The author wishes to make the following correction to this paper [1]. Due to mislabeling, replace:
with
There is an error in the peptide sequence of GIP in Figure 1. Two amino acid residues are missing. The correct sequence for GIP is: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ. The authors would like to apologize for any inconvenience caused to the readers by these changes.
References
- 1.Al-Zamel N., Al-Sabah S., Luqmani Y., Adi L., Chacko S., Schneider T.D., Krasel C. A Dual GLP-1/GIP Receptor Agonist Does Not Antagonize Glucagon at Its Receptor but May Act as a Biased Agonist at the GLP-1 Receptor. Int. J. Mol. Sci. 2019;20:3532. doi: 10.3390/ijms20143532. [DOI] [PMC free article] [PubMed] [Google Scholar]