseri LM19. However, it should be noted that in antimicrobial assays C. perfringens was only inhibited by L. gasseri LM19 cells, not cell-free supernatant, which might suggest that they should be in close proximity for an antimicrobial effect. Co-inoculation of L. gasseri LM19 with C. perfringens did seem to alter the effect of C. perfringens on the background microbiota: in experiments with all three donors, the profiles seen after addition of L. gasseri LM19 with C. perfringens were more similar to instances where L. gasseri was added alone or in control samples than to samples containing only C. perfringens. Although we confirmed that bacteriocin genes were being expressed in these fermentations, other factors such as lactic acid production may also have an impact.
Colon model fermentations also allowed the production of formic, acetic, propionic and butyric acids to be quantified using NMR. We observed an increase in SCFA production in the faecal fermentation of the three donors when L. gasseri LM19 was added compared to the control. However, as with the microbial composition, the amount of each SCFA produced was very different from one donor to another, which might be related to production by other members of the microbiota that varied between the three donors. In a previous study of consumption of a beverage prepared with L. gasseri CP2305, the stools of the participants also presented an increased level of SCFA, while the microbiota experienced some alterations, including an increase in the presence of bacteria from Clostridium cluster IV, known for producing higher amounts of SCFA (Sawada et al. 2016). The authors of that study could not conclude if the increase of SCFA was due to the effect of L. gasseri or due to the proliferation of bacteria that produced more SCFA. Similarly, our addition of C. perfringens also increased SCFA levels to greater than those seen with L. gasseri LM19. SCFA production also depends on diet and availability of nutrients in the gastrointestinal tract as well as the resident microbiota (den Besten et al. 2013; Holmes et al. 2017).
This work shows the ability of L. gasseri LM19, a multi-bacteriocin breast milk isolate, to survive in colon conditions. Its ability to express different bacteriocin genes, including a novel gassericin M, under these conditions, makes it an interesting candidate for further studies.
Electronic supplementary material
Acknowledgements
The authors would like to thank Dr. Lee Kellingray for training in the colon model system and Dr. Lizbeth Sayavedra, Dr. Maria Diaz-Garcia, Dr. Bhavika Parmanand and Saskia Neuert for training in QIIME2.
Funding information
The authors are grateful for funding from Walsh Fellowship Project 2015066 (EG-G) and BBSRC Institute Strategic Programme Grant BB/R012490/1 and BBS/E/F/000PR10356 (Quadram Institute Biosciences, MJM and AN). Research in the Cotter lab is also supported by SFI; PI award “Obesibiotics” (SFI/11/PI/1137) and centre grant “APC Microbiome Institute” (SFI/12/RC/2273).
Compliance with ethical standards
Conflict of interest
The authors declare that they have no conflicts of interest.
Ethical statement
Faecal samples were provided by different donors, from a study approved by the QIB Human Research Governance committee (IFR01/2015) registered at http://www.clinicaltrials.gov (NCT02653001). The participants provided their written informed consent to participate in this study.
