Abstract
Fowlicidins are a group of newly identified chicken cathelicidin host defense peptides. We have shown that the putatively mature fowlicidin-2 of 31 amino acid residues possesses potent antibacterial and lipopolysaccharide (LPS)- neutralizing activities, but with a noticeable toxicity to mammalian cells. As a first step in exploring the structure-activity relationships of fowlicidin-2, in this study we determined its tertiary structure by nuclear magnetic resonance spectroscopy. Unlike the majority of cathelicidins, which are composed of a predominant α-helix with a short hinge sequence near the center, fowlicidin-2 consists of 2 well-defined α-helical segments (residues 6–12 and 23–27) connected by a long extensive kink (residues 13–20) induced by proline. To further investigate the functional significance of each of these structural components, several N- and C-terminal deletion analogs of fowlicidin-2 were synthesized and analyzed for their antibacterial, cytotoxic and LPS-neutralizing activities. Our results indicated that neither the N- nor C-terminal α-helix alone is sufficient to confer any function. Rather, fowlicidin-2(1–18) and fowlicidin-2(15–31), 2 α-helical segments with inclusion of the central cationic kink region, retained substantial capacities to kill bacteria and neutralize the LPS-induced proinflammatory response, relative to the parent peptide. More desirably, these 2 peptide analogs showed substantially reduced toxicity to human erythrocytes and epithelial cells, indicative of improved potential as antibacterial and antisepsis agents. To our knowledge, fowlicidin-2 is the first α-helical cathelicidin, with the central kink region shown to be critically important in killing bacteria and neutralizing LPS.
Key Words: Host defense peptide, Antimicrobial peptides, Cathelicidins, Innate immunity, Structure-activity relationship, Endotoxin, Antibiotic resistance
Introduction
With the rapid emergence of antibiotic-resistant pathogens, there is an unprecedented urgency to develop new antimicrobials to which these organisms are less prone to gain resistance. Cationic host defense peptides are an integral component of innate immunity and are found in virtually all living species. They are capable of killing a variety of pathogens and have a similar efficiency against strains resistant and susceptible to antibiotics [1, 2, 3]. Most cationic peptides have nonspecific membrane-lytic activities, which are much more difficult for bacteria to develop resistance to than to conventional antibiotics [1, 4, 5]. Therefore, these peptides are being actively explored as a new class of antimicrobials.
However, several major barriers impede the development of cationic peptides as therapeutic agents. Factors such as salt and serum suppress the microbicidal activities of a majority of these peptides [6, 7, 8]. There is also noticeable toxicity to host cells associated with many of these peptides. Various strategies are being pursued in attempts to reduce the toxicity and enhance the antimicrobial efficacy and serum stability of these peptides. To date, a number of structure-activity relationship studies have led to the identification of novel peptide analogs with better therapeutic potentials. They have done this by altering certain physicochemical and structural properties, such as charge, amphipathicity, hydrophobicity, degree of structuring (α-helix or β-sheet), D-isomerization and cyclization [9, 10, 11, 12].
Cathelicidins, a major family of vertebrate antimicrobial host defense peptides, are receiving particular attention as novel antimicrobials, due to their simple structures and high antibacterial efficacy relative to other families of cationic peptides [13, 14, 15, 16]. In addition to a broad spectrum of antimicrobial activities, many cathelicidins have the capacity to directly bind lipopolysaccharide (LPS) and lipoteichoic acid in vitro and suppress Gram-negative and Gram-positive bacteria-induced septic shock in vivo [17, 18, 19]. Thus, these cathelicidins may also represent excellent therapeutic candidates for sepsis treatment.
We previously reported the identification of 3 novel chicken cathelicidins, namely fowlicidins 1–3, with highly potent antibacterial and LPS-neutralizing activities [20, 21]. In comparison with fowlicidin-1, fowlicidin-2 exhibited similar antibacterial efficacy with less lytic activity to host cells [20]. To further reduce the toxicity of fowlicidin-2, in this report we first determined the tertiary structure of fowlicidin-2 by nuclear magnetic resonance (NMR) spectroscopy. Based on the structural information, several deletion analogs were further designed and analyzed for their antibacterial, cytotoxic, membranepermeabilizing and LPS-neutralizing activities. We demonstrated that 4 amino acids in the central kink region (residues 15–18) are critically important in peptide-membrane interactions as well as in bacterial killing and LPS neutralization. We further identified that 2 short peptide analogs that contained either the N- or C-terminal helical segment together with residues 15–18 retain substantial antibacterial and LPS-neutralizing activities but have a significantly reduced cytotoxicity, relative to the parent peptide.
