Skip to main content
Elsevier - PMC COVID-19 Collection logoLink to Elsevier - PMC COVID-19 Collection
. 2020 Apr 29;158:159–179. doi: 10.1016/j.ijbiomac.2020.04.191

A cutting-edge immunoinformatics approach for design of multi-epitope oral vaccine against dreadful human malaria

Manisha Pritam a, Garima Singh a, Suchit Swaroop b, Akhilesh Kumar Singh c, Brijesh Pandey c, Satarudra Prakash Singh c,
PMCID: PMC7189201  PMID: 32360460

Abstract

Human malaria is a pathogenic disease mainly caused by Plasmodium falciparum, which was responsible for about 405,000 deaths globally in the year 2018. To date, several vaccine candidates have been evaluated for prevention, which failed to produce optimal output at various preclinical/clinical stages. This study is based on designing of polypeptide vaccines (PVs) against human malaria that cover almost all stages of life-cycle of Plasmodium and for the same 5 genome derived predicted antigenic proteins (GDPAP) have been used. For the development of a multi-immune inducer, 15 PVs were initially designed using T-cell epitope ensemble, which covered >99% human population as well as linear B-cell epitopes with or without adjuvants. The immune simulation of PVs showed higher levels of T-cell and B-cell activities compared to positive and negative vaccine controls. Furthermore, in silico cloning of PVs and codon optimization followed by enhanced expression within Lactococcus lactis host system was also explored. Although, the study has sound theoretical and in silico findings, the in vitro/in vivo evaluation seems imperative to warrant the immunogenicity and safety of PVs towards management of P. falciparum infection in the future.

Keywords: Immunoinformatics, Malaria, Plasmodium falciparum, Vaccine, Molecular docking, Epitope

1. Introduction

World Health Organization has documented almost 405,000 deaths including 228 million infections globally towards human malaria disease [1]. Five diverse species of Plasmodium, i.e., P. falciparum, P. vivax, P. malariae, P. ovale, as well as P. knowlesi are culprit for the disease outbreak in which P. falciparum has stood first for lethality. About 99.7 and 62.8% disease cases were documented merely for P. falciparum (Pf) in African as well as South-East Asia realms, respectively, which further supports the above fact [2]. In recent findings, P. vivax has also been found capable to develop severe malaria amongst populations living in sub-tropical countries [3]. The only preferred option is cost intensive chemotherapy for human malaria [4,5]. The reason being the fact that currently, none of cutting-edge effective human malaria vaccine is accessible, which can provide protection towards most of the world-wide population together with endemic regions. On the other hand, the exhaustive research from decades has led to development of total 44 malaria vaccine candidates together with 19 subunit, 10 DNA, 10 recombinant vector, 1 recombinant protein as well as 4 live/attenuated vaccine preparations, of which, merely 7 vaccines are revealed for human host (http://www.violinet.org/). Most of these vaccines are either single or multi-antigens derived from various life-cycle stages of the parasites P. falciparum, P. vivax, P. yoelii, P. berghei and P. chabaudi [6,7]. For instance, Pf vaccine combination involves multi-antigens namely MSP1, MSP2 and RESA derived from blood-stage [8], while NYVAC-Pf7 includes antigens CS, SSP2, LSA1, MSP1, AMA1, SERA as well as Pfs25 from multi-stage of pathogenic life-cycle [9]. Besides these, P. falciparum reticulocyte-binding homologue 5 (PfRH5) was also reported as good antigen for development of malaria vaccine [10,11] that elicits human monoclonal antibody in vaccine trial [12]. Most of the aforesaid vaccines were found to elicit immune responses, but unfortunately, failed to clear phase-III clinical trial owing to rapid waning of vaccine efficacy due to geographical antigenic variation and human leukocyte antigen (HLA) allelic diversity [3,[13], [14], [15]]. Apart from these, apoptosis of infected erythrocytes and their inability to express HLA class I molecules on cell surface that assists in avoiding cytotoxic T lymphocytes (CTL) response is also another aspect [[16], [17], [18]]. Thus, there is pressing need towards the development of innovative vaccines using reverse vaccinology together with immunoinformatics that can target majority of the stages of parasite's life-cycle including species level conservation so as to cover the world-wide human population [19].

In last two decades, the reverse vaccinology strategy has been extensively exploited by world-wide research groups for genome-wide screening of vaccine antigens against several pathogens like Neisseria meningitides serogroup B, P. falciparum, Leishmania and so on [[20], [21], [22], [23], [24]]. It has been synergistically progressive with onset of immunoinformatics, which is another cost-effective and quicker strategy towards prediction of B- as well as T-cell epitopes present on antigenic proteins and targeted population coverage analysis [[25], [26], [27], [28], [29]]. In recent years, the aforementioned strategies have been used very frequently in designing of novel vaccines by various researchers against different diseases like Dengue [30], Schistosomiasis [31], Fascioliasis [32], Encephalitis [33], Lassa fever [34], Neonatal meningitis [35] and H7N9 influenza A [36]. Furthermore, Toll-like receptors (TLRs), e.g., TLR-2, TLR-4 and TLR-9 typically present in plasma membrane of host cell recognized as pathogen-associated molecular patterns (PAMPs) that provokes phagocytosis and develop innate immune responses through production of cytokines, interleukins, and antibodies that prohibit the parasite entry in pre-erythrocytic stage of malaria [[37], [38], [39], [40]]. To the best of our knowledge, this is one of the first computational studies for designing of multi-epitope based oral vaccine against human malaria. Overall, this investigation focuses on the designing of 15 innovative polypeptide vaccines (PVs) utilizing predicted B- and/or T-cell epitopes sourced from 5 genome derived predicted antigenic proteins (GDPAP) assembled together with specific linkers and adjuvants towards P. falciparum malaria [24].

2. Methodology

The methodological flow chart depicting the strategy for development of innovative PVs is presented in Fig. 1 with following steps: (i) Selection of P. falciparum 3D7 protein sequences and homology study, (ii) B-cell epitopes prediction, (iii) Prediction of HLA class I and II restricted T-cell epitope ensemble, (iv) Prediction of IL-10 and IFN-γ inducing T cell epitopes (v) Designing or selection of test PVs, positive as well as negative polypeptide vaccine controls using chimeric technique, (vi) Tertiary structure prediction and molecular docking of PVs with TLR2 and TLR4 receptors, (vii) Characterization of structural and functional properties viz. secondary structure, physicochemical, adhesion, antigenicity, allergenicity, solubility and biological activity of leading PVs (viii) Immune simulation of leading PVs, (ix) Molecular docking of leading PVs with protective antibodies (IgG1 and IgG3), (x) Molecular dynamics of leading PVs complexed with TLR2 and TLR4 and (xi) In silico cloning and expression of potent PVs in Lactococcus lactis etc. Further, the accomplishment of aforementioned steps required various bioinformatics tools, which are provided in Table 1 .

Fig. 1.

Fig. 1

Strategy of the present work for development of effective malaria polypeptide vaccines.

Table 1.

Bioinformatics tools used in the present study for designing of polytope vaccines.

S. no. Prediction/analysis tools Function Accuracy (%)/AUC/R2 Website
1 AllergenFP Allergenicity of peptide 88.00% ddg-pharmfac.net/AllergenFP/
2 ANTIGENpro Protein antigenicity 76% http://scratch.proteomics.ics.uci.edu/
3 BCPREDS Linear B-cell epitopes 0.8 ailab.ist.psu.edu/bcpred/predict.html
4 CamSol Protein solubility 0.98 http://www-vendruscolo.ch.cam.ac.uk/camsolmethod.html
5 C-ImmSim Immune simulation N.A http://kraken.iac.rm.cnr.it/C-IMMSIM/?page=1
6 ClusPro 2.0 Protein-protein docking N.A cluspro.bu.edu/home.php
7 DeepGOPlus Protein function 0.9 http://deepgoplus.bio2vec.net/deepgo/
8 DiscoTope 2.0 Conformational B-cell epitopes 0.73 www.cbs.dtu.dk/services/DiscoTope/
9 ExPASy-ProtParam Grand average of hydropathicity N.A web.expasy.org/protparam/
10 IEDB-AR Population coverage analysis of epitopes N.A tools.iedb.org/population/
11 IEDB-AR (consensus method) HLA class I epitope 0.86 tools.iedb.org/mhci/
HLA class II epitope 0.85 tools.iedb.org/mhcii/
12 IFNepitope IFN-γ inducing peptides 82.10% crdd.osdd.net/raghava/ifnepitope/
13 IL-10Pred Interleukin-10 inducing 72.30% crdd.osdd.net/raghava/IL-10pred/
14 IL-4Pred Interleukin-4 inducing peptide 64.76% webs.iiitd.edu.in/raghava/il4pred/scan.php
15 iMODS Normal mode analysis N.A http://imods.chaconlab.org/
16 JCat Codon optimization N.A http://www.jcat.de/
17 ModRefiner High-resolution protein structure refinement N.A zhanglab.ccmb.med.umich.edu/ModRefiner/
18 PROCHECK Stereochemical quality of a protein structure N.A servicesn.mbi.ucla.edu/PROCHECK/
19 ning of PVs and codon opti Protein antigenicity prediction 75% http://imed.med.ucm.es/Tools/antigenic.html
20 Protein-Sol Protein solubility 0.97 https://protein-sol.manchester.ac.uk/
21 PSIPRED 4.0 Secondary structure 84.20% bioinf.cs.ucl.ac.uk/psipred/
22 RaptorX Protein structure modelling 0.89 raptorx.uchicago.edu/
23 Recombinant protein solubility prediction Protein solubility 88% http://www.biotech.ou.edu/
24 Secret-AAR Protein antigenicity N.A http://microbiomics.ibt.unam.mx/tools/aar/
25 SOLPro Protein solubility 74% http://scratch.proteomics.ics.uci.edu/
26 SPAAN Adhesin protein 97.4% http://www.violinet.org/vaxign/
27 VaxiJen 2.0 Protein antigenicity 78.00% www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html

N.A: not available; AUC: area under ROC curve; R2: correlation of coefficient.

2.1. Selection of P. falciparum protein sequences

Our previous study revealed five protein sequences of P. falciparum 3D7 genome as promising antigenic adhesion proteins [24]. Therefore, in the present study, these malarial adhesion proteins viz. circumsporozoite protein (CSP: PF3D7_0304600), surface protein P113 (P113: PF3D7_1420700), merozoite surface protein 1 (MSP1: PF3D7_0930300), 28 kDa ookinete surface protein (P28: PF3D7_1030900) and 25 kDa ookinete surface antigen precursor (P25: PF3D7_1031000) were considered as platform for designing of new PVs. Further, the BLASTp tool was used to explore homologous sequences amongst human malaria parasites.

2.2. B-cell epitopes prediction

The presence of linear (16-mer) and conformational B-cell epitopes were predicted using BCPREDS and DiscoTope tools, respectively.

2.3. Forecast of T-cell epitopes

The linear B- cell epitope sequences (as forecasted in section 2.2) were used as input for forecast of HLA class I and II restricted T-cell epitopes through IEDB based consensus strategy with threshold criteria of binding affinity (IC50) ≤ 500 nM and percentile rank ≤3, correspondingly.

2.4. Forecast of population coverage and selection of T-cell epitope ensemble

The IEDB based population coverage tool was exploited towards the predicted population coverage (PPC) analysis of forecasted T-cell epitopes with their corresponding HLA binding alleles. Further, HLA class I as well as II epitope ensemble was developed as described previously [24]. Finally, HLA class I and II epitope ensembles were then mapped to forecasted continuous B-cell epitopes.

2.5. Prediction of cytokine responses

The induction of cytokines response predictions, i.e., IL-4, IL-10 and IFN-γ were carried out for epitope ensembles using tools IL-4Pred, IL-10Pred and IFNepitope, correspondingly.

2.6. Designing of multi-epitope PVs

In this study, the new multi-epitope PVs were developed using the linker EAAAK (L1) at N-terminal with or without adjuvant following Ali et al. [30] where Cholera toxin B subunit (A: UniProt accession no. AIE88420.1) and 50S ribosomal L7/L12 (B: UniProt accession no. P9WHE3) were used as adjuvants against TLR-2 (PDB ID: 2Z7X) and TLR-4 (PDB ID: 4G8A), correspondingly. During PVs designing, the epitopes were coupled with linkers by adopting following strategies: HLA class I epitopes with GGGS (L2), HLA class II epitopes with GPGPG (L3), B-cell epitopes with L2 or L3, HLA class I and II epitope with L3, HLA class II epitope and B-cell epitope with L3. Also, the adjuvants were coupled with epitopes using linker L1. The linker L1 was also employed to connect adjuvant with HLA class I and B-cell epitope [[41], [42], [43], [44], [45]].

2.7. Tertiary structure prediction and molecular docking of PVs with TLR2 and TLR4 receptors

The forecast of tertiary structures of PVs was performed using RaptorX tool. Further, the refinement as well validation of 3D structure was carried out by tools ModRefiner and PROCHECK, respectively. The molecular docking studies of PVs with molecular complex receptors TLR2-TLR1 (PDB ID: 2Z7X) and TLR4-MD2 (PDB ID: 4G8A) were performed using ClusPro 2.0 tool. The PVs developed without and with TLR2 and TLR 4 specific adjuvants that were docked with receptors TLR2-TLR1 and TLR4-MD2, correspondingly. The ligands Escherichia coli heat labile enterotoxin type IIB B-pentamer (C1; PDB ID: 1QB5) and carbohydrate recognition and neck domains of surfactant protein A (C2; PDB ID: 1R13) were used as controls for docking with receptors TLR2 and TLR4, correspondingly [46,47].

2.8. Characterization of structural and functional properties of leading PVs with positive vaccine controls

The self-assembling protein nanoparticles (SAPN) from P. falciparum FMP014 (C3) and fusion protein from Staphylococcus aureus (C4) were selected as positive vaccine controls as detailed previously in Kaba et al. [48] and Ahmadi et al. [49] for comparative evaluation of several properties of leading PVs., respectively. The physico-chemical properties [Grand Average Hydropathy (GRAVY), molecular weight, isoelectric point (pI) and half-life] were calculated using ExPASy-ProtParam tool. The antigenic properties were predicted with the involvement of VaxiJen2.0, ANTIGENpro, Protein antigenicity prediction by Kolaskar and Tongaonkar and Secret-AAR tools. Further, the recombinant protein solubility was predicted using tools RPSP, Protein-Sol, CamSol and SOLPro. The analysis of secondary structure elements (alpha helix, extended strand and random coil) were performed using PSIPRED tool. Further, tertiary structure analysis was carried using tools ModRefiner and PROCHECK. The biological function and allergenicity were evaluated based on tools DeepGOPlus and AllergenFP, correspondingly.

2.9. Immune simulation of leading PVs

The best docked complex (in terms of lowest docking energy) PVs with receptors TLR2 and TLR4 were chosen for immune simulation study using C-ImmSim tool along with two positive vaccine controls (C3, C4) as mentioned in section 2.8 and one negative vaccine control (C5) so as to compare the simulation results. The C5 was designed using suitable linkers as well as non-binding HLA class I and II epitopes by applying the same strategies as used in PVs. The non-epitopes were screened using the criteria of 14 lowest ranking HLA class I (HLA-A*0201, -B*5301) and 3 lowest ranking HLA class II (HLA-DRB1–0411) as predicted by IEDB based consensus method, correspondingly in a randomly selected highly variable erythrocyte membrane protein 1, (PfEMP1: PF3D7_0617400.1). The C-ImmSim is a simulator of agent-based model, which forecasts the induction of immune response (cellular and humoral response) along with forecast of T-cell epitope as well as B-cell epitope [50]. The default simulation parameters were chosen except HLA allele, number of antigen (10000) and time steps [51]. The host HLA alleles (HLA-A*02:01, HLA-B*53:01 and HLA-DRB1*04:11) were selected based on prevalent alleles associated with human malaria [[52], [53], [54], [55]]. The time steps 1, 42 and 84 were selected following Kaba et al. [48].