Footnotes
Publisher’s note
Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
References
- Abramov V, Khlebnikov V, Kosarev I, Bairamova G, Vasilenko R, Suzina N, Machulin A, Sakulin V, Kulikova N, Vasilenko N, Karlyshev A, Uversky V, Chikindas ML, Melnikov V. Probiotic properties of Lactobacillus crispatus 2,029: homeostatic interaction with cervicovaginal epithelial cells and antagonistic activity to genitourinary pathogens. Probiotics Antimicrob Proteins. 2014;6:165–176. doi: 10.1007/s12602-014-9164-4. [DOI] [PubMed] [Google Scholar]
- Altschul SF, Gish W, Miller W, Myers EW, Lipman DJ. Basic local alignment search tool. J Mol Biol. 1990;215:403–410. doi: 10.1016/S0022-2836(05)80360-2. [DOI] [PubMed] [Google Scholar]
- Bankevich A, Nurk S, Antipov D, Gurevich AA, Dvorkin M, Kulikov AS, Lesin VM, Nikolenko SI, Pham S, Prjibelski AD, Pyshkin AV, Sirotkin AV, Vyahhi N, Tesler G, Alekseyev MA, Pevzner PA. SPAdes: a new genome assembly algorithm and its applications to single-cell sequencing. J Comput Biol. 2012;19:455–477. doi: 10.1089/cmb.2012.0021. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Bogovic-Matijasic B, Rogelj I, Nes IF, Holo H. Isolation and characterization of two bacteriocins of Lactobacillus acidophilus LF221. Appl Microbiol Biotechnol. 1998;49:606–612. doi: 10.1007/s002530051221. [DOI] [PubMed] [Google Scholar]
- Bokulich NA, Kaehler BD, Rideout JR, Dillon M, Bolyen E, Knight R, Huttley GA, Caporaso G. Optimizing taxonomic classification of marker-gene amplicon sequences with QIIME 2’s q2-feature-classifier plugin. Microbiome. 2018;6:90. doi: 10.1186/s40168-018-0470-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Bolger AM, Lohse M, Usadel B. Trimmomatic: a flexible trimmer for Illumina sequence data. Bioinformatics. 2014;30:2114–2120. doi: 10.1093/bioinformatics/btu170. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Carver T, Harris SR, Berriman M, Parkhill J, McQuillan JA. Artemis: an integrated platform for visualization and analysis of high-throughput sequence-based experimental data. Bioinformatics. 2012;28:464–469. doi: 10.1093/bioinformatics/btr703. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Collins FWJ, O’Connor PM, O’Sullivan O, Gómez-Sala B, Rea MC, Hill C, Ross RP. Bacteriocin gene-trait matching across the complete Lactobacillus pan-genome. Sci Rep. 2017;7:3481. doi: 10.1038/s41598-017-03339-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Cotter PD, Ross RP, Hill C. Bacteriocins - a viable alternative to antibiotics? Nat Rev Microbiol. 2013;11:95–105. doi: 10.1038/nrmicro2937. [DOI] [PubMed] [Google Scholar]
- Czárán TL, Hoekstra RF, Pagie L. Chemical warfare between microbes promotes biodiversity. Proc Natl Acad Sci U S A. 2002;99:786–790. doi: 10.1073/pnas.012399899. [DOI] [PMC free article] [PubMed] [Google Scholar]
- den Besten G, van Eunen K, Groen AK, Venema K, Reijngoud D-J, Bakker BM. The role of short-chain fatty acids in the interplay between diet, gut microbiota, and host energy metabolism. J Lipid Res. 2013;54:2325–2340. doi: 10.1194/jlr.R036012. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Field D, Cotter PD, Hill C, Ross RP (2015) Bioengineering lantibiotics for therapeutic success. Front Microbiol 6. 10.3389/fmicb.2015.01363 [DOI] [PMC free article] [PubMed]
- Fujisawa T, Benno Y, Yaeshima T, Mitsuoka T. Taxonomic study of the Lactobacillus acidophilus group, with recognition of Lactobacillus gallinarum sp nov and Lactobacillus johnsonii sp nov and synonymy of Lactobacillus acidophilus group A3 (Johnson et al 1980) with the type strain of L. amylovorus (Nakamura 1981) Int J Syst Bacteriol. 1992;42:487–491. doi: 10.1099/00207713-42-3-487. [DOI] [PubMed] [Google Scholar]