Materials and Methods
Peptide Synthesis
Fowlicidin-2 was synthesized using the standard solid-phase method by SynPep (Dublin, Calif., USA) and its analogs by Bio-Synthesis (Lewisville, Tex., USA; table 1). The peptides were purified through reverse-phase HPLC and obtained at 195% purity. The mass and purity of each peptide were further confirmed by MALDI-TOF mass spectrometry using the Voyager DePro instrument (Applied Biosystems, Foster City, Calif., USA) housed in the recombinant DNA/protein resource facility of Oklahoma State University. The average mass of each peptide determined by mass spectrometry was consistent with the mass calculated from the sequence (table 1).
Table 1.
Peptide | Sequence | Charge | Length | Mass, Da |
|
---|---|---|---|---|---|
calculated | observed | ||||
Fowl-2(1–31) | LVQRGRFGRFLRKIRRFRPKVTITIQGSARF | +10 | 31 | 3,761.5 | 3,760.6 |
Fowl-2(1–14) | LVQRGRFGRFLRKI | +5 | 14 | 1,746.1 | 1,746.1 |
Fowl-2(1–15) | LVQRGRFGRFLRKIR | +6 | 15 | 1,902.3 | 1,903.2 |
Fowl-2(1–18) | LVQRGRFGRFLRKIRRFR | +8 | 18 | 2,361.9 | 2,363.0 |
Fowl-2(15–31) | RRFRPKVTITIQGSARF | +5 | 17 | 2,033.4 | 2,034.0 |
Fowl-2(19–31) | PKVTITIQGSARF | +2 | 13 | 1,417.7 | 1,417.8 |
Circular Dichroism Spectroscopy
To determine the secondary structure of fowlicidin-2 and its analogs, circular dichroism (CD) spectroscopy was performed with a Jasco-715 spectropolarimeter using a 0.1-cm path length cell over the 180- to 260-nm range, as we previously described [21, 22]. The spectra were acquired at 25°C every 1 nm, with a 2-second averaging time per point and a 1-nm band pass. Peptides (10 μΜ) were measured in 50 mM potassium phosphate buffer, pH 7.4, with or without different concentrations of trifluoroethanol (TFE) (0, 10, 20, 40 and 60%) or sodium dodecyl sulfate (SDS) micelles (0.25 and 0.5%). Mean residue ellipticity (MRE) was expressed as [θ]MRE (deg • cm2 • dmol–1). The contents of 6 types of secondary structural element (regular and distorted α-helix, regular and distorted β-sheet, turns and unordered structures) were analyzed with the program Selcon3 [23].
Nuclear Magnetic Resonance Spectroscopy
To determine the solution structure of fowlicidin-2, 2-dimensional 1H-1H nuclear magnetic resonance (NMR) experiments were performed with an 11.75-tesla UnityPlus spectrometer (Varian, Palo Alto, Calif., USA), operating at 499.96 MHz, with a 3-mm triple-resonance inverse detection probe. Fowlicidin-2 (3 mM) was used to record total correlation spectroscopy (TOCSY) and nuclear overhauser enhancement spectroscopy (NOESY) NMR experiments at 25°C in 50% deuterated TFE (TFE-d3)/50% H2O, essentially as described [21, 22]. A series of 1-dimensional experiments were conducted from 5 to 35°C, at 5°C increments. Water peak suppression was obtained by low-power irradiation of the H2O resonance. A total of 256 increments of 4K data points were recorded for the 2-dimensional experiments. All data sets were obtained in the hypercomplex phase-sensitive mode. TOCSY spectra were recorded by using MLEV-17 for isotropic mixing for 100 ms at a B1 field strength of 8 KHz. NOESY experiments were performed with mixing times of 100, 300 and 400 ms, and the residual TFE methylene peak (3.88 ppm) was used as a reference for the chemical-shift values. Varian software, VNMR 6.1C, on a Silicon Graphics Octane workstation was used for data processing, and Sparky 3 software (Goddard and Kneller, University of California, San Francisco, Calif., USA) was used for data analysis.
Structure Calculation
Proton resonance assignments were made using 2-dimensional TOCSY for intra-residue spin systems and NOESY spectra for inter-residue connectivities, as previously described [24]. A total of 174 distance constraints obtained from the NOESY spectrum were used for structure calculations. A mixing time of 300 ms was initially used for distance constraint measurements and the assigned peaks were then checked with the NOESY spectra obtained with a 100-ms mixing time. NOE peaks were classified as intra-residue, sequential, medium and long range. NOE cross peak intensities were classified as strong (1.8–2.7 Å), medium (1.8–3.5 Å), weak (1.8–4.0 Å) and very weak (1.8–5.0 Å). Upper distance limits for NOEs involving methyl protons and non-stereospecifically assigned methylene protons were corrected appropriately by adding 1 Å to the constraints for center averaging [25]. The obtained distance restraints were then used to create initial peptide structures starting from extended structures using the Crystallography and NMR System (CNS), version 1.1 [26], which uses both a simulated annealing protocol and molecular dynamics to produce low-energy structures with minimum distance and geometry violations. Default parameters were used to generate 100 structures for the initial CNS run. A second round of calculations generated 20 structures, from which the 10 with the lowest energy and no restriction violations and were selected and analyzed with Sybyl 7.1 (Tripos, St. Louis, Mo., USA). The surface accessibilities of fowlicidin-2 were generated using GRASP [27].