2.10. Molecular docking of leading PVs and antibodies IgG1 and IgG3

The molecular docking between antibodies IgG1 (PDB ID: 6B5L) as well as IgG3 (PDB ID: 5BK0) with PVs (PV1A/PV3B) were performed using ClusPro 2.0 tool along with co-crystallized respective control epitopes NPDPNANPNVD (C6, IEDB ID: 756359) and NANPNANPNANPNANPNANP (C7, IEDB ID: 43248) of Pf CSP [56,57].

2.11. Molecular dynamics of leading PVs complexed with TLR2/TLR4

Molecular dynamics of top 2 docked complexes PV1A-TLR2 and PV3B-TLR4 were performed through iMODS server to explain the collective protein motion in the internal coordinates through normal mode analysis (NMA). The NMA in dihedral coordinates naturally mimics the combined functional motions of protein molecules modelled as a set of atoms connected by harmonic springs [58].

2.12. Codon optimization and in silico cloning of leading PVs

The DNA coding sequences of the oral PVs (PV1A and PV3B) were optimized for elevated protein expression using Java Codon Adaptation Tool (JCat) involving following options: i) Lactococcus lactis (strain IL1403) as expression host, ii) avoid rho-independent transcription terminators, iii) avoid prokaryotic ribosome binding sites and iv) avoid cleavage sites of restriction enzymes. Further, for in silico cloning of PV1A and PV3B cDNA (with stop codon) SnapGene software was used involving insertion at restriction site of FspI (6006) in plasmid vector pIL1 (Gene bank accession number: HM021326) [59].

3. Results and discussion

According to VIOLIN database (accessed on June 26, 2019), total 16 vaccines available so far for against P. falciparum from different life-cycle stages, but they have not succeed to get approval from FDA, USA for world-wide marketing [60]. The RTS,S/AS01 is the only world's first European Medicines Agency (EMA) approved malaria vaccine with partial protection in young children (36.3%) for use to only Sub-Saharan African region along with severe adverse effect (24.2%–28.4%) and incurable adverse effect (1.5%–2.5%) [61,62]. In addition, the efficacy was further declined to almost zero after 4th year and negative in 5th year [63]. The aforementioned facts warrant exhaustive efforts/research towards the development of a more effective PV that can elicit robust immune response globally. The present study is an extension of our previous report [24] that exploits 5 homologous antigens conserved amongst human malaria parasites P. falciparum, P. vivax, P. ovale and P. malariae (with minimum 38.62% identity recognized through BLASTp tool) as potential platform for designing of PVs [64].

3.1. Prediction of B- and T-cell epitopes for screening of epitope ensemble

In recent years, epitope based designing of vaccine is a new strategy that has been employed by world-wide researchers towards the development of efficient PVs against numerous diseases such as leishmaniasis, malaria and so on. In this context, the exploitation of computational approaches is not only cost-effective for vaccine development but also diminishes time period and risk of failure in experimental studies [26,27,65,66]. In this study, 82 continuous B-cell epitopes were forecasted from 5 GDPAP using BCPREDS (Supplementary Table S1). These 82 continuous B-cell epitopes were found to possess total 433 T-cell epitopes including 142 HLA class I epitopes and 291 HLA class II epitopes (Supplementary Table S2). These T-cell epitopes were forecasted from the pool of predicted continuous B-cell epitopes as the antigen presentation to T-cells was supposed to be more efficient if it is recognized by the B-cell. In addition, an antigen-specific B-cell may present multiple T-cell epitopes to the immune system and, thus enhances its ability to be triggered in a specific manner [[67], [68], [69]]. Further, based on the PPC analysis an epitope ensemble of 13 HLA class I epitopes with 98.75% and 3 HLA class II epitopes with 56.85% world coverage were designed using criteria described previously (Table 2) [24]. However, a combined set of 16 HLA class I and II epitope ensemble revealed human population coverage of highest 99.46% and lowest 94.47% for world and South America, respectively (Fig. 2). The aforementioned criteria involved the screening of cross-presented epitopes amongst different set of HLA binding alleles in a selected population with higher PPC and VaxiJen score. The technique of identifying such ‘promiscuous’ epitopes that cover diverse HLA alleles of affected population are highly desirable as they could enhance the vaccine efficacy [51]. Concerning HLA class I epitope ensemble of P. falciparum, epitopes YTLTAGVCV (T1) and YFNDDIKQF (T5) covered 56.56% and 39.26% of world population were also reported in similar study conducted by Pritam et al. [24].

Table 2.

Details of predicted T-cell epitope ensemble including HLA binding alleles along with their source linear B-cell epitope.

S. no. T-cell epitope number T-cell epitopes with start and end position B-cell epitope number (Antigen) Linear B-cell epitopes with start and end position Predicted population coverage (%) HLA binding alleles
HLA class I
1 T1 100YTLTAGVCV108 B1 (P28) 98TEYTLTAGVCVPNVCR113 56.56 HLA-A*02:06, HLA-A*02:01, HLA-A*68:02, HLA-C*05:01, HLA-C*15:02, HLA-C*12:03, HLA-C*14:02
2 T2 421YPNGIVYPL429 B2 (MSP1) 417PKVPYPNGIVYPLPLT432 53.84 HLA-A*68:02, HLA-B*07:02, HLA-B*18:01, HLA-B*08:01, HLA-B*39:01, HLA-B*35:01, HLA-B*53:01, HLA-C*03:03, HLA-C*14:02, HLA-C*12:03
3 T3 46VLHCEVQCL54 B3 (P113) 45YVLHCEVQCLNGNNEI60 40.93 HLA-A*02:01, HLA-C*14:02
4 T4 90YACKCNLGY98 B4 (P25) 84DGNPVSYACKCNLGYD99 40.73 HLA-A*01:01, HLA-A*29:02, HLA-B*15:01, HLA-B*35:01, HLA-C*12:03
5 T5 1013YFNDDIKQF1021 B5 (MSP1) 1006ILKNNDTYFNDDIKQF1021 39.26 HLA-A*23:01, HLA-A*29:02, HLA-C*14:02, HLA-C*07:02, HLA-C*12:03
6 T6 450LMNPHTKEK458 B6 (MSP1) 447YGDLMNPHTKEKINEK462 38.48 HLA-A*03:01, HLA-A*11:01, HLA-A*30:01, HLA-A*31:01
7 T7 580YRLKENKDY588 B7 (P113) 579YYRLKENKDYDVVSSI594 33.31 HLA-C*07:01, HLA-C*06:02
8 T8 105GVCVPNVCR113 B1(P28) 98TEYTLTAGVCVPNVCR113 25.64 HLA-A*11:01, HLA-A*31:01, HLA-A*68:01
9 T9 1104NVLQNFSVF1112 B8 (MSP1) 1097NSLNNPHNVLQNFSVF1112 23.15 HLA-A*23:01, HLA-B*15:01, HLA-B*15:02, HLA-B*35:01
10 T10 98TEYTLTAGV106 B1(P28) 98TEYTLTAGVCVPNVCR113 19.88 HLA-A*68:02, HLA-B*18:01, HLA-B*40:02, HLA-B*44:02
11 T11 1117KEAEIAETE1125 B9 (MSP1) 1115KKKEAEIAETENTLEN1130 7.81 HLA-B*40:01
12 T12 1310GESEDNDEY1318 B10 (MSP1) 1309FGESEDNDEYLDQVVT1324 6.27 HLA-B*44:03
13 T13 1120EIAETENTL1128 B9 (MSP1) 1115KKKEAEIAETENTLEN1130 5.82 HLA-A*25:01, HLA-A*68:02



HLA class II
14 T14 1350PLAGVYRSLKKQIEK1364 B11
(MSP1)
1350PLAGVYRSLKKQIEKN1365 41.75 HLA-DRB1*03:08, HLA-DRB1*03:06, HLA-DRB1*03:07, HLA-DRB1*03:09, HLA-DRB1*03:01, HLA-DRB1*03:05, HLA-DRB1*07:03, HLA-DRB1*04:05, HLA-DRB1*08:01, HLA-DRB1*08:17, HLA-DRB1*11:20, HLA-DRB1*08:06, HLA-DRB1*11:01, HLA-DRB1*11:14, HLA-DRB1*08:13, HLA-DRB1*11:07, HLA-DRB1*11:21, HLA-DRB1*11:02, HLA-DRB1*13:21, HLA-DRB1*13:04, HLA-DRB1*13:07, HLA-DRB1*11:28, HLA-DRB1*13:05, HLA-DRB1*13:23, HLA-DRB1*13:01, HLA-DRB1*13:27, HLA-DRB1*13:28, HLA-DRB1*13:22
15 T15 1007LKNNDTYFNDDIKQF1021 B5 (MSP1) 1006ILKNNDTYFNDDIKQF1021 20.03 HLA-DRB1*03:09, HLA-DRB1*03:05, HLA-DRB1*03:01, HLA-DRB1*04:21, HLA-DRB1*04:02, HLA-DRB1*04:10, HLA-DRB1*13:04, HLA-DRB3*01:01
16 T16 125DPANSLTHTCSCNIG139 B12 (P28) 124VDPANSLTHTCSCNIG139 18.25 HLA-DRB1*07:01, HLA-DRB1*07:03

Fig. 2.

Fig. 2

The malaria endemic population coverage analysis of combined HLA class I and II binding epitope ensemble used in designing of PVs obtained by IEDB analysis tool.

3.2. Induction of cytokine responses of epitope ensemble

In case of malaria, adaptive immune system elicits both cellular and humoral immune responses, which are associated with B and T lymphocytes, respectively. However, mainly the CD4+ T lymphocytes (also known as helper T cell (Th), Th1 and Th2) elicit IFN-γ and IL-4, correspondingly) regulate the malaria infection [68,70]. Besides these, TLRs are also involved in the activation of different signalling cascade that ultimately express the genes of pro-inflammatory cytokines like IFN-γ, etc. [71]. The IFN-γ is associated with depletion of liver-stage parasites [72,73]. This is also supported by present study, where the epitopes T2, T7, T8, T10, T11 and T1, T2, T3, T4, T5, T6, T7, T8, T9, T11, T12, T13, T14, T16 were found to induce the IFN-γ and IL-4 responses, correspondingly (Supplementary Table S3). Amongst aforementioned epitopes ensemble, the T14 was recorded as one of the potent candidate to induce IL-10 response that found to suppresses the pathogenic inflammatory responses concerning control of malaria parasite [74].

3.3. Design of PVs for malaria

Linear B-cell epitopes is linked to antibody generation, where identification of such epitopes using traditional approaches is not only costly but also time consuming with involvement of difficult processes [75]. In order to overcome aforementioned issues, the present study involved the prediction of T-cell epitopes using linear B-cell epitopes as input instead of whole antigen so as to minimize not only the size of PV but also elicit both cellular (T-cell epitope) as well as humoral (B-cell epitope) immune responses. Further, the non toxic nature of adjuvants A and B also helps in production of several cytokines (e.g., INF-γ, TNF-α, IL-2, IL-4, IL-6, IL-12) through induction of dendritic cell, B-cell, macrophage and T-cell, which ultimately boost the concentration of the antibodies reported in several studies linked to various disease causing agents including human rotavirus, HIV, Helicobacter pylori, Influenza virus [[76], [77], [78], [79]]. Therefore, 15 PVs were designed through epitope ensemble of T-cell epitopes and/or linear B-cell epitopes having epitope ensemble with different linkers as well as adjuvants, which are responsible for the activation of TLR2 and TLR4 receptors pertaining to malaria. Initially, five non-adjuvant PVs (PV1-PV5) were designed followed by incorporation of TLR2 and TLR4 binding specific adjuvants that resulted into respective design of 10 adjuvant PVs, i.e., PV1A-PV5A and PV1B-PV5B (Table 3 ). Further, EAAAK linker was incorporated at N-terminal of PVs as it is stiff and prevents the assembly of adjuvant with other vaccine domain [80,81]. Although, the adjuvants are found to enhance the immunogenicity of vaccines but they may cause toxicity/adverse reaction. Therefore, we have designed 5 PVs without adjuvants, where the designing of PV1 having only T-cell epitopes (HLA class I and II) and they were joined together by using linker L2 and L3. Likewise, in PV2, we have exploited merely linear B-cell epitopes attached together with linker L3. Similarly in PV3, both T- and B- cell epitopes were joined with linkers L2 and L3 while, in PV4, we have exploited merely linear B- cell epitopes attached together with linker L2. Amongst these two linkers, L3 is a universal linker, which can enhance the proteasome processing along with immunogenicity, while L2 is a flexible linker that can stimulate better immune response [42,77,82]. As exemplary vaccine is found to induce multi-immune response (B- and T-cell immune response), therefore in the designing of further PVs both the T- and B- cell epitopes were used so as to elicit humoral/cellular response [83]. The PV3 and PV5 were differing from each other with respect to linkers L3 and L2, respectively used for joining continuous B-cell epitopes. However, in case of designing a negative polypeptide vaccine control, linkers L2 and L3 were employed to connect non-HLA class I and II T-cell epitopes (Table 3). Fig. 3 (a, b) depicts the exemplar design of PV1 and PV3 with adjuvants A and B i.e., PV1A and PV3B. The advantage of using linkers and adjuvants used in the present study for designing of multi-epitope malaria PVs have been also revealed by several contemporary researchers against other diseases [36,84,85] to enhance the antigen processing and presentation ability as well as immunogenicity. Also, the cost effective Cholera toxin B subunit adjuvant is cytokines inducer (Th1 and Th2 response), which increases the antibody titration [86]. Thus, the use of both T-cell and B-cell epitopes together with linkers and adjuvants can increase the potential of PVs towards induction of multi immune responses.

Table 3.

Order of linkers, epitopes and adjuvants used in designing of 15 polypeptide vaccines and positive as well as negative vaccine controls.