- Garcia-Gutierrez E (2019) New antimicrobials to target gut and food pathogens. PhD thesis, University of East Anglia
- Garcia-Gutierrez E, Mayer MJ, Cotter PD, Narbad A (2018) Gut microbiota as a source of novel antimicrobials. Gut Microbes:1–21. 10.1080/19490976.2018.1455790 [DOI] [PMC free article] [PubMed]
- Hegarty JW, Guinane CM, Ross RP, Hill C, Cotter PD. Bacteriocin production: a relatively unharnessed probiotic trait? F1000Res. 2016;5:2587. doi: 10.12688/f1000research.9615.1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Holmes AJ, Chew YV, Colakoglu F, Cliff JB, Klaassens E, Read MN, Solon-Biet SM, McMahon AC, Cogger VC, Ruohonen K, Raubenheimer D, Le Couteur DG, Simpson SJ. Diet-microbiome interactions in health are controlled by intestinal nitrogen source constraints. Cell Metab. 2017;25:140–151. doi: 10.1016/j.cmet.2016.10.021. [DOI] [PubMed] [Google Scholar]
- Holo H, Nes IF. High-frequency transformation, by electroporation, of Lactococcus lactis subsp. cremoris grown with glycine in osmotically stabilized media. Appl Environ Microb. 1989;55:3119–3123. doi: 10.1128/AEM.55.12.3119-3123.1989. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Joerger MC, Klaenhammer TR. Characterization and purification of helveticin J and evidence for a chromosomally determined bacteriocin produced by Lactobacillus helveticus 481. J Bacteriol. 1986;167:439–446. doi: 10.1128/JB.167.2.439-446.1986. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Karska-Wysocki B, Bazo M, Smoragiewicz W. Antibacterial activity of Lactobacillus acidophilus and Lactobacillus casei against methicillin-resistant Staphylococcus aureus (MRSA) Microbiol Res. 2010;165:674–686. doi: 10.1016/j.micres.2009.11.008. [DOI] [PubMed] [Google Scholar]
- Kasuga G, Tanaka M, Harada Y, Nagashima H, Yamato T, Wakimoto A, Arakawa K, Kawai Y, Kok J, Masuda T. Homologous expression and characterization of gassericin T and gassericin S, a novel class IIb bacteriocin produced by Lactobacillus gasseri LA327. Appl Environ Microb. 2019;85:e02815–e02818. doi: 10.1128/AEM.02815-18. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Kawai Y, Saito T, Toba T, Samant K, Itoh T. Isolation and characterization of a highly hydrophobic new bacteriocin (gassericin a) from Lactobacillus gasseri LA39. Biosci Biotechnol Biochem. 1994;58:1218–1221. doi: 10.1271/bbb.58.1218. [DOI] [PubMed] [Google Scholar]
- Kawai Y, Saitoh B, Takahashi O, Kitazawa H, Saito T, Nakajima H, Itoh T. Primary amino acid and DNA sequences of gassericin T, a lactacin F-family bacteriocin produced by Lactobacillus gasseri SBT2055. Biosci Biotechnol Biochem. 2000;64:2201–2208. doi: 10.1271/bbb.64.2201. [DOI] [PubMed] [Google Scholar]
- Kelsic ED, Zhao J, Vetsigian K, Kishony R. Counteraction of antibiotic production and degradation stabilizes microbial communities. Nature. 2015;521:516–519. doi: 10.1038/nature14485. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Kim PI, Jung MY, Chang Y-H, Kim S, Kim S-J, Park Y-H. Probiotic properties of Lactobacillus and Bifidobacterium strains isolated from porcine gastrointestinal tract. Appl Microbiol Biotechnol. 2007;74:1103–1111. doi: 10.1007/s00253-006-0741-7. [DOI] [PubMed] [Google Scholar]
- Ladero V, Coton M, Fernández M, Buron N, Martín MC, Guichard H, Coton E, Alvarez MA. Biogenic amines content in Spanish and French natural ciders: application of qPCR for quantitative detection of biogenic amine-producers. Food Microbiol. 2011;28:554–561. doi: 10.1016/j.fm.2010.11.005. [DOI] [PubMed] [Google Scholar]