Antibacterial Assay
Three representative Gram-negative bacteria (Escherichia coli ATCC 25922, Salmonella enterica Serovar Enteritidis ATCC 13076 and Klebsiella pneumoniae ATCC 13883) and 4 Gram-positive bacteria (Listeria monocytogenes ATCC 19115, Staphylococcus aureus ATCC 25923, and 2 methicillin-resistant strains, S. aureus ATCC BAA-39 and S. aureus ATCC 43300) were purchased from ATCC (Manassas, Va., USA) or MicroBiologics (St. Cloud, Minn., USA). The antibacterial activities of fowlicidin-2 and its analogs were tested by using a modified broth microdilution assay in the bicarbonate buffer to better mimic physiological environments, as previously described [28]. Briefly, bacteria were cultured overnight in tryptic soy broth (TSB) at 37°C, diluted 1:1,000 in fresh subculture medium containing 20% TSB, 10% fetal bovine serum (FBS), 100 mM NaCl, 25 mM NaHCO3 and 1 mM NaH2PO4, and grown to the mid-log phase. Cells were then washed twice with 10 mM sodium phosphate buffer, pH 7.4, and resuspended to 5 × 105 colony-forming units (CFU)/ml in the assay medium containing 20% TSB, 25 mM NaHCO3 and 1 mM NaH2 PO4 [28]. If necessary, 100 mM NaCl was incorporated to test the effect of salinity on antibacterial activity. Bacteria (90 μm) were dispensed into 96-well plates, followed by addition in duplicate of 10 μl of peptides in serial 2-fold dilutions in 0.01% acetic acid. The minimum inhibitory concentration (MIC) of each peptide against each bacterial strain was determined as the lowest concentration that gave no visible bacterial growth after overnight incubation at 37°C.
Effect of Serum on the Antibacterial Activity
The influence of serum on the antibacterial activity of fowlicidin-2 and its analogs was evaluated by the radial diffusion assay as described [29, 30]. Briefly, S. aureus ATCC 25923 was grown in TSB to the mid-log phase, and washed twice with 10 mM sodium phosphate buffer, pH 7.4, and then mixed evenly to 4 × 105 CFU/ml with the underlay gel containing 10 mM sodium phosphate buffer, 0.3 mg/ml of TSB powder and 1% (w/v) agarose. Sample wells (3 mm in diameter) were punched in the underlay gel. Peptides (0.5 or 1 μg), diluted in 4 μl of 0.01% acetic acid containing 0, 20 and 50% human serum, were added to each well. After 3 h of incubation at 37°C, the overlay gel containing 6% TSB powder, 1% agarose and 10 mM sodium phosphate buffer (pH 7.4) was poured onto the underlay gel and incubated overnight at 37°C to visualize the bacterial clearance zones.
Inner Membrane Permeabilization Assay
The kinetics of permeabilizing bacterial cytoplasmic membranes by fowlicidin-2 and its analogs were determined using E. coli ML-35p, which constitutively expresses β-galactosidase in the cytosol but lacks lactose permease (kindly provided by Richard Gallo, University of California, San Diego, Calif., USA), as previously described [21, 28]. The disruption of the E. coli ML-35p inner membrane results in the release of β-galactosidase, which in turn hydrolyzes o-nitrophenyl-β-D-galactopyranoside (ONPG), a chromogenic substrate to generate a color product, o-nitrophenol. Briefly, E. coli ML-35p was cultured overnight in TSB at 37°C, diluted 1:1,000 and grown for an additional 3 h at 37°C. Cells were washed twice with 10 mM sodium phosphate buffer, pH 7.4, and diluted to A600 = 0.03 (equivalent to 2.5–5 × 107 CFU/ml) in the same buffer containing 1% TSB with and without 100 mM NaCl. Bacteria (80 μl) were then dispensed into a 96-well plate, followed by addition of 0.5 MIC of each peptide and 1.5 mM of ONPG (Sigma, St. Louis, Mo., USA) to a total volume of 100 μl. Because the MIC of fowlicidin-2(19–31) could not be determined even at the highest peptide concentration tested (132 μM), 16 μM was used. The plate was incubated at 37°C for 1 h with shaking and it was read every 2 min to monitor the production of o-nitrophenol at 420 nm. Negative controls contained no peptide but an equal volume of 0.01% acetic acid.