S. no Type of polypeptide vaccine No. of amino acids Design of polypeptide vaccine/sequence
1 PV1 235 L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L3
2 PV1A 364 L1-A-L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L3 (EAAAKMIKLKFGVFFTVLLSSAYANGTPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMANEAAAKYPNGIVYPLGGGSYFNDDIKQFGGGSLMNPHTKEKGGGSNVLQNFSVFGGGSKEAEIAETEGGGSGESEDNDEYGGGSEIAETENTLGGGSYTLTAGVCVGGGSGVCVPNVCRGGGSTEYTLTAGVGGGSYACKCNLGYGGGSVLHCEVQCLGGGSYRLKENKDYGPGPGPLAGVYRSLKKQIEKGPGPGLKNNDTYFNDDIKQFGPGPGDPANSLTHTCSCNIGGPGPG)
3 PV1B 370 L1-B-L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L3
4 PV2 299 L1-B2-L3-B5-L3-B6-L3-B8-L3-B9-L3-B10-L3-B9-L3-B1-L3-B4-L3-B3-L3-B7-L3-B11-L3-B5-L3-B13-L3
5 PV2A 428 L1-A-L1-B2-L3-B5-L3-B6-L3-B8-L3-B9-L3-B10-L3-B9-L3-B1-L3-B4-L3-B3-L3-B7-L3-B11-L3-B5-L3-B13-L3
6 PV2B 434 L1-B-L1-B2-L3-B5-L3-B6-L3-B8-L3-B9-L3-B10-L3-B9-L3-B1-L3-B4-L3-B3-L3-B7-L3-B11-L3-B5-L3-B13-L3
7 PV3 529 L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L3-B2-L3-B5-L3-B6-L3-B8-L3-B9-L3-B10-L3-B9-L3-B1-L3-B4-L3-B3-L3-B7-L3-B11-L3-B5-L3-B13-L3
8 PV3A 658 L1-A-L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L3-B2-L3-B5-L3-B6-L3-B8-L3-B9-L3-B10-L3-B9-L3-B1-L3-B4-L3-B3-L3-B7-L3-B11-L3-B5-L3-B13-L3
9 PV3B 664 L1-B-L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L3-B2-L3-B5-L3-B6-L3-B8-L3-B9-L3-B10-L3-B9-L3-B1-L3-B4-L3-B3-L3-B7-L3-B11-L3-B5-L3-B13-L3 (EAAAKMAKLSTDELLDAFKEMTLLELSDFVKKFEETFEVTAAAPVAVAAAGAAPAGAAVEAAEEQSEFDVILEAAGDKKIGVIKVVREIVSGLGLKEAKDLVDGAPKPLLEKVAKEAADEAKAKLEAAGATVTVKEAAAKYPNGIVYPLGGGSYFNDDIKQFGGGSLMNPHTKEKGGGSNVLQNFSVFGGGSKEAEIAETEGGGSGESEDNDEYGGGSEIAETENTLGGGSYTLTAGVCVGGGSGVCVPNVCRGGGSTEYTLTAGVGGGSYACKCNLGYGGGSVLHCEVQCLGGGSYRLKENKDYGPGPGPLAGVYRSLKKQIEKGPGPGLKNNDTYFNDDIKQFGPGPGDPANSLTHTCSCNIGGPGPGPKVPYPNGIVYPLPLTGPGPGILKNNDTYFNDDIKQFGPGPGYGDLMNPHTKEKINEKGPGPGNSLNNPHNVLQNFSVFGPGPGKKKEAEIAETENTLENGPGPGFGESEDNDEYLDQVVTGPGPGKKKEAEIAETENTLENGPGPGTEYTLTAGVCVPNVCRGPGPGDGNPVSYACKCNLGYDGPGPGYVLHCEVQCLNGNNEIGPGPGYYRLKENKDYDVVSSIGPGPGPLAGVYRSLKKQIEKNGPGPGILKNNDTYFNDDIKQFGPGPGVDPANSLTHTCSCNIGGPGPG)
10 PV4 285 L1-B2-L2-B5-L2-B6-L2-B8-L2-B9-L2-B10-L2-B9-L2-B1-L2-B4-L2-B3-L2-B7-L2-B11-L2-B5-L2-B13-L2
11 PV4A 414 L1-A-L1-B2-L2-B5-L2-B6-L2-B8-L2-B9-L2-B10-L2-B9-L2-B1-L2-B4-L2-B3-L2-B7-L2-B11-L2-B5-L2-B13-L2
12 PV4B 420 L1-B-L1-B2-L2-B5-L2-B6-L2-B8-L2-B9-L2-B10-L2-B9-L2-B1-L2-B4-L2-B3-L2-B7-L2-B11-L2-B5-L2-B13-L2
13 PV5 514 L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L2-B2-L2-B5-L2-B6-L2-B8-L2-B9-L2-B10-L2-B9-L2-B1-L2-B4-L2-B3-L2-B7-L2-B11-L2-B5-L2-B13-L2
14 PV5A 643 L1-A-L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L2-B2-L2-B5-L2-B6-L2-B8-L2-B9-L2-B10-L2-B9-L2-B1-L2-B4-L2-B3-L2-B7-L2-B11-L2-B5-L2-B13-L2
15 PV5B 649 L1-B-L1-T2-L2-T5-L2-T6-L2-T9-L2-T11-L2-T12-L2-T13-L2-T1-L2-T4-L2-T8-L2-T10-L2-T4-L2-T3-L2-T7-L3-T14-L3-T15-L3-T16-L2-B2-L2-B5-L2-B6-L2-B8-L2-B9-L2-B10-L2-B9-L2-B1-L2-B4-L2-B3-L2-B7-L2-B11-L2-B5-L2-B13-L2
16 C3 212 MGHHHHHHDEEPSDKHIKEYLNKIQNSLSTEWSPCSVTCGNGIQVRIKPGSANKPKDELDYANDIEKKICKMEKCASVFEDLIDYNKAALSKFKEDGSWQTWNAKWDQWSNDWNAWESDWQAWKDDWAEWRALWMGGRLLLRLERIRHENRMVLEALEALARFVANLSMRLALMVLSFLRNESRGGSGNANPNANPNANPNANPNANPNANP
17 C4 468 IRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKAAALFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNAAAMKKLVPLLLALLLLVAACGTGGKQSSDKSNGKLKVVTTNSILYDMAKNVGGDNVDIHSIVAAADVKPIYLNGEEGNKDKQDPHAWLSLDNGIKYVKTIQQTFIAAAITPGYIWEINTEKQGTPEQMRQAIEFVKKHKLKHLLVETSAAAHTVQAGESLNIIASRYGVSVDQLMAANNLRGYLIMPNQTLAAATPTATTGSNGNASSFNHQNLYTAGQCTWYVFDRRAQAGSPISTYWSDAKYWAGNAANDGYQVNNTPSVGSIMQSTPGPYGHVAYVERVNGDGSILISEMNYTYGPYNMNYRTIPASEVSS
18 C5 248 EAAAKPDNRDKKEGGGGSEKCRGKNKDGGGSPPKRNKRQPGGGSTKAPEKKKEGGGSEEVNGEKDNGGGSEWNKENKNNGGGSTASSEKGKDGGGSGFCRERKKRGGGSPKPPKRNKRGGGSPKRNKRQPKGGGSKCRGKNKDKGGGSPEKQLAGGKGGGSAKKQALGRSGGGSKDCASCKKKGPGPGPAELPKPPKRNKRQPGPGPGAPPKQEEKGGCEPASGPGPGKAPPKQEEKGGCEPAGPGPG

Linkers (L1, L2 and L3), adjuvant (A and B), T-cell epitopes (T1-T16), and B-cell epitopes (B1-B13).

Fig. 3.

Fig. 3

Schematic diagram of polypeptide vaccines PV1A (a) and PV3B (b) in which adjuvant, T-cell epitopes (HLA class I and II), B-cell epitopes and linkers are shown in different colours.

3.4. Molecular docking of PVs with receptors TLR2 and TLR4

The TLRs, especially the surface one, viz. TLR2 as well as TLR4 are available not only on the immune cells, but also on epithelial cells and fibroblasts that recognizes PAMPs and bridge the innate as well as adaptive immunity of the host by regulating the balance between Th1 and Th2 type of responses [[87], [88], [89], [90]]. For example, the merozoites stage of P. falciparum releases glycosylphosphatidylinositol (GPI) anchored surface antigens, which act as ligands recognized by both TLR1-TLR2 heterodimers and TLR4 homodimers of host immune cells. Such events indeed results in decreasing the parasitic load from host by triggering the production of various pro-and anti-inflammatory cytokines as well as antibody isotype switching [[38], [39], [40],91,92,]. Thus, for enhanced protection, selection of respective TLR2 and 4 mucosal protein adjuvant A (CTB) and B (50s ribosomal L7/L12) in designed PVs could be the good choice against P. falciparum [77,78,86,93]. Even combining two distinct TLR agonists into an adjuvanted subunit vaccine have showed synergetic protective efficacy [94,95]. Altogether, these facts led to the hypothesis of using both TLR2 and 4 receptors agonists A and B, respectively in the designed PVs and subsequently docking experiment was performed to reveal the possible association amongst PVs and TLR [96,97]. For molecular docking, the tertiary structures of 15 PVs were predicted that revealed >80% of amino acids in favoured regions. Overall 22 docking studies were carried out using ClusPro2.0 tool including control C1 and C2 against receptors TLR2 and TLR4, respectively (Table 4 ). This resulted into total 18 docked models, i.e., M1 to M18 including 16 PVs and 2 controls. It is quite interesting to note that the PVs designed without adjuvants were also able to interact (dock) with TLR2 and TLR4 (having good energy scores) over control except PV3. Therefore, they might be capable to elicit innate immunity [[98], [99], [100]], which are in well agreement with earlier studies regarding the rapid production of IFN-γ [101,102]. Amongst 15 designed PVs, PV3, PV5A and PV4B were not able to dock by ClusPro tool with their respective receptors. So, a total 12 potential PVs with 16 docked models were obtained for TLR2-TLR1 (M2-M9) and TLR4-MD2 (M11-M18). The docking energy of control models M1 (−685.9 Kcal/mol) and M10 (−794.9 Kcal/mol) for complexes TLR2-TLR1-C1 and TLR4-MD2-C2 were found higher over designed potential PVs, which indicates that all the docked PVs have formed stronger immunological complexes over control ligands. Amongst the designed PVs without adjuvants (PV1, PV2, PV4 and PV5), PV4 showed the lowest docking energies −1180.9 Kcal/mol and −1166.7 Kcal/mol with respect to TLR2 and TLR4 receptors, correspondingly. These clearly indicated that the PVs without adjuvants have interacting domain to induce innate immune system. This is in agreement with the recent study where human TLR4-derived self-assembling peptide nanoparticles have been used as non toxic vaccine adjuvant with filarial antigenic protein to induce the immunological responses in mice [103]. Besides these, the linker L2 has been utilized in the designing of PV1A, PV3B and PV4, which can provide better flexibility during interaction as compare to L1 and L3. Amongst the two adjuvants used in designing of PVs, average docking score of PVs (PV1, PV2 and PV3) involving cholera toxin B subunit was lower (−1190.3 Kcal/mol) compare to PVs (PV1, PV2 and PV3) involving 50S ribosomal L7/L12 (−1173.3 Kcal/mol) (Table 4). However, based on overall docking score, PV1A (−1275.5) and PV3B (−1269.2) against receptors TLR2 and TLR4, respectively were selected as leading PVs for further structural and functional analysis (Fig. 4 ).

Table 4.

Details of molecular docking energies of polypeptide vaccines with their respective model number.

S. no. Name of polypeptide vaccine/control ClusPro 2.0 docking energy (Kcal/mol) Model number
TLR2 receptor
1 C1 −685.9 M1
2 PV1 −1153.1 M2
3 PV1A −1275.5 M3
4 PV2 −1117.1 M4
5 PV2A −1214.2 M5
6 PV3 N.A N.A
7 PV3A −1081.3 M6
8 PV4 −1180.9 M7
9 PV4A −1115.7 M8
10 PV5 −1047.4 M9
11 PV5A N.A N.A



TLR4 receptor
12 C2 −794.9 M10
13 PV1 −1070.7 M11
14 PV1B −1111.1 M12
15 PV2 −1117.9 M13
16 PV2B −1139.7 M14
17 PV3 N.A N.A
18 PV3B −1269.2 M15
19 PV4 −1166.7 M16
20 PV4B N.A N.A
21 PV5 −1076.5 M17
22 PV5B −835.8 M18

N.A-not available.

Fig. 4.

Fig. 4

Docking model of controls (C1, C2) and polypeptide vaccines. The models M1 (TLR2-TLR1-C1) and M10 (TLR4-MD2-C2) are controls while M2 (TLR1-TLR2-PV1A) and M11 (TLR4-MD2-PV3B) are polypeptide vaccines. In case of models M1 and M2, the TLR1, TLR2 and ligands (C1 and PV1A) are shown in green, blue and red colour, respectively whereas in models M10 and M11, TLR4, MD and ligands (C2 and PV3B) are shown in blue, green and red colour, respectively.

3.5. Comparative evaluation of structural and functional properties of leading PVs with positive as well as negative vaccine controls

The negative GRAVY values of both PVs PV1A (−0.377) and PV3B (−0.479) were pointing towards their hydrophilic nature (that exposed on outer surface) and, therefore may elicit elevated humoral immune response [93]. Generally, in vitro protein stability is determined by instability index <40. Considering this, the present study depicted PV1A and PV3B as stable proteins with their corresponding instability index values of 36.35 and 26.22. However, in vivo half-life of PV1A and PV3B showed >10 h and, therefore reflecting the stabilities of these two PVs, which might enhance the durability as well as strength of immune response [104,105]. The leading PVs, i.e., PV1A and PV3B were predicted as probable antigens in this study using several antigenicity forecasting tools viz. VaxiJen, ANTIGENpro, protein antigenicity prediction and Secret-AAR including SPAN at default threshold values. Nevertheless, non-allergenicity of PV1A and PV3B were forecasted by AllergenFP tool at threshold value >0.8. Also, the secondary structure analysis (SSA) of a protein is beneficial for understanding its folding, stability as well as function [[106], [107], [108], [109], [110]]. In this context, the present study revealed alpha helices of 31.31 and 25.75%, β-strands of 9.89 and 16.71% and coils of 58.79 and 57.53% for PV1A and PV3B, respectively (Fig. 5). The predicted tertiary structures of PV1A and PV3B were refined by ModRefiner tool in which the Ramachandran plot exhibited respective favoured regions of 92.3 and 91.4% as well as allowed regions of 6 and 5.7%. These values indicated high quality and stability of refined protein structure model based on Ramachandran plot as described previously [111] (Fig. 6). Further, PV1A and PV3B were forecasted to possess respective 8 and 18 linear as well as 104 and 315 discontinuous B cell epitopes at default thresholds (Supplementary Table S4). These leading PVs were also predicted to be involved in multi-organism process as well as cell adhesion and immune system process, respectively, as predicted by DeepGOPlus tool, which is based on deep convolutional neural network model and Gene Ontology (GO) scheme. The overall structural and functional analysis of leading PVs showed comparatively similar properties over positive vaccine controls C3 and C4 (Table 5). Thus, the leading polypeptide vaccines PV1A and PV3B have the capability to induce both humoral as well as cellular immune responses. However, the orally administered polypeptide vaccines suffer from the poor stability, insolubility, weak bioavailability and low immunogenicity due to acidic environment of the upper GI-tract and inefficient delivery to the mucosa-associated lymphoid tissue. Therefore, genetically engineered L. lactis expression host can be used for production and delivery of vaccine antigens due to several advantageous properties viz. easy and safe production as well as storage, survival in gastric environment and self-adjuvanticity [112,113].

Fig. 5.

Fig. 5

Predicted secondary structural elements (H: helix, E:beta strand, C: coil) of PV1A (a) and PV3B (b) by PSIPRED. The bar chart represents the percentage of confidence.

Fig. 6.

Fig. 6

Evaluation of three dimensional models of PV1A (a) and PV3B (b) using Ramachandran plot. The glycine amino acids are represented by black triangles while other amino acids of polypeptide vaccines are displayed in black squares.

Table 5.

Comparative evaluation of structural and functional properties of positive vaccine controls (C3, C4) and leading polypeptide vaccines (PV1A and PV3B).