- LeBlanc JG, Chain F, Martín R, Bermúdez-Humarán LG, Courau S, Langella P. Beneficial effects on host energy metabolism of short-chain fatty acids and vitamins produced by commensal and probiotic bacteria. Microb Cell Factories. 2017;16:79–79. doi: 10.1186/s12934-017-0691-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Lewis K. Platforms for antibiotic discovery. Nat Rev Drug Discov. 2013;12:371–387. doi: 10.1038/nrd3975. [DOI] [PubMed] [Google Scholar]
- Li H, Durbin R. Fast and accurate long-read alignment with burrows-wheeler transform. Bioinformatics. 2010;26:589–595. doi: 10.1093/bioinformatics/btp698. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Li H, Handsaker B, Wysoker A, Fennell T, Ruan J, Homer N, Marth G, Abecasis G, Durbin R, Genome Project Data Processing S The sequence alignment/map format and SAMtools. Bioinformatics. 2009;25:2078–2079. doi: 10.1093/bioinformatics/btp352. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Majhenič AČ, Venema K, Allison GE, Matijašić BB, Rogelj I, Klaenhammer TR. DNA analysis of the genes encoding acidocin LF221 A and acidocin LF221 B, two bacteriocins produced by Lactobacillus gasseri LF221. Appl Microbiol Biotechnol. 2004;63:705–714. doi: 10.1007/s00253-003-1424-2. [DOI] [PubMed] [Google Scholar]
- Maldonado-Barragán A, Caballero-Guerrero B, Martín V, Ruiz-Barba JL, Rodríguez JM. Purification and genetic characterization of gassericin E, a novel co-culture inducible bacteriocin from Lactobacillus gasseri EV1461 isolated from the vagina of a healthy woman. BMC Microbiol. 2016;16:37. doi: 10.1186/s12866-016-0663-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Mavrič A, Tompa G, Trmčić A, Rogelj I, Bogovič Matijašić B. Bacteriocins of Lactobacillus gasseri K7 – monitoring of gassericin K7 a and B genes’ expression and isolation of an active component. Process Biochem. 2014;49:1251–1259. doi: 10.1016/j.procbio.2014.04.022. [DOI] [Google Scholar]
- Nagpal R, Ogata K, Tsuji H, Matsuda K, Takahashi T, Nomoto K, Suzuki Y, Kawashima K, Nagata S, Yamashiro Y. Sensitive quantification of Clostridium perfringens in human feces by quantitative real-time PCR targeting alpha-toxin and enterotoxin genes. BMC Microbiol. 2015;15:219–219. doi: 10.1186/s12866-015-0561-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Pandey N, Malik RK, Kaushik JK, Singroha G. Gassericin a: a circular bacteriocin produced by lactic acid bacteria Lactobacillus gasseri. W J Microbiol Biotechn. 2013;29:1977–1987. doi: 10.1007/s11274-013-1368-3. [DOI] [PubMed] [Google Scholar]
- Parmanand BA, Kellingray L, Le Gall G, Basit AW, Fairweather-Tait S, Narbad A (2019) A decrease in iron availability to human gut microbiome reduces the growth of potentially pathogenic gut bacteria; an in vitro colonic fermentation study. J Nutr Biochem. 10.1016/j.jnutbio.2019.01.010 [DOI] [PMC free article] [PubMed]
- Quinlan AR, Hall IM. BEDTools: a flexible suite of utilities for comparing genomic features. Bioinformatics. 2010;26:841–842. doi: 10.1093/bioinformatics/btq033. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Rodríguez JM. The origin of human milk bacteria: is there a bacterial entero-mammary pathway during late pregnancy and lactation? Adv Nutr. 2014;5:779–784. doi: 10.3945/an.114.007229. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Sarmiento-Rubiano L-A, Berger B, Moine D, Zúñiga M, Pérez-Martínez G, Yebra MJ. Characterization of a novel Lactobacillus species closely related to Lactobacillus johnsonii using a combination of molecular and comparative genomics methods. BMC Genomics. 2010;11:504. doi: 10.1186/1471-2164-11-504. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Sawada D, Sugawara T, Ishida Y, Aihara K, Aoki Y, Takehara I, Takano K, Fujiwara S. Effect of continuous ingestion of a beverage prepared with Lactobacillus gasseri CP2305 inactivated by heat treatment on the regulation of intestinal function. Food Res Int. 2016;79:33–39. doi: 10.1016/j.foodres.2015.11.032. [DOI] [Google Scholar]