Hemolytic Assay
The hemolytic activities of fowlicidin-2 and its analogs were determined as previously described [20, 21, 22]. Briefly, fresh anti-coagulated human blood was collected, washed twice with PBS and diluted to 0.8% in PBS with or without 10% FBS. Erythrocytes (90 μl) were dispensed into 96-well plates, followed by addition in duplicate of 10 μl of serially diluted peptides in 0.01% acetic acid. After incubation at 37°C for 2 h, the plates were centrifuged at 800 g for 10 min. The supernatants were transferred to new 96-well plates and the absorbance was measured at 405 nm for released hemoglobin. Negative controls contained cells suspended in PBS only and positive controls included cells suspended in 1% Triton X-100. Percent hemolysis was calculated as [(A405 nm peptide – A405 nm, PBS)/(A405 nm, 1% Triton X-100 – A405 nm, PBS)] × 100.
Cytotoxicity Assay
The toxicity was evaluated with human colonic epithelial Caco-2 cells (ATCC) using alamarBlue dye (Biosource, Carlsbad, Calif., USA), as previously described [20, 21, 22]. Briefly, cells were seeded into a 96-well plate at 5 × 104 cells/well in Dulbecco's modified Eagle's medium (DMEM) containing 20% FBS. After overnight growth to 80–90% confluence at 37°C and in 5% CO2, cells were washed once with DMEM, followed by addition of 90 μl of fresh DMEM with and without 10% FBS and 10 μl of each peptide in duplicate (to a final concentration of 100 or 200 mM) into each well. After incubation for 18 h, 10 μl of alamarBlue dye were added to each well and incubated for another 6 h. The fluorescence was measured with excitation at 545 nm and emission at 590 nm. Percent cell death was calculated as [1 – (Fpeptide – Fbackground)/(Facetic acid – Fbackground)] × 100, where Fpeptide is the fluorescence of cells exposed to peptides, Facetic acid is the fluorescence of cells exposed to 0.01% acetic acid only and Fbackground is the background fluorescence of 10% alamarBlue dye in DMEM without cells.
Modulation of LPS-Induced Proinflammatory Response
The effect of fowlicidin-2 and its analogs on the production of LPS-induced proinflammatory mediators was evaluated using mouse macrophage RAW264.7 cells (ATCC). Cells were seeded in 24-well plates at 3 × 105 cells/well in DMEM containing 10% FBS and allowed to grow overnight to 80–90% confluence. After being washed twice with DMEM and replenished with fresh DMEM with or without 10% FBS, cells were treated with 0.1 μg/ml of LPS from E. coli O114:B4 (Sigma) together with 20 μM of peptides in duplicate. The supernatants were removed, following incubation at 37°C for 24 h, for analysis of tumor necrosis factor (TNF)-α concentrations by ELISA (R&D Systems, Minneapolis, Minn., USA) and nitric oxide (NO) levels with Griess reagent (Molecular Probes, Eugene, Oreg., USA).
Results
Solution Structure of Fowlicidin-2
The secondary structure of fowlicidin-2 was determined by CD spectroscopy in different concentrations of TFE and SDS, as previously described [21, 22]. As shown in figure 1a, fowlicidin-2 was largely unstructured in phosphate buffer, but showed a dose-dependent enhancement in the α-helical content in the presence of increasing concentrations of TFE. The α-helicity rose from 3 to 36% as the TFE concentration increased from 10 to 60%. An α-helical content of 17% was also observed in 0.25 or 0.5% SDS micelles (fig. 1b).
Because fowlicidin-2 adopted a peak level of α-helicity in 40–60% TFE, 2-dimensional 1H-1H NMR spectroscopy was next performed to determine its tertiary structure in TFE:H2O (1:1, v/v), as previously described [21, 22]. Sequence-specific resonance assignments were obtained using the TOCSY and NOESY spectra. The TOCSY spectra acquired at 25°C gave good chemical-shift dispersion with limited spectral overlap, enabling the assignment of the spin systems for all residues (online suppl. fig. S1, www.karger.com/doi/10.1159/000174822). A spatial distance constraint was assigned from each NOE specific peak in the NOESY spectra. The sequential and medium distance NOE connectivities as well as Cα-proton chemical-shift index (ΔCαH) are illustrated in figure 2. A number of nonsequential dαN(i, i+3) NOEs that are indicative of regions of α-helical conformation were observed from Gly5 to Phe10 and from Val21 to Arg30. The characteristic chemical-shift index of these amino acids also confirmed the helical conformation in these 2 regions.