Properties Parameter/tools Value/Score/Probability
C3 C4 PV1A PV3B
Physicochemical Molecular weight 2.44 kDa 5.05 kDa 3.79 kDa 6.80 kDa
Isoelectric point (pI) 6.24 8.67 5.72 4.75
Instability index (II) 28 22.78 36.35 26.22
GRAVY −0.88 −0.32 −0.38 −0.48
Antigenicity VaxiJen 0.65 0.67 0.56 0.46
ANTIGENpro 0.67 0.94 0.94 0.90
Protein antigenicity prediction 0.99 1.02 1.01 1.01
Secret-AAR 42.6 27.59 33.18 31.67
Adhesion SPAAN 0.32 0.82 0.76 0.45
Recombinant protein solubility RPSP 0.1 100 0.0 99.9
Protein-Sol 0.53 0.28 0.48 0.75
CamSol 2.00 0.34 0.74 1.56
SOLPro In soluble (0.54) In soluble (0.78) Soluble (0.87) Soluble (0.98)
Secondary structure stability alpha helix 9.9% 20.29% 31.31% 25.75%
β-strands 25.94% 31.83% 9.89% 16.71%
coils 64.15% 47.86% 58.79% 57.53%
Protein function DeepGOPlus Killing of cells of other organism and regulation of cell processes Molecular and biological process Multi-organism process Immune system process and cell adhesion

3.6. Immune simulation of leading PVs

In the course of human malaria infection, pro-inflammatory (TNF-α, IFN-γ and IL-12) and anti-inflammatory (IL-4 and IL-10) cytokines were produced by Th1 and Th2 cells, respectively [114]. In addition, cytotoxic T lymphocyte, natural killer cells and macrophages were activated by elicitation of IL-4, which helps to control pathogen effect [115,116]. Even, the most successful vaccine candidate of malaria, RTS,S was reported to elicit IFN-γ, IL-2, IgG titers, and activation of CD4+ T cell responses [72,117]. In this background, the present study involved the immune simulations of PV1A and PV3B using C-ImmSim tool along with the positive vaccine controls (C3, C4) (Table 6). The C3 is a self-assembling polypeptide nanoparticle (SAPN) based P. falciparum malaria vaccine candidate that elicit IFN-γ, TNF-α, IL-4, IL-10 and IgG antibody titers in mice [48,118]. The C4 is a novel fusion protein of Staphylococcus aureus that indicated a high titer of specific antibodies (IgG1 and IgG2a) responses and decrease the viable cell counts through elicitation of mixture of Th1, Th2, and Th17 immune responses. The simulation results were displayed no alteration in antigen level as well as immunogenic responses except generation of IFN-γ against negative control (C5). While the positive vaccine controls as well as PV1A/PV3B showed drastic decrease in antigen counts that ultimately reached to zero after 5th day of injection (Supplementary Fig. 1). Besides these, they were also involved in the elicitation of B lymphocytes, cytotoxic T lymphocytes, helper T lymphocytes and macrophages responses that lead to generation of cytokines (IFN-γ, TGF-β, IL-2, IL-10 and IL-12) as well as antibody titration (IgG + IgM and IgG1 + IgG2).

Table 6.

Details of immune simulation results of positive controls (C3 and C4) and leading PVs (PV1A, PV3B).

Types of immune response C3 C4 PV1A PV3B
Antigen count (Ist dose) Decreases to zero count after 5th day of injection Decreases to zero count after 5th day of injection Decreases to zero count after 5th day of injection Decreases to zero count after 5th day of injection
Antigen count
(IInd and IIIrd dose)
Decreases to zero after 2nd day of injection Decreases to zero after 2nd day of injection Decreases to zero after 2nd day of injection Decreases to zero after 2nd day of injection
Antibody titers (IgG + IgM and IgG1 + IgG2) Elicited high level of antibody titers Elicited high level of antibody titers Elicited high level of antibody titers Elicited high level of antibody titers
Total B cell population per state at end of IIIrd dose (cells per mm3) ~ 3000 ~ 2700 ~ 2800 ~ 2700
Active B cell population at end of IIIrd dose (cells per mm3) ~ 2900 ~ 2700 ~ 2700 ~ 2500
Plasma B lymphocytes at end of IIIrd dose (IgG1) ~ 550 ~ 550 ~ 550 ~ 500
IFN-γ (ng/ml) ~ 7.2 × 105 ~ 7.4 × 105 ~ 6.9 × 105 ~ 6 × 105
TGF-β (ng/ml) ~ 9.2 × 105 ~ 6.5 × 105 ~ 8.9 × 105 ~ 1.1 × 106
IL-2 (ng/ml) ~ 2 × 106 ~ 2.1 × 106 ~ 1.8 × 106 ~ 1.5 × 106
IL-10 (ng/ml) ~ 9 × 104 ~ 9 × 104 ~ 9 × 104 ~ 9 × 104
IL-12 (ng/ml) ~ 9 × 104 ~ 11 × 104 ~ 9 × 104 ~ 8 × 104
Memory T-helper lymphocytes count (cells per mm3) ~ 7000 ~ 7100 ~ 6300 ~ 5200
Active T-cytotoxic lymphocytes population per state (cells per mm3) ~ 900 ~ 1100 ~ 1100 ~ 1100
Active macrophages (cells per mm3) ~ 90 ~ 90 ~ 80 ~ 80
Macrophages presenting (cells per mm3) ~ 110 ~ 145 ~ 100 ~ 90

The generation of high level of IgM under study pointing towards better primary immune response as well as decrease in antigen level with enhancement in B cell population with antibodies (IgM, IgG1 + IgG2 and IgG + IgM), which further reflecting good secondary and tertiary immune responses. These results agree well with the earlier finding of Shey et al. [66]. Utilizing similar in silico approach, the leading PVs designed and characterized in the present study was compared with the wet lab experimental data of Kaba et al. [48] and Ahmadi et al. [49] (Table 6). The predicted result of immune simulation indicated the elicitation of macrophages, B and T lymphocytes for the production of cytokines (IFN-γ, TGF-β, IL-2, IL-10 and IL-12) as well as antibodies (IgG + IgM and IgG1 + IgG2) against proposed top two PVs, which seems to be similar observations obtained by aforementioned research group in mice. Fig. 7 summarizes the comparative account on immune simulations of C3, C4 with one of leading PVs (PV1A) having higher potential to induce protective immune responses that might be owing to use of Cholera toxin B subunit adjuvant. Therefore, designing strategy used in PV1A/PV3B could be highly effective in stimulation immune responses. Moreover, validity of immunoinformatics tools for prediction of epitopes, protective immune response analysis, constructing chimeric multi-epitope vaccine, assessment of vaccine safety as well as efficacy and immunization modelling have been exercised in the last five years with >500 literatures in the PMC database that assisted in the preclinical and clinical studies of several vaccine project including Hepatitis B Virus, Dengue, Schistosoma haematobium, Treponema pallidum, S. aureus, Trypanosoma cruzi, Helicobacter pylori, Middle East Respiratory Syndrome Coronavirus, Zika virus [26,45,119,120]. Therefore, the use of bioinformatics tools for prediction of antigenicity, epitopes and molecular interaction are convenient and adequate approach in vaccine design and development [47,84,121].

Fig. 7.

Fig. 7

Fig. 7

Immune simulation results of positive vaccine controls C3 (A, D, G, J, M) and C4 (B, E, H, K, N) along with test polypeptide vaccine PV1A (C, F, I, L, O).

3.7. Molecular docking of leading PVs with antibodies IgG1 and IgG3

When an antigen interacts with antibody it induces the humoral immune response and helps in clearance of pathogen. The IgG antibodies (named in order of decreasing abundance IgG1, IgG2, IgG3, and IgG4) are one of the most abundant pathogens neutralizing molecules found in human serum. These antibodies share >90% amino acid sequence identity but each subclass has exclusive effector properties including half-life, epitope binding, immunological complex formation, complement activation, triggering of effector cells and placental transport. Moreover, the IgG profile of a given individual is determined by their inherited allotypes that can potentially influence the clinical manifestation of the immune response [122]. However, broadly neutralizing antibodies (bNAbs) have been found in a rare population of patients that control the infection [[123], [124], [125]]. These bNAbs tend to target different conserved antigenic regions exposed on the outer surfaces of a pathogen across the circulating strains. Here, in the present study, a protein-protein global docking method (ClusPro server) was used to reveal the shape complementarity between PVs (as ligands) and the interacting domains of antibodies IgG1 and IgG3 (as the receptors) to eliminate the need of a long term exposure of malaria patients to selected antigen mimetics PV1A and PV3B involving the epitopes (B1, B4 and B5) of P. falciparum strains. These antibodies could be considered as bNAbs if they found with a well detectable neutralization activity in wet lab experimental studies [[126], [127], [128], [129], [130]]. Furthermore, the respective source proteins P28, P25 and MSP1of epitopes B1, B4 and B5 have been characterized as leading vaccine candidates [130,131]. Also, the antibodies IgG1 and IgG3 have been found associated with human malaria protection [132,133]. Thus, a structure based vaccinology approach could be exploited to predict the probability of potent PVs that might be able to block infection even more effectively [134]. These data lead to provoke the molecular interaction studies of leading PVs (PV1A as well as PV3B) along with co-crystallized control epitopes towards antibodies IgG1 and IgG3 (Table 7 and Fig. 8 B1- B6). For IgG1 and IgG3 antibody the obtained lowest score for molecular docking of IgG1 and IgG3 control was −449.4 and − 630.9, correspondingly. The obtained ClusPro docking energies and PatchDock scores of PV1A and PV3B against both antibody receptors IgG1 and IgG3 were found lower as compared to their respective controls C6 and C7 (Table 7). Besides these, PV1A showed hydrogen bond interaction through amino acids Leu-9, Val-13, Phe-15 and Lys-326, Asp-329 of B5 epitope with antibody receptors IgG1 and IgG3, correspondingly. Moreover, PV3B exhibited similar interaction with IgG1 and IgG3 through Gly-255, Gly-280 and Gly-525 of B1, Leu-551 of B4, respectively [135].

Table 7.

Molecular docking details of ClusPro docking energy and PatchDock score of PV1A and PV3B as well as controls C6 and C7 towards antibodies IgG1 and IgG3.

Model number Receptor (antibody) Ligand (PV/control) ClusPro 2.0 docking energy (Kcal/mol) PatchDock Score
B1 IgG1 C6 −449.4 6482
B2 PV1A −918.8 18,294
B3 PV3B −929.0 18,512
B4 IgG3 C7 −630.9 7834
B5 PV1A −1058.5 22,930
B6 PV3B −1025.1 19,814

Fig. 8.

Fig. 8

Visualization of docking models of C6 (B1), PV1A (B2), PV3B (B3) against antibody IgG1 and C7 (B4), PV1A (B5), PV3B (B6) against antibody IgG3. The respective colours of heavy and light chains of IgG1 and IgG3 are shown in cyan and red as well as magenta and blue.

3.8. Molecular dynamics of the PV1A/PV3B -TLR2/TLR4 complexes

Molecular dynamics study is crucially for evaluating the stability of the protein-protein complex, which can be determined by comparing necessary protein dynamics to their normal modes [136]. The NMA allowed the demonstration of docked protein-protein complex mobility and stabilization. Fig. 9(a, b) showed the 3D interaction model of respective polypeptide vaccines PV1A and PV3B complexed with TLR2 and TLR4. The direction of each amino acid residue was given by arrows and the length of the arrow corresponded to the degree of mobility. It also provided the profiles of deformability (c, d), mobility (e, f), eigenvalue (g, h), variance map (i, j), covariance matrix (k, l) and elastic network (m, n). The value of NMA-B-factors (mobility) indicated the relative amplitude of the atomic displacements around the equilibrium confirmation. While the deformability calculated the gradient of the atomic displacements summed over all modes at every atomic position. High values are expected in flexible regions such as hinges or linkers between domains, whereas low values usually correspond to rigid parts. The obtained higher and lower values of maximum mobility and deformability for PV3B (2.038E+02, 1.088E−06) indicated towards more flexible regions compare to PV1A (3.443E+01, 4.740E−06). The eigenvalue associated to each normal mode represented the motion stiffness. Lower the eigenvalue, easier the deformation i.e., lower energy is required to deform the complex structure. The respective eigenvalues for PV1A and PV3B complexed with TLR2 and TLR4 were found 1.064E−06 and 7.498E−09 that indicated the greater stability of complex PV1A-TLR2. The individual and cumulative variances associated to each normal mode were inversely related to the eigenvalue. The covariance matrix indicated the coupling between pairs of residues, i.e. whether they experience correlated (red), uncorrelated (white) or anti-correlated (blue) motions whereas elastic network graph characterizes pairs of atoms connected by springs and each dot in the graph represented one spring between the corresponding pair of atoms [137].

Fig. 9.

Fig. 9

Fig. 9

Molecular dynamics simulation of respective polypeptide vaccines (PV1A and PV3B) complexed with TLR2 and TLR4 (a, b), deformability (c, d), eigenvalue (e, f), variance map (g, h), correlation matrix (i, j) and elastic network model (k, l). Coloured bars showed the individual (red) and cumulative (green) variances in the correlation matrix. In the elastic network graph, dots are coloured according to their stiffness, the darker greys indicate stiffer springs and vice versa (m, n).

3.9. Codon optimization, in silico cloning and expression of PV1A and PV3B

The sequence length of obtained cDNA for PV1A and PV3B were 1092 bp and 1992 bp, correspondingly. The Codon Adaptation Index (CAI) values for PV1A and PV3B were 0.9857 and 0.9584, respectively. For reliable optimization of codon, CAI value should lie between 0.9 and 1.0 [138]. However, the GC content of improved DNA sequence of PV1A and PV3B were found 42.12% and 43.12%, which are lying in the optimal range (30% to 70%) that could be easily expressed in any suitable expression host [139]. Although, P. falciparum antigens could be expressed in E. coli but require the codon harmonization (reduction of amino acid misincorporation) to improve the immunogenicity [140]. In the present study, the solubilization probability of recombinant proteins (PV1A and PV3B) to be expressed in E. coli revealed by bioinformatics tools RPSP, Protein-Sol, CamSol and SOLPro was lower compare to positive vaccine controls (C3, C4) that indicated to look for alternative expression host (Table 5). Additionally, L. lactis was used as expression host alternative to E. coli due to following advantageous properties i) generally recognized as safe (GRAS) microorganism ii) lack of outer membrane (iii) insignificant extracellular proteolysis activity (iv) free of endotoxins (v) no lipo-polysaccharide contamination (vii) accommodates cysteine-rich proteins (vii) accessibility of both inducible and constitutive genetic control systems (viii) able to express prone-to-aggregate and/or difficult-to-purify proteins (ix) presentation to the host immune system in the context of micro-particles to avoids the immunotolerance, which is normally provoked by oral delivery of soluble antigens (x) exhibits similar codon bias to P. falciparum, which makes it efficient protein expression and secretion system to outer surface that could easily interact with host immune system [113,[141], [142], [143]]. In recent years, several wet lab studies have confirmed the utilization of L. lactis as an expression host to produce properly folded, pure and stable chimeric and/or single antigenic proteins of many pathogens that elicited high levels of functional antibodies/cytokines including P. falciparum [[144], [145], [146], [147], [148]], Mycobacterium bovis [149], Mycobacterium tuberculosis [150], Helicobacter pylori [151], Polish avian H5H1 influenza [152], cancer [153] and Staphylococcus aureus [154]. Moreover, L. lactis-mediated delivery of DNA vaccines also lead to the expression of post-translationally modified antigens by host cells resulting in presentation of conformationally restricted epitopes to the immune system for induction of both cellular and humoral immune responses [112].