- Seemann T. Prokka: rapid prokaryotic genome annotation. Bioinformatics. 2014;30:2068–2069. doi: 10.1093/bioinformatics/btu153. [DOI] [PubMed] [Google Scholar]
- Selle K, Klaenhammer TR. Genomic and phenotypic evidence for probiotic influences of Lactobacillus gasseri on human health. FEMS Microbiol Rev. 2013;37:915–935. doi: 10.1111/1574-6976.12021. [DOI] [PubMed] [Google Scholar]
- Singh A, Vishwakarma V, Singhal B. Metabiotics: the functional metabolic signatures of probiotics: current state-of-art and future research priorities—metabiotics: probiotics effector molecules. Adv Biosci Biotec. 2018;04:43. doi: 10.4236/abb.2018.94012. [DOI] [Google Scholar]
- Tahara T, Oshimura M, Umezawa C, Kanatani K. Isolation, partial characterization, and mode of action of acidocin J1132, a two-component bacteriocin produced by Lactobacillus acidophilus JCM 1132. Appl Environ Microb. 1996;62:892–897. doi: 10.1128/AEM.62.3.892-897.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Tahara T, Yoshioka S, Utsumi R, Kanatani K. Isolation and partial characterization of bacteriocins produced by Lactobacillus gasseri JCM 2124. FEMS Microbiol Lett. 1997;148:97–100. doi: 10.1111/j.1574-6968.1997.tb10273.x. [DOI] [PubMed] [Google Scholar]
- Treven P, Turkova K, Trmčić A, Obermajer T, Rogelj I, Matijašić BB. Detection and quantification of probiotic strain Lactobacillus gasseri K7 in faecal samples by targeting bacteriocin genes. Folia Microbiol. 2013;58:623–630. doi: 10.1007/s12223-013-0252-8. [DOI] [PubMed] [Google Scholar]
- Untergasser A, Cutcutach I, Koressaar T, Ye J, Faircloth B, Remm M, Rozen S. Primer 3-new capabilities and interfaces. Nucleic Acids Res. 2012;40:e115. doi: 10.1093/nar/gks596. [DOI] [PMC free article] [PubMed] [Google Scholar]
- van Heel AJ, de Jong A, Montalban-Lopez M, Kok J, Kuipers OP. BAGEL3: automated identification of genes encoding bacteriocins and (non-)bactericidal posttranslationally modified peptides. Nucleic Acids Res. 2013;41:W448–W453. doi: 10.1093/nar/gkt391. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Weber T, Blin K, Duddela S, Krug D, Kim HU, Bruccoleri R, Lee SY, Fischbach MA, Müller R, Wohlleben W, Breitling R, Takano E, Medema MH. antiSMASH 3.0—a comprehensive resource for the genome mining of biosynthetic gene clusters. Nucleic Acids Res. 2015;43:W237–W243. doi: 10.1093/nar/gkv437. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Wegmann U, Klein JR, Drumm I, Kuipers OP, Henrich B. Introduction of peptidase genes from Lactobacillus delbrueckii subsp. lactis into Lactococcus lactis and controlled expression. Appl Environ Microb. 1999;65:4729–4733. doi: 10.1128/AEM.65.11.4729-4733.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
- Yamano T, Iino H, Takada M, Blum S, Rochat F, Fukushima Y. Improvement of the human intestinal flora by ingestion of the probiotic strain Lactobacillus johnsonii La1. Brit J Nutr. 2007;95:303–312. doi: 10.1079/BJN20051507. [DOI] [PubMed] [Google Scholar]
- Zorič Peternel M, Čanžek Majhenič A, Holo H, Nes IF, Salehian Z, Berlec A, Rogelj I. Wide-inhibitory spectra bacteriocins produced by Lactobacillus gasseri K7. Probiotics Antimicrob Proteins. 2010;2:233–240. doi: 10.1007/s12602-010-9044-5. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.