For structural calculations, a total of 174 NOE distance constraints involving 74 intraresidue, 53 sequential and 37 medium-range constraints were used (table 2). From 100 conformers calculated, 10 structures with the lowest energy were retained for further analysis. A Ramachandran plot, produced by Procheck-NMR [31], showed that 64.5% of residues are in the most favored region and 32.2% are in additional allowed regions (table 2). A superimposition of the 10 lowest energy structures showed a considerable degree of flexibility with a pairwise root mean square deviation of the backbone of 3.86 Å (table 2). However, alignments along residues 6–12 and 23–27 of the 10 lowest energy structures showed backbone root mean square deviation values of 1.55 and 0.28 Å, respectively (table 2), suggesting the 2 α-helical segments are relatively rigid, whereas other regions are flexible.
Table 2.
NOE constraints, n | ||
Total | 174 | |
Intraresidue | 74 | |
Sequential | 53 | |
Medium range | 37 | |
Long range | 6 | |
Energies, kcal/mol | ||
Overall | –203.70 ± 27.32 | |
Bonds | 72.52 ± 1.09 | |
Angles | 75.77 ± 8.12 | |
Improper | 0.28 ± 0.11 | |
Van der Waals | –141.07 ± 12.59 | |
Electrostatic | –211.21 ± 13.66 | |
Pairwise r.m.s.d. for residues 1–31, Å | ||
Backbone | 3.86 ± 0.98 | |
Heavy atoms | 5.73 ± 1.20 | |
r.m.s.d. to mean structure (backbone/heavy atoms), Å | ||
Residues 6–12 | 1.55/3.68 | |
Residues 23–27 | 0.28/1.34 | |
Percentage of residues in regions of ϕ-ψ space | ||
Core | 64.5% | |
Allowed | 29.0% | |
Generously allowed | 3.2% | |
Disallowed | 3.2% |
r.m.s.d. = Root mean square deviation.
The average solution structure of fowlicidin-2 indicated that it has 2 well-defined α-helices from Arg6 to Arg12 and from Ile23 to Gly27, a bend from Phe17 to Lys20 and a flexible region at the N-terminus from Leu1 to Arg4 (fig. 3a, b). In contrast to most α-helical cathelicidins with a limited degree of kink (mostly induced by glycine) near the center [21, 22, 32, 33], the kink of fowlicidin-2 in the central region is extensive, due to the presence of Pro19. A closer examination revealed that the N-terminal α-helix adopts a typical amphipathic structure, while the C-terminal α-helix is highly hydrophobic (compare fig. 3c and d). It is noted that the central kink region of fowlicidin-2 carries a strong positive charge (fig. 3c, d), containing 5 cationic residues. The atomic coordinates and structure factors of fowlicidin-2 have been deposited under code 2GDL in the Protein Data Bank, Research Collaboratory for Structural Bioinformatics, Rutgers University, New Brunswick, N.J., USA (www.rcsb.org).
Design and Conformation of Fowlicidin-2 Analogs
To probe the impact of 2 short helical segments and the central kink region on the antibacterial, cytotoxic and LPS-binding activities of fowlicidin-2, several analogs with deletion of either N- or C-terminal residues were designed (table 1), synthesized chemically and purified to 195% homogeneity by reverse-phase HPLC. The mass and purity of each peptide were further confirmed by mass spectrometry (fable 1). The secondary structural contents of each peptide were determined by CD spectroscopy in the presence of 60% TFE, showing each peptide analog with a higher degree of α-helicity than the parent peptide (fig. 1c). Three C-terminal deletion analogs, namely fowlicidin-2(1–14), fowlicidin-2(1–15) and fowlicidin-2(1–18), have a gradual increase in the α-helical content, ranging from 44 and 53 to 62%, respectively, suggesting that residues 15–18 in the central kink region of the parent peptide likely adopt an α-helical conformation without Pro19. The α-helical content of 2 N-terminal deletion analogs, fowlicidin-2(15–31) and fowlicidin-2(19–31), were estimated to be 42 and 79%, respectively, which is consistent with the secondary structural contents predicted from the parent peptide. A similar trend also occurred with each analog in 0.5% SDS (data not shown).
Antibacterial Activities of Fowlicidin-2 and Its Analogs
A modified broth microdilution assay was used to test the antibacterial activity of fowlicidin-2 and its analogs using a bicarbonate-based buffer as described [28]. Three representative Gram-negative and 4 Gram-positive bacterial strains, including methicillin-resistant S. aureus, were included in the assay. As shown in table 3, fowlicidin-2 is potent against all strains with the MIC values in the range of 0.5–2 μM with and without 100 mM NaCl. In contrast, the analog containing only the N-terminal α-helix [fowlicidin-2(1–14)] exhibited ≥8-fold reduction in antibacterial activity. The analog consisting solely of the C-terminal α-helix [fowlicidin-2(19–31)] failed to kill bacteria even at 32 μM, the highest concentration tested. These results suggested neither α-helical segments alone are sufficient to maintain the antibacterial activity of the parent peptide.