Also, with the aforementioned properties, the last two decades witnesses the use of genetically engineered L. lactis system as effective oral based vaccine vehicles for delivering antigens of viruses, bacteria and parasites to elicit both systemic and mucosal immunity [[155], [156], [157], [158]]. Finally, the size of PV1A and PV3B recombinant DNA (obtained after insertion of cDNA into pIL1 expression vector) was observed as 7477 bp and 8377 bp, respectively which lies inside the ORF and could be translated into respective protein sequences with four additional amino acids (MCKC) at the N-terminus (Fig. 10 ). Therefore, an ideal multi-epitope polypeptide vaccine should compose of a series of epitopes and/ or adjuvants that can elicit simultaneous and strong innate and adaptive (humoral and cellular) immune responses involving T- and B-cells responses against a targeted pathogen of malaria. In contrast to traditional killed/live attenuated or single-epitope vaccines, multi-epitope vaccines have distinctive properties such as involvement of numerous HLA-restricted epitopes derived from different antigens of various Plasmodium species/strains that can be recognized by various T-cells, bringing of additional components with adjuvant capability to enhance the immunogenicity as well as long-lasting immunity and reduction of unnecessary parts that can trigger the pathogenicity/adverse effects. Well-designed multi-epitope vaccines with such advantages should become powerful prophylactic and therapeutic agents against malaria infections. However, the present problems in the field of multi-epitope vaccine design include the selection of appropriate candidate antigens and systematic arrangement of their immunodominant epitopes for effective oral delivery through virus-like particles and SAPN. The present study successfully utilized the immunoinformatics tools for prediction of suitable epitope ensemble of target proteins for designing a multi-epitope malaria oral vaccine.

Fig. 10.

Fig. 10

The cloning map of leading polypeptide vaccine PV1A (a) and PV3B (b) into pIL1 expression vector. The plasmid DNA, inserted cDNA and ORF are shown in black, red and orange colour, respectively.

4. Conclusion

Surprisingly, so far no licensed malaria vaccine is available in the market to protect world-wide human populations regardless of decades of research. One of the major bottlenecks of malaria vaccine development is immune escape mechanism of pathogen through antigenic variation and/or HLA diversity. The designed PVs (PV1A and PV3B) under present study may overcome the aforementioned issues as they possess both B- and T-cell epitopes derived from 5 antigenic proteins that involve multi -stages of pathogen life-cycle with world-wide human population coverage (99.46%). Moreover, these PVs have the higher potential to elicit both innate (TLR2 and TLR4) and adaptive (cellular and humoral) immune responses. However, this warrants further experimental validation so as to evaluate their efficacy in the preclinical studies.

The following are the supplementary data related to this article.

Supplementary Fig. 1

Immune simulation results of negative polypeptide vaccine control C5 (A, C, E, G, I) and test polypeptide vaccine PV3B (B, D, F, H, J).

mmc1.docx (414KB, docx)
Supplementary Table S1

Details of predicted linear B-cell epitopes.

mmc2.xlsx (15.8KB, xlsx)
Supplementary Table S2

Details of predicted HLA class I and II epitopes.

mmc3.xlsx (28.6KB, xlsx)
Supplementary Table S3

Details of cytokines inducing T-cell epitope ensemble (HLA class I and II).

Details of epitope ensemble with their respective source B-cell epitope and antigenic protein

mmc4.xlsx (15.6KB, xlsx)
Supplementary Table S4

Predicted B-cell epitopes (linear and discontinuous) of leading PVs (PV1A and PV3B).

mmc5.xlsx (19.5KB, xlsx)

Author statement

Manisha Pritam: Performed the experiments and analyzed the results.

Garima Singh: Involved in analyzing the results.

Suchit Swaroop: Involved in study design.

Akhilesh Kumar Singh: Involved in designing of study and revision of the manuscript.

Brijesh Pandey: Contributed substantially in review and editing of revised manuscript.

Satarudra Prakash Singh: Involved in designing of study, analyzing results and finalized the manuscript.

Funding

This study was self-financed and did not receive any grant from funding agency.

Declaration of competing interest

The authors declare that they have no conflicts of interest.

Acknowledgments

Authors would like to acknowledge Amity Institute of Biotechnology, Amity University Uttar Pradesh, Lucknow for providing laboratory workspace.

Contributor Information

Akhilesh Kumar Singh, Email: akhileshsingh@mgcub.ac.in.

Brijesh Pandey, Email: brijeshpandey@mgcub.ac.in.

Satarudra Prakash Singh, Email: sprakashsingh@mgcub.ac.in.