Table 3.
Bacteria | ATCC No. | MIC, μM |
|||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
fowl-2(1–31) |
fowl-2(1–14) |
fowl-2(1–15) |
fowl-2(1–18) |
fowl-2(15–31) |
fowl-2(19–31) |
||||||||
0 | 100 | 0 | 100 | 0 | 100 | 0 | 100 | 0 | 100 | 0 | 100 | ||
Gram-negative E. coli |
25922 | 2 | 2 | 16˜32 | 32 | 16 | 16 | 4 | 4˜8 | 4˜8 | 8 | >32 | >32 |
S. enterica Serovar enteritidis | 13076 | 1 | 1 | 16 | 16 | 4 | 4˜8 | 2 | 2 | 4 | 4 | >32 | >32 |
K. pneumoniae | 13883 | 2 | 2 | 16 | 32 | 8 | 16 | 2 | 2 | 4 | 4 | >32 | >32 |
Gram-positive L. monocytogenes |
19115 | 2 | 2 | 16˜32 | 32 | 4˜8 | 8˜16 | 2 | 2 | 2˜4 | 4 | >32 | >32 |
S. aureus | 25923 | 0.5 | 2 | 8˜16 | >32 | 8 | 16 | 2 | 2 | 2˜4 | 4 | >32 | >32 |
S. aureus (MRSA)1 | BAA-39 | 1˜2 | 1˜2 | 32 | >32 | 4˜8 | 16 | 2 | 2˜4 | 4 | 4 | >32 | >32 |
S. aureus (MRSA) | 43300 | 1 | 1˜2 | 32 | >32 | 4˜8 | 16 | 2 | 2 | 2 | 4 | >32 | >32 |
Mid-log phase bacteria (5 × 105 CFU/ml) were incubated overnight with serial 2-fold dilutions of each peptide in the assay medium containing 20% TSB, 25 mM NaHCO3 and 1 mM NaH2PO4 in the presence or absence of 100 mM NaCl (shown, respectively, as 0 or 100 in the heading line). The MIC value of individual peptides against each bacterial strain was determined as the peptide concentration that gave no visible bacterial growth after overnight incubation. The experiments were repeated at least 3 times and the ranges of MICs are presented. MRSA = Methicillin-resistant S. aureus.
As compared with fowlicidin-2(1–14), fowlicidin-2(1–15) and fowlicidin-2(1–18) with inclusion of additional positively charged residues in the central kink region of the parent peptide showed a gradual increase in antibacterial potency (table 3). This is consistent with earlier observations that a simultaneous increase in cationicity and α-helicity is often directly correlated with antibacterial efficacy [10, 11]. Fowlicidin-2(1–18) with a concurrent increase of +3 in the net charge and 18% in the α-helical content exhibited 8- to 16-fold enhancement in bactericidal efficiency, as compared with fowlicidin-2(1–14). In fact, the MIC values of fowlicidin-2(1–18) approached those of the parent peptide, with only ≤2-fold difference against all bacteria tested (table 3). These results demonstrated the critical involvement of the 4 amino acids in the bending region from Arg15 to Arg18 in killing bacteria.
Relative to fowlicidin-2(19–31), fowlicidin-2(15–31) containing additional residues from Arg15 to Arg18 also demonstrated significant antibacterial activities, with only 2- to 4-fold reductions in MIC as compared with the parent peptide. These results further confirmed that the 4-amino-acid segment from Arg15 to Arg18 in the central kink region is of vital importance in maintaining the bactericidal activity of fowlicidin-2.
Many antimicrobial peptides show a reduced antibacterial activity in the presence of serum or physiological concentrations of NaCl [6, 7, 8, 34]. However, none of the fowlicidin-2 analogs displayed >2-fold reduction in MIC in the presence of 100 mM NaCl (table 3). It is particularly true with fowlicidin-2(1–18) and fowlicidin-2(15–31), whose antibacterial activities were largely unaffected by salt. The effect of serum on the antibacterial potency of peptides was also tested against S. aureus ATCC 29523 by a radial diffusion assay [29, 30] using 0.5 μg/well of each peptide in the presence and absence of 20 or 50% human serum. As shown in figure 4, serum did not affect the antibacterial activity of the parent peptide or fowlicidin-2(15–31), but inhibited the activities of 3 C-terminal deletion analogs, namely fowlicidin-2(1–14), fowlicidin-2(1–15) and fowlicidin-2(1–18). Because of different sensitivity to serum, fowlicidin-2(1–18) may only be appropriate for topical applications, whereas fowlicidin-2(15–31) appears to be suitable for both topical and systemic administrations.
Permeabilization of Bacterial Cytoplasmic Membrane by Fowlicidin-2 and Its Analogs
Electrostatic interaction with and subsequent disruption of bacterial membranes is a common mode of action for most antimicrobial peptides [1, 4, 5]. The ability of fowlicidin-2 and its analogs to permeabilize the inner membranes of bacteria was assessed by using 0.5 MIC of each peptide and E. coli strain ML-35p, as previously described [21, 28]. As shown in figure 5, full-length fowlicidin-2 permeabilized E. coli inner membrane quickly in a time-dependent fashion, with permeabilization occurring almost immediately upon contact of the peptide with the bacteria and the peak level being reached within 50–60 min, which was consistent with our earlier time-kill assay that showed fowlicidin-2 achieved maximum bacterial killing within 30–60 min of incubation [20].
These results also suggested that physical membrane disruption is the major mechanism of bacterial killing by fowlicidin-2. In agreement with the broth microdilution assay (table 3) and the radial diffusion assay (fig. 4), salt did not affect the killing kinetics of fowlicidin-2 (fig. 5).
All 3 C-terminal deletion analogs at 0.5 MIC showed a significant delay in bacterial membrane permeabilization, which did not occur until approximately 20 min for fowlicidin-2(1–14), 10–15 min for fowlicidin-2(1–15) and around 5 min for fowlicidin-2(1–18) (fig. 5), indicating that the N-terminal α-helical segment alone is not efficient in membrane interaction. Peak membrane perturbation was also delayed by 50–60 min for fowlicidin-2 (1–14) and fowlicidin-2(1–15), and by 10–20 min for fowlicidin-2(1–18) in the absence of salt (data not shown). Presence of salt further delayed membrane permeabilization for all 3 analogs with fowlicidin-2(1–14) and fowlicidin-2(1–15) remaining largely inactive within 1 h (fig. 5). A comparison among 3 C-terminal deletion analogs suggested that cationicity and α-helicity are positively correlated with the kinetics of membrane interaction and permeabilization with and without salt (fig. 5).
Two N-terminal deletion analogs, fowlicidin-2(15–31) and fowlicidin-2(19–31), also showed time-dependent membrane lysis of E. coli (fig. 5), indicating that, in contrast to the N-terminal α-helix, the C-terminal α-helix alone appears to be capable of interacting and permeabilizing bacterial membranes. Impressively, fowlicidin-2(15–31) with inclusion of the 4 amino-acid segment from Arg15 to Arg18 showed similar kinetics of membrane permeabilization to the full-length peptide and, furthermore, such an activity was not affected by salt (fig. 5). Collectively, these observations confirmed that the central cationic kink region is critical in mediating salt-resistant interactions between peptides and bacterial membranes.
Cytotoxicity of Fowlicidin-2 and Its Analogs
To identify the region(s) that are involved in cytotoxicity, fowlicidin-2 and its analogs were tested for their toxicities to human erythrocytes and colonic epithelial Caco-2 cells, as previously described [20, 21]. The full-length fowlicidin-2 peptide displayed a noticeable, dose-dependent hemolytic activity. At 200 μM, fowlicidin-2 lysed 80 and 100% of erythrocytes in the presence (fig. 6a) and absence (fig. 6b) of 10% FBS, respectively. Remarkably, all 3 C-terminal deletion analogs and fowlicidin-2(19–31) showed essentially no hemolysis even at 200 μM, regardless of serum (fig. 6a, b). Fowlicidin-2(15–31), when applied at 200 μM, also lost hemolytic activity in the presence of serum (fig. 6a), and only exhibited 30% of lysis in the absence of serum (fig. 6b).
As for Caco-2 cells, the full-length peptide showed 100% killing in the presence of 10% FBS and 30% killing without FBS, whereas all analogs lost their toxicity significantly. Fowlicidin-2(1–14), fowlicidin-2(1–15) and fowlicidin-2(19–31) caused only a negligible degree of cell death when 100 μM was used with and without serum (fig. 6c). Fowlicidin-2(1–18) and fowlicidin-2(15–31) caused 15 and 55% cell death at 100 μM without serum, respectively, whereas serum reduced the cytotoxicity of both peptides to a minimum (8%).