References

  • 1.World Malaria Report 2019. Geneva: World Health Organization. www.who.int/malaria/publications/world-malaria-report-2019, 2019 (Accessed 16 December 2019).
  • 2.World Malaria Report 2018. Geneva: World Health Organization. www.who.int/malaria/publications/world-malaria-report-2018/en/, 2018 (Accessed 4 February 2019).
  • 3.Beeson J.G., Kurtovic L., Dobano C., Opi D.H., Chan J.A., Feng G., Good M.F., Reiling L., Boyle M.J. Challenges and strategies for developing efficacious and long-lasting malaria vaccines. Sci. Transl. Med. 2019;11 doi: 10.1126/scitranslmed.aau1458. [DOI] [PubMed] [Google Scholar]
  • 4.Moorthy V.S., Good M.F., Hill A.V. Malaria vaccine developments. Lancet. 2004;363:150–156. doi: 10.1016/S0140-6736(03)15267-1. [DOI] [PubMed] [Google Scholar]
  • 5.Cui L., Mharakurwa S., Ndiaye D., Rathod P.K., Rosenthal P.J. Antimalarial drug resistance: literature review and activities and findings of the ICEMR network. Am J Trop Med Hyg. 2015;93:57–68. doi: 10.4269/ajtmh.15-0007. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Sanders P.R., Gilson P.R., Cantin G.T., Greenbaum D.C., Nebl T., Carucci D.J., McConville M.J., Schofield L., Hodder A.N., Yates J.R., 3rd, crabb B.S. Distinct protein classes including novel merozoite surface antigens in raft-like membranes of Plasmodium falciparum. J. Biol. Chem. 2005;280:40169–40176. doi: 10.1074/jbc.M509631200. [DOI] [PubMed] [Google Scholar]
  • 7.Malkin E., Long C.A., Stowers A.W., Zou L., Singh S., MacDonald N.J., Narum D.L., Miles A.P., Orcutt A.C., Muratova O., Moretz S.E., Zhou H., Diouf A., Fay M., Tierney E., Leese P., Mahanty S., Miller L.H., Saul A., Martin L.B. Phase 1 study of two merozoite surface protein 1 (MSP1(42)) vaccines for Plasmodium falciparum malaria. PLoS Clin Trials. 2007;2:1–14. doi: 10.1371/journal.pctr.0020012. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Genton B., Al-Yaman F., Betuela I., Anders R.F., Saul A., Baea K., Mellombo M., Taraika J., Brown G.V., Pye D., Irving D.O., Felger I., Beck H.P., Smith T.A., Alpers M.P. Safety and immunogenicity of a three-component blood-stage malaria vaccine (MSP1, MSP2, RESA) against Plasmodium falciparum in Papua New Guinean children. Vaccine. 2003;22:30–41. doi: 10.1016/s0264-410x(03)00536-x. [DOI] [PubMed] [Google Scholar]
  • 9.Ockenhouse C.F., Sun P.F., Lanar D.E., Wellde B.T., Hall B.T., Kester K., Stoute J.A., Magill A., Krzych U., Farley L., Wirtz R.A., Sadoff J.C., Kaslow D.C., Kumar S., Church L.W., Crutcher J.M., Wizel B., Hoffman S., Lalvani A., Hill A.V., Tine J.A., Guito K.P., de Taisne C., Anders R., Ballou W.R. Phase I/IIa safety, immunogenicity, and efficacy trial of NYVAC-Pf7, a pox-vectored, multiantigen, multistage vaccine candidate for Plasmodium falciparum malaria. J. Infect. Dis. 1998;177:1664–1673. doi: 10.1086/515331. [DOI] [PubMed] [Google Scholar]
  • 10.Douglas A.D., Williams A.R., Illingworth J.J., Kamuyu G., Biswas S., Goodman A.L., Wyllie D.H., Crosnier C., Miura K., Wright G.J., Long C.A., Osier F.H., Marsh K., Turner A.V., Hill A.V., Draper S.J. The blood-stage malaria antigen PfRH5 is susceptible to vaccine-inducible cross-strain neutralizing antibody. Nat. Commun. 2011;2:1–19. doi: 10.1038/ncomms1615. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Patel S.D., Ahouidi A.D., Bei A.K., Dieye T.N., Mboup S., Harrison S.C., Duraisingh M.T. Plasmodium falciparum merozoite surface antigen, PfRH5, elicits detectable levels of invasion-inhibiting antibodies in humans. J. Infect. Dis. 2013;208:1679–1687. doi: 10.1093/infdis/jit385. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Alanine D.G.W., Quinkert D., Kumarasingha R., Mehmood S., Donnellan F.R., Minkah N.K., Dadonaite B., Diouf A., Galaway F., Silk S.E., Jamwal A., Marshall J.M., Miura K., Foquet L., Elias S.C., Labbé G.M., Douglas A.D., Jin J., Payne R.O., Illingworth J.J., Pattinson D.J., Pulido D., Williams B.G., de Jongh W.A., Wright G.J., Kappe S.H.I., Robinson C.V., Long C.A., Crabb B.S., Gilson P.R., Higgins M.K., Draper S.J. Human antibodies that slow erythrocyte invasion potentiate malaria-neutralizing antibodies. Cell. 2019;178:216–228. doi: 10.1016/j.cell.2019.05.025. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Ferreira M.U., da Silva Nunes M., Wunderlich G. Antigenic diversity and immune evasion by malaria parasites. Clin. Diagn. Lab. Immunol. 2004;11:987–995. doi: 10.1128/CDLI.11.6.987–995.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Sagara I., Healy S.A., Assadou M.H., Gabriel E.E., Kone M., Sissoko K., Tembine I., Guindo M.A., Doucoure M., Niaré K., Dolo A., Rausch K.M., Narum D.L., Jones D.L., MacDonald N.J., Zhu D., Mohan R., Muratova O., Baber I., Coulibaly M.B., Fay M.P., Anderson C., Wu Y., Traore S.F., Doumbo O.K., Duffy P.E. Safety and immunogenicity of Pfs25H-EPA/Alhydrogel, a transmission-blocking vaccine against Plasmodium falciparum: a randomised, double-blind, comparator-controlled, dose-escalation study in healthy Malian adults. Lancet Infect. Dis. 2018;18:969–982. doi: 10.1016/S1473-3099(18)30344-X. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Kurtovic L., Agius P.A., Feng G., Drew D.R., Ubillos I., Sacarlal J., Aponte J.J., Fowkes F.J.I., Dobano C., Beeson J.G. Induction and decay of functional complement-fixing antibodies by the RTS,S malaria vaccine in children, and a negative impact of malaria exposure. BMC Med. 2019;17:1–14. doi: 10.1186/s12916-019-1277-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Gomes P.S., Bhardwaj J., Rivera-Correa J., Freire-De-Lima C.G., Morrot A. Immune escape strategies of malaria parasites. Front. Microbiol. 2016;7:1–7. doi: 10.3389/fmicb.2016.01617. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Dinko B., Pradel G. Immune evasion by Plasmodium falciparum parasites: converting a host protection mechanism for the parasite’s benefit. Adv. Infectious Diseases. 2016;6:82–95. doi: 10.4236/aid.2016.62011. [DOI] [Google Scholar]
  • 18.Belachew E.B. Immune response and evasion mechanisms of Plasmodium falciparum parasites. J Immunol Res. 2018;2018:1–6. doi: 10.1155/2018/6529681. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Pizza M., Scarlato V., Masignani V., Giuliani M.M., Arico B., Comanducci M., Jennings G.T., Baldi L., Bartolini E., Capecchi B., Galeotti C.L., Luzzi E., Manetti R., Marchetti E., Mora M., Nuti S., Ratti G., Santini L., Savino S., Scarselli M., Storni E., Zuo P., Broeker M., Hundt E., Knapp B., Blair E., Mason T., Tettelin H., Hood D.W., Jeffries A.C., Saunders N.J., Granoff D.M., Venter J.C., Moxon E.R., Grandi G., Rappuoli R. Identification of vaccine candidates against serogroup B meningococcus by whole-genome sequencing. Science. 2000;287:1816–1820. doi: 10.1126/science.287.5459.1816. [DOI] [PubMed] [Google Scholar]
  • 20.Ramaswamy V., Cresence V.M., Rejitha J.S., Lekshmi M.U., Dharsana K.S., Prasad S.P., Vijila H.M. Listeria-review of epidemiology and pathogenesis. J Microbiol Immunol Infect. 2007;40:4–13. [PubMed] [Google Scholar]
  • 21.Singh S.P., Khan F., Mishra B.N. Computational characterization of Plasmodium falciparum proteomic data for screening of potential vaccine candidates. Hum. Immunol. 2010;71:136–143. doi: 10.1016/j.humimm.2009.11.009. [DOI] [PubMed] [Google Scholar]
  • 22.Vakili B., Eslami M., Hatam G.R., Zare B., Erfani N., Nezafat N., Ghasemi Y. Immunoinformatics-aided design of a potential multi-epitope peptide vaccine against Leishmania infantum. Int. J. Biol. Macromol. 2018;120:1127–1139. doi: 10.1016/j.ijbiomac.2018.08.125. [DOI] [PubMed] [Google Scholar]
  • 23.Masignani V., Pizza M., Moxon E.R. The development of a vaccine against meningococcus B using reverse vaccinology. Front. Immunol. 2019;10:1–14. doi: 10.3389/fimmu.2019.00751. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Pritam M., Singh G., Swaroop S., Singh A.K., Singh S.P. Exploitation of reverse vaccinology and immunoinformatics as promising platform for genome-wide screening of new effective vaccine candidates against Plasmodium falciparum. BMC Bioinformatics. 2019;19:219–230. doi: 10.1186/s12859-018-2482-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Rappuoli R. Reverse vaccinology. Curr. Opin. Microbiol. 2000;3:445–450. doi: 10.1016/s1369-5274(00)00119-3. [DOI] [PubMed] [Google Scholar]
  • 26.Pandey R.K., Ojha R., Mishra A., Prajapati V.K. Designing B- and T-cell multi-epitope based subunit vaccine using immunoinformatics approach to control Zika virus infection. J. Cell. Biochem. 2018;119:7631–7642. doi: 10.1002/jcb.27110. [DOI] [PubMed] [Google Scholar]
  • 27.Khatoon N., Pandey R.K., Prajapati V.K. Exploring Leishmania secretory proteins to design B and T cell multi-epitope subunit vaccine using immunoinformatics approach. Sci. Rep. 2017;7:1–12. doi: 10.1038/s41598-017-08842-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Chauhan V., Rungta T., Goyal K., Singh M.P. Designing a multi-epitope based vaccine to combat Kaposi sarcoma utilizing immunoinformatics approach. Sci. Rep. 2019;9:1–15. doi: 10.1038/s41598-019-39299-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Naz K., Naz A., Ashraf S.T., Rizwan M., Ahmad J., Baumbach J., Ali A. PanRV: Pangenome-reverse vaccinology approach for identifications of potential vaccine candidates in microbial pangenome. BMC Bioinformatics. 2019;20:1–10. doi: 10.1186/s12859-019-2713-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Ali M., Pandey R.K., Khatoon N., Narula A., Mishra A., Prajapati V.K. Exploring dengue genome to construct a multi-epitope based subunit vaccine by utilizing immunoinformatics approach to battle against dengue infection. Sci. Rep. 2017;7:1–13. doi: 10.1038/s41598-017-09199-w. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.A. Rahmani, M. Baee, M. Rostamtabar, A. Karkhah, S. Alizadeh, M. Tourani, H.R. Nouri, Development of a conserved chimeric vaccine based on helper T-cell and CTL epitopes for induction of strong immune response against Schistosoma mansoni using immunoinformatics approaches, Int. J. Biol. Macromol., 141(2019) 125–136. doi.org/ 10.1016/j.ijbiomac.2019.08.259. [DOI] [PubMed]
  • 32.Kalita P., Lyngdoh D.L., Padhi A.K., Shukla H., Tripathi T. Development of multi-epitope driven subunit vaccine against Fasciola gigantica using immunoinformatics approach. Int. J. Biol. Macromol. 2019;138:224–233. doi: 10.1016/j.ijbiomac.2019.07.024. [DOI] [PubMed] [Google Scholar]
  • 33.Ojha R., Pareek A., Pandey R.K., Prusty D., Prajapati V.K. Strategic development of a next-generation multi-epitope vaccine to prevent Nipah virus zoonotic infection. ACS Omega. 2019;4:13069–13079. doi: 10.1021/acsomega.9b00944. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Sayed S.B., Nain Z., Abdullah F., Khan M.S.A., Haque Z., Rahman S.R., Tasmin R., Adhikari U.K. Immunoinformatics-guided designing of peptide vaccine against Lassa virus with dynamic and immune simulation studies. Preprints. 2019 doi: 10.20944/preprints201909.0076.v1. [DOI] [Google Scholar]
  • 35.Nain Z., Abdulla F., Rahman M.M., Karim M.M., Khan M., Sayed S.B., Mahmud S., Rahman S., Sheam M.M., Haque Z., Adhikari U.K. Proteome-wide screening for designing a multi-epitope vaccine against emerging pathogen Elizabethkingia anophelis using immunoinformatic approaches. J. Biomol. Struct. Dyn. 2019:1–18. doi: 10.1080/07391102.2019.1692072. Advance online publication. [DOI] [PubMed] [Google Scholar]
  • 36.Hasan M., Ghosh P.P., Azim K.F., Mukta S., Abir R.A., Nahar J., Hasan Khan M.M. Reverse vaccinology approach to design a novel multi-epitope subunit vaccine against avian influenza A (H7N9) virus. Microb. Pathog. 2019;130:19–37. doi: 10.1016/j.micpath.2019.02.023. [DOI] [PubMed] [Google Scholar]
  • 37.Gazzinelli R.T., Denkers E.Y. Protozoan encounters with toll-like receptor signalling pathways: implications for host parasitism. Nat. Rev.Immunol. 2006;6:895–906. doi: 10.1038/nri1978. [DOI] [PubMed] [Google Scholar]
  • 38.Kawai T., Akira S. Toll-like receptors and their crosstalk with other innate receptors in infection and immunity. Immunity. 2011;34:637–650. doi: 10.1016/j.immuni.2011.05.006. [DOI] [PubMed] [Google Scholar]
  • 39.Zhu J., Krishnegowda G., Li G., Gowda D.C. Proinflammatory responses by glycosylphosphatidylinositols (GPIs) of Plasmodium falciparum are mainly mediated through the recognition of TLR2/TLR1. Exp. Parasitol. 2011;128:205–211. doi: 10.1016/j.exppara.2011.03.010. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Durai P., Govindaraj R.G., Choi S. Structure and dynamic behavior of toll-like receptor 2 subfamily triggered by malarial glycosylphosphatidylinositols of Plasmodium falciparum. FEBS J. 2013;280:6196–6212. doi: 10.1111/febs.12541. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Livingston B., Crimi C., Newman M., Higashimoto Y., Appella E., Sidney J., Sette A. A rational strategy to design multiepitope immunogens based on multiple Th lymphocyte epitopes. J Immsunol. 2002;168:5499–5506. doi: 10.4049/jimmunol.168.11.5499. [DOI] [PubMed] [Google Scholar]
  • 42.Yang Y., Sun W., Guo J., Zhao G., Sun S., Yu H., Guo Y., Li J., Jin X., Du L., Jiang S., Kou Z., Zhou Y. In silico design of a DNA-based HIV-1 multi-epitope vaccine for Chinese populations. Hum Vaccin Immunother. 2015;11:795–805. doi: 10.1080/21645515.2015.1012017. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Yin D., Li L., Song X., Li H., Wang J., Ju W., Qu X., Song D., Liu Y., Meng X., Cao H., Song W., Meng R., Liu J., Li J., Xu K. A novel multi-epitope recombined protein for diagnosis of human brucellosis. BMC Infect. Dis. 2016;16:1–8. doi: 10.1186/s12879-016-1552-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Hajighahramani N., Nezafat N., Eslami M., Negahdaripour M., Rahmatabadi S.S., Ghasemi Y. Immunoinformatics analysis and in silico designing of a novel multiepitope peptide vaccine against Staphylococcus aureus. Infect. Genet. Evol. 2017;48:83–94. doi: 10.1016/j.meegid.2016.12.010. [DOI] [PubMed] [Google Scholar]
  • 45.Meza B., Ascencio F., Sierra-Beltrán A.P., Torres J., Angulo C. A novel design of a multi-antigenic, multistage and multi-epitope vaccine against helicobacter pylori: an in silico approach. Infect. Genet. Evol. 2017;49:309–317. doi: 10.1016/j.meegid.2017.02.007. [DOI] [PubMed] [Google Scholar]
  • 46.Liang S., Hosur K.B., Lu S., Nawar H.F., Weber B.R., Tapping R.I., Connell T.D., Hajishengallis G. Mapping of a microbial protein domain involved in binding and activation of the TLR2/TLR1 heterodimer. J. Immunol. 2009;182:2978–2985. doi: 10.4049/jimmunol.0803737. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Awasthi S., Brown K., King C., Awasthi V., Bondugula R. A toll-like receptor-4-interacting surfactant protein-A-derived peptide suppresses tumor necrosis factor-α release from mouse JAWS II dendritic cells. J. Pharmacol. Exp. Ther. 2011;336:672–681. doi: 10.1124/jpet.110.173765. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Kaba S.A., Karch C.P., Seth L., Ferlez K.M.B., Storme C.K., Pesavento D.M., Laughlin P.Y., Bergmann-Leitner E.S., Burkhard P., Lanar D.E. Self-assembling protein nanoparticles with built-in flagellin domains increases protective efficacy of a Plasmodium falciparum based vaccine. Vaccine. 2018;36:906–914. doi: 10.1016/j.vaccine.2017.12.001. [DOI] [PubMed] [Google Scholar]
  • 49.K. Ahmadi, G. Pouladfar, M. Kalani, S. Faezi, M.R. Pourmand, S. Hasanzadeh, L. Mafakher, M.M. Aslani, M. Mahdavi, Epitope-based immunoinformatics study of a novel Hla-MntC-SACOL0723 fusion protein from Staphylococcus aureus: induction of multi-pattern immune responses, Mol. Immunol.. 114(2019) 88–99. doi.org/ 10.1016/j.molimm.2019.05.016. [DOI] [PubMed]
  • 50.Rapin N., Lund O., Bernaschi M., Castiglione F. Computational immunology meets bioinformatics: the use of prediction tools for molecular binding in the simulation of the immune system. PLoS One. 2010;5:1–14. doi: 10.1371/journal.pone.0009862. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Singh G., Pritam M., Banerjee M., Singh A.K., Singh S.P. Genome based screening of epitope ensemble vaccine candidates against dreadful visceral leishmaniasis using immunoinformatics approach. Microb. Pathog. 2019;136 doi: 10.1016/j.micpath.2019.103704. [DOI] [PubMed] [Google Scholar]
  • 52.Hill A.V., Allsopp C.E., Kwiatkowski D., Anstey N.M., Twumasi P., Rowe P.A., Bennett S., Brewster D., McMichael A.J., Greenwood B.M. Common west African HLA antigens are associated with protection from severe malaria. Nature. 1991;352:595–600. doi: 10.1038/352595a0. [DOI] [PubMed] [Google Scholar]
  • 53.Osafo-Addo A.D., Koram K.A., Oduro A.R., Wilson M., Hodgson A., Rogers W.O. HLA-DRB1*04 allele is associated with severe malaria in northern Ghana. Am J Trop Med Hyg. 2008;78:251–255. [PubMed] [Google Scholar]
  • 54.Lima-Junior J.C., Rodrigues-da-Silva R.N., Banic D.M., Jiang J., Singh B., Fabrício-Silva G.M., Porto L.C., Meyer E.V., Moreno A., Rodrigues M.M., Barnwell J.W., Galinski M.R., de Oliveira-Ferreira J. Influence of HLA-DRB1 and HLA-DQB1 alleles on IgG antibody response to the P. vivax MSP-1, MSP-3α and MSP-9 in individuals from Brazilian endemic area. PLoS One. 2012;7:1–10. doi: 10.1371/journal.pone.0036419. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Ademola S.A., Amodu O.K., Yindom L. HLA-A alleles differentially associate with severity to Plasmodium falciparum malaria infection in Ibadan, Nigeria. Afr. J. Biomed. Res. 2017;20:223–228. [Google Scholar]
  • 56.G. Triller, S.W. Scally, G. Costa, M. Pissarev, C. Kreschel, A. Bosch, E. Marois, B.K. Sack, R. Murugan, A.M. Salman, C.J. Janse, S.M. Khan, S. Kappe, A.A. Adegnika, B. Mordmüller, E.A. Levashina, J.P. Julien, H. Wardemann, Natural parasite exposure induces protective human anti-malarial antibodies, Immunity. 47(2017), 1197–1209.e10. doi.org/ 10.1016/j.immuni.2017.11.007. [DOI] [PMC free article] [PubMed]
  • 57.Kisalu N.K., Idris A.H., Weidle C., Flores-Garcia Y., Flynn B.J., Sack B.K., Murphy S., Schön A., Freire E., Francica J.R., Miller A.B., Gregory J., March S., Liao H.X., Haynes B.F., Wiehe K., Trama A.M., Saunders K.O., Gladden M.A., Monroe A., Bonsignori M., Kanekiyo M., Wheatley A.K., McDermott A.B., Farney S.K., Chuang G.Y., Zhang B., Kc N., Chakravarty S., Kwong P.D., Sinnis P., Bhatia S.N., Kappe S.H.I., Sim B.K.L., Hoffman S.L., Zavala F., Pancera M., Seder R.A. A human monoclonal antibody prevents malaria infection by targeting a new site of vulnerability on the parasite. Nat. Med. 2018;24:408–416. doi: 10.1038/nm.4512. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Lopez-Blanco J.R., Aliaga J.I., Quintana-Ortí E.S., Chacon P. iMODS: internal coordinates normal mode analysis server. Nucleic Acids Res. 2014;42:W271–W276. doi: 10.1093/nar/gku339. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Hayes F., Daly C., Fitzgerald G.F. Identification of the minimal replicon of Lactococcus lactis subsp. lactis UC317 plasmid pCI305. Appl. Environ. Microbiol. 1990;56:202–209. doi: 10.1128/aem.56.1.202-209.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60.Brennan M.J. The US Food and Drug Administration provides a pathway for licensing vaccines for global diseases. PLoS Med. 2009;6 doi: 10.1371/journal.pmed.1000095. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Asante K.P., Adjei G., Enuameh Y., Owusu-Agyei S. RTS,S malaria vaccine development: progress and considerations for postapproval introduction. Vaccine: Development and Therapy. 2016;6:25–32. doi: 10.2147/VDT.S53028. [DOI] [Google Scholar]
  • 62.Guerra Mendoza Y., Garric E., Leach A., Lievens M., Ofori-Anyinam O., Pirçon J.Y., Stegmann J.U., Vandoolaeghe P., Otieno L., Otieno W., Owusu-Agyei S., Sacarlal J., Masoud N.S., Sorgho H., Tanner M., Tinto H., Valea I., Mtoro A.T., Njuguna P., Oneko M., Otieno G.A., Otieno K., Gesase S., Hamel M.J., Hoffman I., Kaali S., Kamthunzi P., Kremsner P., Lanaspa M., Lell B., Lusingu J., Malabeja A., Aide P., Akoo P., Ansong D., Asante K.P., Berkley J.A., Adjei S., Agbenyega T., Agnandji S.T., Schuerman L. Safety profile of the RTS,S/AS01 malaria vaccine in infants and children: additional data from a phase III randomized controlled trial in sub-Saharan Africa. Hum Vaccin Immunother. 2019;23:1–13. doi: 10.1080/21645515.2019.1586040. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Olotu A., Fegan G., Wambua J., Nyangweso G., Leach A., Lievens M., Kaslow D.C., Njuguna P., Marsh K., Bejon P. Seven-year efficacy of RTS,S/AS01 malaria vaccine among young African children. N. Engl. J. Med. 2016;374:2519–2529. doi: 10.1056/NEJMoa1515257. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Pearson W.R. An introduction to sequence similarity (“homology”) searching. Curr. Protoc. Bioinformatics. 2013;42:3.1.1–3.1.8. doi: 10.1002/0471250953.bi0301s42. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Narula A., Pandey R.K., Khatoon N., Mishra A., Prajapati V.K. Excavating chikungunya genome to design B and T cell multi-epitope subunit vaccine using comprehensive immunoinformatics approach to control chikungunya infection. Infect. Genet. Evol. 2018;61:4–15. doi: 10.1016/j.meegid.2018.03.007. [DOI] [PubMed] [Google Scholar]
  • 66.Shey R.A., Ghogomu S.M., Esoh K.K., Nebangwa N.D., Shintouo C.M., Nongley N.F., Asa B.F., Ngale F.N., Vanhamme L., Souopgui J. In-silico design of a multi-epitope vaccine candidate against onchocerciasis and related filarial diseases. Sci. Rep. 2019;9:4409. doi: 10.1038/s41598-019-40833-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67.Lanzavecchia A. Antigen-specific interaction between T and B cells. Nature. 1985;314:537–539. doi: 10.1038/314537a0. doi.org/10.1038/314537a0. [DOI] [PubMed] [Google Scholar]
  • 68.Janeway C.A., Jr., Travers P., Walport M., Shlomchik M.J. 5th edition. Garland Science; New York: 2001. Immunobiology: The Immune System in Health and Disease.www.ncbi.nlm.nih.gov/books/NBK10757 [Google Scholar]
  • 69.Kaliamurthi S., Selvaraj G., Chinnasamy S., Wang Q., Nangraj A.S., Cho W.C., Gu K., Wei D.Q. Exploring the Papillomaviral proteome to identify potential candidates for a chimeric vaccine against cervix papilloma using immunomics and computational structural vaccinology. Viruses. 2019;11:63. doi: 10.3390/v11010063. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Angulo I., Fresno M. Cytokines in the pathogenesis of and protection against malaria. Clin. Diagn. Lab. Immunol. 2002;9:1145–1152. doi: 10.1128/cdli.9.6.1145-1152.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Dunst J., Kamena F., Matuschewski K. Cytokines and chemokines in cerebral malaria pathogenesis. Front. Cell. Infect. Microbiol. 2017;7:1–16. doi: 10.3389/fcimb.2017.00324. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 72.Sun P., Schwenk R., White K., Stoute J.A., Cohen J., Ballou W.R., Voss G., Kester K.E., Heppner D.G., Krzych U. Protective immunity induced with malaria vaccine, RTS,S, is linked to Plasmodium falciparum circumsporozoite protein-specific CD4+ and CD8+ T cells producing IFN-gamma. J. Immunol. 2003;171:6961–6967. doi: 10.4049/jimmunol.171.12.6961. [DOI] [PubMed] [Google Scholar]
  • 73.Bostrom S., Giusti P., Arama C., Persson J.O., Dara V., Traore B., Dolo A., Doumbo O., Troye-Blomberg M. Changes in the levels of cytokines, chemokines and malaria-specific antibodies in response to Plasmodium falciparum infection in children living in sympatry in Mali. Malar. J. 2012;11:1–11. doi: 10.1186/1475-2875-11-109. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.Boyle M.J., Jagannathan P., Bowen K., McIntyre T.I., Vance H.M., Farrington L.A., Schwartz A., Nankya F., Naluwu K., Wamala S., Sikyomu E., Rek J., Greenhouse B., Arinaitwe E., Dorsey G., Kamya M.R., Feeney M.E. The development of Plasmodium falciparum-specific IL10 CD4 T cells and protection from malaria in children in an area of high malaria transmission. Front. Immunol. 2017;8:1–12. doi: 10.3389/fimmu.2017.01329. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75.Potocnakova L., Bhide M., Pulzova L.B. An introduction to B-cell epitope mapping and in silico epitope prediction. J Immunol Res. 2016;2016:1–11. doi: 10.1155/2016/6760830. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76.Li Y., Guan L., Liu X., Liu W., Yang J., Zhang X., Wang F., Guo Y., Li H., Li X. Oral immunization with rotavirus VP7-CTB fusion expressed in transgenic Arabidopsis thaliana induces antigen-specific IgA and IgG and passive protection in mice. Exp. Therapeutic Med. 2018;15:4866–4874. doi: 10.3892/etm.2018.6003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 77.X. Li, Y. Xing, L. Guo, X. Lv, H. Song, T. Xi, Oral immunization with recombinant Lactococcus lactis delivering a multi-epitope antigen CTB-UE attenuates helicobacter pylori infection in mice, Pathogens and disease. 72(2014) 78–86. doi.org/ 10.1111/2049-632X.12173. [DOI] [PubMed]
  • 78.H. Lei, X. Peng, H. Jiao, D. Zhao, J. Ouyang, Broadly protective immunity against divergent influenza viruses by oral co-administration of Lactococcus lactis expressing nucleoprotein adjuvanted with cholera toxin B subunit in mice, Microb. Cell Factories. 14(2015) 1–10. doi.org/ 10.1186/s12934-015-0287-4. [DOI] [PMC free article] [PubMed]
  • 79.J. Hou, Y. Liu, J. Hsi, H. Wang, R. Tao, Y. Shao, Cholera toxin B subunit acts as a potent systemic adjuvant for HIV-1 DNA vaccination intramuscularly in mice, Human Vaccines & Immunotherapeutics. 10(2014) 1274–1283. doi.org/ 10.4161/hv.28371. [DOI] [PMC free article] [PubMed]
  • 80.Arai R., Ueda H., Kitayama A., Kamiya N., Nagamune T. Design of the linkers which effectively separate domains of a bifunctional fusion protein. Protein Eng. 2001;14:529–532. doi: 10.1093/protein/14.8.529. [DOI] [PubMed] [Google Scholar]
  • 81.Vishnu U.S., Sankarasubramanian J., Gunasekaran P., Rajendhran J. Identification of potential antigens from non-classically secreted proteins and designing novel multitope peptide vaccine candidate against Brucella melitensis through reverse vaccinology and immunoinformatics approach. Infect. Genet. Evol. 2017;55:151–158. doi: 10.1016/j.meegid.2017.09.015. [DOI] [PubMed] [Google Scholar]
  • 82.Yano A., Onozuka A., Asahi-Ozaki Y., Imai S., Hanada N., Miwa Y., Nisizawa T. An ingenious design for peptide vaccines. Vaccine. 2005;23:2322–2326. doi: 10.1016/j.vaccine.2005.01.031.s. [DOI] [PubMed] [Google Scholar]
  • 83.Sanasam B.D., Kumar S. PRE-binding protein of Plasmodium falciparum is a potential candidate for vaccine design and development: an in silico evaluation of the hypothesis. Med. Hypotheses. 2019;125:119–123. doi: 10.1016/j.mehy.2019.01.006. [DOI] [PubMed] [Google Scholar]
  • 84.A.I. Khan, M.S. Islam, M.T. Islam, A. Ahmed, M.I. Chowdhury, F. Chowdhury, M. Siddik, J.D. Clemens, F. Qadri, Oral cholera vaccination strategy: self-administration of the second dose in urban Dhaka, Bangladesh, Vaccine. 37(2019) 827–832. doi.org/ 10.1016/j.vaccine.2018.12.048. [DOI] [PubMed]
  • 85.Singh G., Pritam M., Banerjee M., Singh A.K., Singh S.P. Designing of precise vaccine construct against visceral leishmaniasis through predicted epitope ensemble: a contemporary approach. Comput. Biol. Chem. 2020;86:107259. doi: 10.1016/j.compbiolchem.2020.107259. [DOI] [PubMed] [Google Scholar]
  • 86.Stratmann T. Cholera toxin subunit B as adjuvant––an accelerator in protective immunity and a break in autoimmunity. Vaccines. 2015;3:579–596. doi: 10.3390/vaccines3030579. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 87.Yao C., Oh J.H., Lee D.H., Bae J.S., Jin C.L., Park C.H., Chung J.H. Toll-like receptor family members in skin fibroblasts are functional and have a higher expression compared to skin keratinocytes. Int. J. Mol. Med. 2015;35:1443–1450. doi: 10.3892/ijmm.2015.2146. [DOI] [PubMed] [Google Scholar]
  • 88.Ozato K., Tsujimura H., Tamura T. Toll-like receptor signaling and regulation of cytokine gene expression in the immune system. BioTechniques. 2002;33:S66–S75. doi: 10.2144/oct0208. [DOI] [PubMed] [Google Scholar]
  • 89.B.S. Franklin, P. Parroche, M.A. Ataíde, F. Lauw, C. Ropert, R.B. de Oliveira, D. Pereira, M.S. Tada, P. Nogueira, L.H. da Silva, H. Bjorkbacka, D.T. Golenbock, R.T. Gazzinelli, Malaria primes the innate immune response due to interferon-gamma induced enhancement of toll-like receptor expression and function, Proc. Natl. Acad. Sci. U. S. A.. 106(2009) 5789–5794. doi.org/ 10.1073/pnas.0809742106. [DOI] [PMC free article] [PubMed]
  • 90.Mukherjee S., Karmakar S., Babu S.P. TLR2 and TLR4 mediated host immune responses in major infectious diseases: a review. Brazilian J. Infect. Dis. 2016;20:193–204. doi: 10.1016/j.bjid.2015.10.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 91.E.J. Pone, H. Zan, J. Zhang, A. Al-Qahtani, Z. Xu, P. Casali, Toll-like receptors and B-cell receptors synergize to induce immunoglobulin class-switch DNA recombination: relevance to microbial antibody responses, Crit. Rev. Immunol.. 30(2010) 1–29. doi.org/ 10.1615/critrevimmunol.v30.i1.10. [DOI] [PMC free article] [PubMed]
  • 92.Gun S.Y., Claser C., Tan K.S., Rénia L. Interferons and interferon regulatory factors in malaria. Mediat. Inflamm. 2014;2014:1–21. doi: 10.1155/2014/243713. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 93.Solanki V., Tiwari M., Tiwari V. Prioritization of potential vaccine targets using comparative proteomics and designing of the chimeric multi-epitope vaccine against Pseudomonas aeruginosa. Sci. Rep. 2019;9:1–19. doi: 10.1038/s41598-019-41496-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 94.M.T. Orr, E.A. Beebe, T.E. Hudson, J.J. Moon, C.B. Fox, S.G. Reed, R.N. Coler, 2014. A dual TLR agonist adjuvant enhances the immunogenicity and protective efficacy of the tuberculosis vaccine antigen ID93. PLoS One. 9, e83884. doi.org/ 10.1371/journal.pone.0083884. [DOI] [PMC free article] [PubMed]
  • 95.Vakili B., Nezafat N., Zare B., Erfani N., Akbari M., Ghasemi Y., Rahbar M.R., Hatam G.R. A new multi-epitope peptide vaccine induces immune responses and protection against Leishmania infantum in BALB/c mice. Med. Microbiol. Immunol. 2020;209:69–79. doi: 10.1007/s00430-019-00640-7. [DOI] [PubMed] [Google Scholar]
  • 96.E.G. Reed-Geaghan, J.C. Savage, A.G. Hise, G.E. Landreth, CD14 and toll-like receptors 2 and 4 are required for fibrillar A{beta}-stimulated microglial activation, J. Neurosci.. 29(2009) 11982–11992. doi.org/ 10.1523/JNEUROSCI.3158-09.2009. [DOI] [PMC free article] [PubMed]
  • 97.J.M. Billod, A. Lacetera, J. Guzmán-Caldentey, S. Martín-Santamaría, Computational approaches to toll-like receptor 4 modulation, Molecules (Basel, Switzerland). 21(2016) 1–24. doi.org/ 10.3390/molecules21080994. [DOI] [PMC free article] [PubMed]
  • 98.Medzhitov R. Toll-like receptors and innate immunity. Nat. Rev. Immunol. 2001;(2):135–145. doi: 10.1038/35100529. [DOI] [PubMed] [Google Scholar]
  • 99.Kalantari P. The emerging role of pattern recognition receptors in the pathogenesis of malaria. Vaccines (Basel) 2018;6:1–15. doi: 10.3390/vaccines6010013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 100.Ernest M., Hunja C., Arakura Y., Haraga Y., Abkallo H.M., Zeng W., Jackson D.C., Chua B., Culleton R. The toll-like receptor 2 agonist PEG-pam(2)Cys as an immunochemoprophylactic and immunochemotherapeutic against the liver and transmission stages of malaria parasites. Int. J. Parasitol. Drugs Drug Resist. 2018;8:451–458. doi: 10.1016/j.ijpddr.2018.10.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 101.Mohan T., Sharma C., Bhat A.A., Rao D. Modulation of HIV peptide antigen specific cellular immune response by synthetic α-and β-defensin peptides. Vaccine. 2013;31:1707–1716. doi: 10.1016/j.vaccine.2013.01.041. [DOI] [PubMed] [Google Scholar]
  • 102.Miller J.L., Sack B.K., Baldwin M., Vaughan A.M., Kappe S.H.I. Interferon-mediated innate immune responses against malaria parasite liver stages. Cell Rep. 2014;7:436–447. doi: 10.1016/j.celrep.2014.03.018. [DOI] [PubMed] [Google Scholar]
  • 103.A. Tandon, M. Pathak, M.K. Harioudh, S. Ahmad, M. Sayeed, T. Afshan, M.I. Siddiqi, K. Mitra, S.M. Bhattacharya, J.K. Ghosh, A TLR4-derived non-cytotoxic, self-assembling peptide functions as a vaccine adjuvant in mice, J. Biol. Chem.. 293(2018) 19874–19885. doi.org/ 10.1074/jbc.RA118.002768. [DOI] [PMC free article] [PubMed]
  • 104.Guruprasad K., Reddy B.V.B., Pandit M.W. Correlation between stability of a protein and its dipeptide composition: a novel approach for predicting in vivo stability of a protein from its primary sequence. Protein Eng. Des. Sel. 1990;4:155–161. doi: 10.1093/protein/4.2.155. [DOI] [PubMed] [Google Scholar]
  • 105.Bastola R., Lee S. Physicochemical properties of particulate vaccine adjuvants: their pivotal role in modulating immune responses. J. Pharm. Res. Investigation. 2018 doi: 10.1007/s40005-018-0406-4. [DOI] [Google Scholar]
  • 106.Rost B. Review: protein secondary structure prediction continues to rise. J. Struct. Biol. 2001;134:204–218. doi: 10.1006/jsbi.2001.4336. [DOI] [PubMed] [Google Scholar]
  • 107.Lovell S.C., Davis I.W., Arendall W.B., 3rd, de Bakker P.I., Word J.M., Prisant M.G., Richardson J.S., Richardson D.C. Structure validation by Calpha geometry: phi, psi and Cbeta deviation. Proteins. 2003;50:437–450. doi: 10.1002/prot.10286. [DOI] [PubMed] [Google Scholar]
  • 108.Ding S., Li Y., Shi Z., Yan S. A protein structural classes prediction method based on predicted secondary structure and PSI-BLAST profile. Biochimie. 2014;97:60–65. doi: 10.1016/j.biochi.2013.09.013. [DOI] [PubMed] [Google Scholar]
  • 109.Adekiya T.A., Aruleba R.T., Khanyile S., Masamba P., Oyinloye B.E., Kappo A.P. Structural analysis and epitope prediction of MHC class-1-chain related protein-a for cancer vaccine development. Vaccines (Basel) 2017;6:1–12. doi: 10.3390/vaccines6010001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 110.Buchan D.W., Jones D.T. The PSIPRED protein analysis workbench: 20 years on. Nucleic Acids Res. 2019;47:W402–W407. doi: 10.1093/nar/gkz297. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 111.Laskowski R.A., MacArthur M.W., Moss D.S., Thornton J.M. PROCHECK: a program to check the stereochemical quality of protein structures. J. Appl. Crystallogr. 1993;26:283–291. doi: 10.1107/S0021889892009944. [DOI] [Google Scholar]
  • 112.L.G. Bermúdez-Humarán, P. Kharrat, J.M. Chatel, P. Langella, Lactococci and lactobacilli as mucosal delivery vectors for therapeutic proteins and DNA vaccines, Microb. Cell Factories. 10(2011) 1–10. doi.org/ 10.1186/1475-2859-10-S1-S4. [DOI] [PMC free article] [PubMed]
  • 113.Miquel-Clopés A., Bentley E.G., Stewart J.P., Carding S.R. Mucosal vaccines and technology. Clin. Exp. Immunol. 2019;196:205–214. doi: 10.1111/cei.13285. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 114.Mandala W.L., Msefula C.L., Gondwe E.N., Drayson M.T., Molyneux M.E., MacLennan C.A. Cytokine profiles in Malawian children presenting with uncomplicated malaria, severe malarial anemia, and cerebral malaria. Clin. Vaccine Immunol. 2017;24:1–11. doi: 10.1128/CVI.00533-16. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 115.Prakash D., Fesel C., Jain R., Cazenave P.A., Mishra G.C., Pied S. Clusters of cytokines determine malaria severity in Plasmodium falciparum infected patients from endemic areas of Central India. J. Infect. Dis. 2006;194:198–207. doi: 10.1086/504720. [DOI] [PubMed] [Google Scholar]
  • 116.Sarangi A., Mohapatra P.C., Dalai R.K., Sarangi A.K. Serum IL-4, IL-12 and TNF-alpha in malaria: a comparative study associating cytokine responses with severity of disease from the Coastal Districts of Odisha. J. Parasit. Dis. 2014;38:143–147. doi: 10.1007/s12639-013-0237-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 117.Kester K.E., Cummings J.F., Ofori-Anyinam O., Ockenhouse C.F., Krzych U., Moris P., Schwenk R., Nielsen R.A., Debebe Z., Pinelis E., Juompan L., Williams J., Dowler M., Stewart V.A., Wirtz R.A., Dubois M.C., Lievens M., Cohen J., Ballou W.R., Heppner D.G., Jr., RTS,S Vaccine Evaluation Group Randomized, double-blind, phase 2a trial of falciparum malaria vaccines RTS,S/AS01B and RTS,S/AS02A in malaria-naive adults: safety, efficacy, and immunologic associates of protection. J. Infect. Dis. 2009;200:337–346. doi: 10.1086/600120. [DOI] [PubMed] [Google Scholar]
  • 118.Kaba S.A., McCoy M.E., Doll T.A., Brando C., Guo Q., Dasgupta D., Yang Y., Mittelholzer C., Spaccapelo R., Crisanti A., Burkhard P., Lanar D.E. Protective antibody and CD8+ T-cell responses to the Plasmodium falciparum circumsporozoite protein induced by a nanoparticle vaccine. PLoS One. 2012;7:1–11. doi: 10.1371/journal.pone.0048304. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 119.Kazi A., Chuah C., Majeed A., Leow C.H., Lim B.H., Leow C.Y. Current progress of immunoinformatics approach harnessed for cellular- and antibody-dependent vaccine design. Pathog. Glob. Health. 2018;112:123–131. doi: 10.1080/20477724.2018.1446773. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 120.A. Mubarak, W. Alturaiki, M.G. Hemida, Middle East respiratory syndrome coronavirus (MERS-CoV): infection, immunological response, and vaccine development, J Immunol Res. 2019(2019) 1–11. doi.org/ 10.1155/2019/6491738. [DOI] [PMC free article] [PubMed]
  • 121.A.S. Mustafa, In silico analysis and experimental validation of Mycobacterium tuberculosis -specific proteins and peptides of Mycobacterium tuberculosis for immunological diagnosis and vaccine development, Medical Principles and Practice. 22(2013) 43–51. doi.org/ 10.1159/000354206. [DOI] [PMC free article] [PubMed]
  • 122.Vidarsson G., Dekkers G., Rispens T. IgG subclasses and allotypes: from structure to effector functions. Front. Immunol. 2014;5:1–17. doi: 10.3389/fimmu.2014.00520. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 123.Sok D., Burton D.R. Recent progress in broadly neutralizing antibodies to HIV. Nat. Immunol. 2018;19:1179–1188. doi: 10.1038/s41590-018-0235-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 124.Jones A.T., Chamcha V., Kesavardhana S., Shen X., Beaumont D., Das R., Wyatt L.S., LaBranche C.C., Stanfield-Oakley S., Ferrari G., Montefiori D.C., Moss B., Tomaras G.D., Varadarajan R., Amara R.R. A trimeric HIV-1 envelope gp120 immunogen induces potent and broad anti-V1V2 loop antibodies against HIV-1 in rabbits and rhesus macaques. J. Virol. 2018;92 doi: 10.1128/JVI.01796-17. e01796-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 125.E. Chen, D. Urusova, N.D. Salinas, F. Ntumngia, L. Carias, Y. Huang, J. Adhikari, S.J. Barnes, M.L. Gross, C.L. King, J.H. Adams JN.H. Tolia, Structural vaccinology for malaria: host–pathogen interactions, broadly neutralizing antibodies and immunogen design, Acta Cryst. A74(2018). doi.org/ 10.1107/S01087673180983. [DOI]
  • 126.B.E. Correia, J.T. Bates, R.J. Loomis, G. Baneyx, C. Carrico, J.G. Jardine, R. Rupert, C. Correnti, O. Kalyuzhniy, V. Vittal, M.J. Connell, E. Stevens, A. Schroeter, M. Chen, S. Macpherson, A.M. Serra, Y. Adachi, M.A. Holmes, Y. Li, R.E. Klevit, B.S. Graham, R.T. Wyatt, D. Baker, R.K. Strong, J.E. Crowe Jr., P.R. Johnson, W.R. Schief. Proof of principle for epitope-focused vaccine design, Nature. 507(2014) 201–206. doi.org/ 10.1038/nature12966. [DOI] [PMC free article] [PubMed]
  • 127.I. Sela-Culang, Y. Ofran, B. Peters, Antibody specific epitope prediction-emergence of a new paradigm, Curr. Opin. Virology. 11(2015) 98–102. doi.org/ 10.1016/j.coviro.2015.03.012. [DOI] [PMC free article] [PubMed]
  • 128.R. Rappuoli, M.J. Bottomley, U. D'Oro, O. Finco, E. De Gregorio, Reverse vaccinology 2.0: human immunology instructs vaccine antigen design, J. Exp. Med.. 213(2016) 469–481. doi.org/ 10.1084/jem.20151960. [DOI] [PMC free article] [PubMed]
  • 129.Ringel O., Vieillard V., Debré P., Eichler J., Büning H., Dietrich U. The hard way towards an antibody-based HIV-1 Env vaccine: lessons from other viruses. Viruses. 2018;10:1–22. doi: 10.3390/v10040197. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 130.Doumbo O.K., Niare K., Healy S.A., Sagara I., Duffy P.E. Malaria transmission-blocking vaccines: present status and future perspectives, towards malaria elimination - a leap forward, Sylvie Manguin and vas dev. IntechOpen Chapter. 2018;15:363–385. doi: 10.5772/intechopen.77241. [DOI] [Google Scholar]
  • 131.McLeod B., Miura K., Scally S.W., Bosch A., Nguyen N., Shin H., Kim D., Volkmuth W., Rämisch S., Chichester J.A., Streatfield S., Woods C., Schief W.R., Emerling D., King C.R., Julien J.P. Potent antibody lineage against malaria transmission elicited by human vaccination with Pfs25. Nat. Commun. 2019;2019:1–11. doi: 10.1038/s41467-019-11980-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 132.Lee D.H., Chu K.B., Kang H.J., Lee S.H., Chopra M., Choi H.J., Moon E.K., Inn S.K., Quan F.S. Protection induced by malaria virus-like particles containing codon-optimized AMA-1 of Plasmodium berghei. Malar. J. 2019;18:1–12. doi: 10.1186/s12936. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 133.Burrack K.S., Hart G.T., Hamilton S.E. Contributions of natural killer cells to the immune response against Plasmodium. Malar. J. 2019;18:1–9. doi: 10.1186/s12936-019-2953-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 134.Fong R.H., Banik S.S., Mattia K., Barnes T., Tucker D., Liss N., Lu K., Selvarajah S., Srinivasan S., Mabila M., Miller A., Muench M.O., Michault A., Rucker J.B., Paes C., Simmons G., Kahle K.M., Doranz B.J. Exposure of epitope residues on the outer face of the chikungunya virus envelope trimer determines antibody neutralizing efficacy. J. Virol. 2014;88:14364–14379. doi: 10.1128/JVI.01943-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 135.Sanchez-Trincado J.L., Gomez-Perosanz M., Reche P.A. Fundamentals and methods for T- and B-cell epitope prediction. J Immunol Res. 2017;2017:1–14. doi: 10.1155/2017/2680160. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 136.K. Wüthrich, G. Wagner,R. Richarz, W. Braun, Correlations between internal mobility and stability of globular proteins, Biophys. J.. 32(1980) 549–560. doi.org/ 10.1016/S0006-3495(80)84989-7. [DOI] [PMC free article] [PubMed]
  • 137.Azim K.F., Hasan M., Hossain M.N., Somana S.R., Hoque S.F., Bappy M., Chowdhury A.T., Lasker T. Immunoinformatics approaches for designing a novel multi epitope peptide vaccine against human norovirus (Norwalk virus) Infect. Genet. Evol. 2019;74:1–12. doi: 10.1016/j.meegid.2019.103936. [DOI] [PubMed] [Google Scholar]
  • 138.Grote A., Hiller K., Scheer M., Münch R., Nörtemann B., Hempel D.C., Jahn D. JCat: a novel tool to adapt codon usage of a target gene to its potential expression host. Nucleic Acids Res. 2005;33:W526–W531. doi: 10.1093/nar/gki376. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 139.Urrutia-Baca V.H., Gomez-Flores R., De La Garza-Ramos M.A., Tamez-Guerra P., Lucio-Sauceda D.G., Rodríguez-Padilla M.C. Immunoinformatics approach to design a novel epitope-based oral vaccine against helicobacter pylori. Journal of Computational Biol. 2019;26:1177–1190. doi: 10.1089/cmb.2019.0062. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 140.Punde N., Kooken J., Leary D., Legler P.M., Angov E. Codon harmonization reduces amino acid misincorporation in bacterially expressed P. falciparum proteins and improves their immunogenicity. AMB Express. 2019;9 doi: 10.1186/s13568-019-0890-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 141.Morello E., Bermúdez-Humarán L.G., Llull D., Solé V., Miraglio N., Langella P., Poquet I. Lactococcus lactis, an efficient cell factory for recombinant protein production and secretion. J. Mol. Microbiol. Biotechnol. 2008;14:48–58. doi: 10.1159/000106082. [DOI] [PubMed] [Google Scholar]
  • 142.Pontes D.S., de Azevedo M.S., Chatel J.M., Langella P., Azevedo V., Miyoshi A. Lactococcus lactis as a live vector: heterologous protein production and DNA delivery systems. Protein Expr. Purif. 2011;79:165–175. doi: 10.1016/j.pep.2011.06.005. [DOI] [PubMed] [Google Scholar]
  • 143.M. Bahey-El-Din, C.G. Gahan, Lactococcus lactis-based vaccines: current status and future perspectives, Human vaccines. 7(2011) 106–109. doi.org/ 10.4161/hv.7.1.13631. [DOI] [PubMed]
  • 144.Acquah F.K., Obboh E.K., Asare K., Boampong J.N., Nuvor S.V., Singh S.K., Theisen M., Williamson K.C., Amoah L.E. Antibody responses to two new Lactococcus lactis-produced recombinant Pfs48/45 and Pfs230 proteins increase with age in malaria patients living in the central region of Ghana. Malar. J. 2017;16:306. doi: 10.1186/s12936-017-1955-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 145.Singh S.K., Roeffen W., Mistarz U.H., Chourasia B.K., Yang F., Rand K.D., Sauerwein R.W., Theisen M. Construct design, production, and characterization of Plasmodium falciparum 48/45 R0.6C subunit protein produced in Lactococcus lactis as candidate vaccine. Microb. Cell Factories. 2017;16:1–11. doi: 10.1186/s12934-017-0710-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 146.S.K. Singh, R.W. Tiendrebeogo, B.K. Chourasia, I.H. Kana, S. Singh, M. Theisen, Lactococcus lactis provides an efficient platform for production of disulfide-rich recombinant proteins from Plasmodium falciparum, Microb. Cell Factories. 17(2018) 1–13. doi.org/ 10.1186/s12934-018-0902-2. [DOI] [PMC free article] [PubMed]
  • 147.S.K. Singh, S. Thrane, B.K. Chourasia, K. Teelen, W. Graumans, R. Stoter, G.J. van Gemert, M.G. van de Vegte-Bolmer, M.A. Nielsen, A. Salanti, A.F. Sander, R.W. Sauerwein, M.M. Jore, M. Theisen, Pfs230 and Pfs48/45 fusion proteins elicit strong transmission-blocking antibody responses against Plasmodium falciparum, Front. Immunol.. 10(2019) 1–12. doi.org/ 10.3389/fimmu.2019.01256. [DOI] [PMC free article] [PubMed]
  • 148.Singh S.K., Plieskatt J., Chourasia B.K., Singh V., Bolscher J.M., Dechering K.J., Adu B., López-Méndez B., Kaviraj S., Locke E., King C.R., Theisen M. The Plasmodium falciparum circumsporozoite protein produced in Lactococcus lactis is pure and stable. J. Biol. Chem. 2020;295:403–414. doi: 10.1074/jbc.RA119.011268. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 149.A. Stedman, M.A. Chambers, J. Gutierrez-Merino, Secretion and functional expression of Mycobacterium bovis antigens MPB70 and MPB83 in lactic acid bacteria, Tuberculosis (Edinburgh, Scotland). 117(2019) 24–30. doi.org/ 10.1016/j.tube.2019.05.007. [DOI] [PubMed]
  • 150.P. Mancha-Agresti, C.P. de Castro, J. Dos Santos, M.A. Araujo, V.B. Pereira, J.G. LeBlanc, S.Y. Leclercq, V. Azevedo, Recombinant invasive Lactococcus lactis carrying a DNA vaccine coding the Ag85A antigen increases INF-γ, IL-6, and TNF-α cytokines after intranasal immunization, Front. Microbiol.. 8(2017) 1–12. doi.org/ 10.3389/fmicb.2017.01263. [DOI] [PMC free article] [PubMed]
  • 151.Aliramaei M.R., Khorasgani M.R., Rahmani M.R., Zarkesh Esfahani S.H., Emamzadeh R. Expression of helicobacter pylori CagL gene in Lactococcus lactis MG1363 and evaluation of its immunogenicity as an oral vaccine in mice. Microb. Pathog. 2019;142 doi: 10.1016/j.micpath.2019.103926. [DOI] [PubMed] [Google Scholar]
  • 152.A.K. Szczepankowska, K. Szatraj, P. Sałański, A. Rózga, R.K. Górecki, J.K. Bardowski, Recombinant Lactococcus lactis expressing Haemagglutinin from a polish avian H5N1 isolate and its immunological effect in preliminary animal trials, Biomed. Res. Int.. 2017(2017) 1–8. doi.org/ 10.1155/2017/6747482. [DOI] [PMC free article] [PubMed]
  • 153.X. Zhang, S. Hu, X. Du, T. Li, L. Han, J. Kong, Heterologous expression of carcinoembryonic antigen in Lactococcus lactis via LcsB-mediated surface displaying system for oral vaccine development, J. Microbiol. Immunol. Infect.. 49(2016) 851–858. doi.org/ 10.1016/j.jmii.2014.11.009. [DOI] [PubMed]
  • 154.Samazan F., Rokbi B., Seguin D., Telles F., Gautier V., Richarme G., Chevret D., Varela P.F., Velours C., Poquet I. Production, secretion and purification of a correctly folded staphylococcal antigen in Lactococcus lactis. Microb. Cell Factories. 2015;14:1–14. doi: 10.1186/s12934-015-0271-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 155.E. Davarpanah, N. Seyed, F. Bahrami, S. Rafati, R. Safaralizadeh, T. Taheri, 2020. Lactococcus lactis expressing sand fly PpSP15 salivary protein confers long-term protection against Leishmania major in BALB/c mice. PLoS Negl. Trop. Dis.. 14, e0007939. doi.org/ 10.1371/journal.pntd.0007939. [DOI] [PMC free article] [PubMed]
  • 156.A.H. Mohseni, V. Razavilar, H. Keyvani, M.R. Razavi, R.A. Khavari-Nejad, Oral immunization with recombinant Lactococcus lactis NZ9000 expressing human papillomavirus type 16 E7 antigen and evaluation of its immune effects in female C57BL/6 mice, J. Med. Virol.. 91(2019) 296–307. doi.org/ 10.1002/jmv.25303. [DOI] [PubMed]
  • 157.K.Q. Xin, Y. Hoshino, Y. Toda, S. Igimi, Y. Kojima, N. Jounai, K. Ohba, A. Kushiro, M. Kiwaki, K. Hamajima, D. Klinman, K. Okuda, Immunogenicity and protective efficacy of orally administered recombinant Lactococcus lactis expressing surface-bound HIV, Env. Blood. 102(2003) 223–228. doi.org/ 10.1182/blood-2003-01-0110. [DOI] [PubMed]
  • 158.Buccato S., Maione D., Rinaudo C.D., Volpini G., Taddei A.R., Rosini R., Telford J.L., Grandi G., Margarit I. Use of Lactococcus lactis expressing pili from group B Streptococcus as a broad-coverage vaccine against streptococcal disease. J. Infect. Dis. 2006;194:331–340. doi: 10.1086/505433. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplementary Fig. 1

Immune simulation results of negative polypeptide vaccine control C5 (A, C, E, G, I) and test polypeptide vaccine PV3B (B, D, F, H, J).

mmc1.docx (414KB, docx)
Supplementary Table S1

Details of predicted linear B-cell epitopes.

mmc2.xlsx (15.8KB, xlsx)
Supplementary Table S2

Details of predicted HLA class I and II epitopes.

mmc3.xlsx (28.6KB, xlsx)
Supplementary Table S3

Details of cytokines inducing T-cell epitope ensemble (HLA class I and II).

Details of epitope ensemble with their respective source B-cell epitope and antigenic protein

mmc4.xlsx (15.6KB, xlsx)
Supplementary Table S4

Predicted B-cell epitopes (linear and discontinuous) of leading PVs (PV1A and PV3B).

mmc5.xlsx (19.5KB, xlsx)

Articles from International Journal of Biological Macromolecules are provided here courtesy of Elsevier

RESOURCES