LPS-Neutralizing Activities of Fowlicidin-2 and Its Analogs
We have shown that fowlicidin-2 is capable of binding to LPS and further blocking LPS-induced inflammatory gene expression in RAW264.7 mouse macrophage cells [20]. To further map the region(s) responsible for the LPS-neutralizing activity, RAW264.7 cells were stimulated in serum-free medium for 24 h with 0.1 μg/ml of LPS in the presence or absence of 20 μM of fowlicidin-2 and its analogs. The concentrations of 2 common proinflammatory mediators, namely TNF-α and NO, were measured in cell culture supernatants. Consistent with our earlier observation [20], full-length fowlicidin-2 displayed potent LPS-neutralizing activity, with >95% inhibition in TNF-α production (fig. 7a). Two analogs containing the N-terminal α-helix [fowlicidin-2(1–14) and fowlicidin-2(1–15)] also suppressed LPS-induced TNF-α production by 40–55%, suggesting that the N-terminal α-helix constitutes an LPS binding and neutralization site. A similar trend in inhibiting NO production was also observed with fowlicidin-2(1–14) and fowlicidin-2(1–15) (fig. 7b). As expected, inclusion of cationic residues with the N-terminal α-helix [fowlicidin-2(1–18)] potentiated the binding and neutralization of anionic LPS, particularly in suppression of NO production.
However, the analog containing entirely the C-terminal α-helix [fowlicidin-2(19–31)] showed minimum inhibition of LPS-induced production of TNF-α and NO (fig. 7), indicating that, in contrast to the N-terminal α-helix, the C-terminal α-helix alone is not sufficient for LPS binding and neutralization. The failure of fowlicidin-2(19–31) to interact with LPS is likely due to the fact that this segment is relatively hydrophobic, with a net charge of +2, whereas the N-terminal 14 residues are amphipathic, with a net charge of +5. However, inclusion of the cationic, 4 amino-acid segment with the C-terminal α-helix [fowlicidin-2(15–31)] gave rise to the most suppressive activity in TNF-α and NO production, implying the central kink region is critical in mediating the binding of cationic peptides to anionic LPS. Thus, the segment containing residues 15–31 constitutes the second LPS binding and neutralization site, consistent with our earlier prediction that the full-length fowlicidin-2 is composed of at least 2 LPS-binding sites [20].
The inclusion of 10% FBS in the cell culture medium suppressed LPS-neutralizing activity for all peptide analogs with nearly complete loss of the NO inhibitory activity, except for fowlicidin-2(15–31), which inhibited LPS-induced NO production by approximately 20% in the presence of serum (fig. 7b). The relative resistance of fowlicidin-2(15–31) to serum is also in agreement with its maintenance of the antibacterial activity in human or chicken serum (fig. 4).
It is notable that at 20 μM neither fowlicidin-2 nor its analogs exerted noticeable toxicity or morphological changes on RAW264.7 cells with or without inclusion of 10% FBS in culture medium. Furthermore, no peptide analogs alone caused alterations in TNF-α and NO levels when incubated with RAW264.7 cells (data not shown), suggesting that the inhibitory effect was specifically due to LPS-peptide interactions.
Discussion
An alignment of over 150 α-helical antimicrobial host defense peptides revealed that many consist of a short central hinge sequence, due to the presence of a glycine [10]. The presence or introduction of such a hinge in the helix has been shown to increase the flexibility of the α-helix and in many cases to be desirable, attenuating the toxicity of peptides to host cells while maintaining comparable antimicrobial potency with the peptides with no hinge [10, 11, 35]. A similar glycine-induced hinge is also present near the center of fowlicidins 1 and 3 [21, 22]. In contrast, fowlicidin-2 consists primarily of 2 short α-helices (residues 6–12 and 23–27), connected by an extensive kink region (residues 13–20) induced by Pro19 (fig. 3). The N-terminal α-helix adopts a typical amphipathic structure, whereas the C-terminal helix is more hydrophobic. The central kink region of fowlicidin-2 has a strong positive charge and contains 5 cationic residues. Fowlicidins 1 and 3, on the other hand, are composed of 2 hydrophobic α-helices separated by a slight glycine-induced kink [21, 22]. Most of the cationic residues of fowlicidins 1 and 3 are instead concentrated at either end [21, 22]. Such structural differences between fowlicidin-2 and other α-helical antimicrobial peptides suggest that fowlicidin-2 might be functionally different from fowlicidins 1 and 3 and other peptides.
By studying several fowlicidin-2 analogs with deletions of certain structural components, we have been able to determine the significance of the 2 α-helices and the central kink region in the antibacterial, cytotoxic and LPS-neutralizing activities. Because fowlicidin-2(1–14) and fowlicidin-2(19–31) displayed no toxicity at all against either human erythrocytes or epithelial cells (fig. 6), it is obvious that neither the N- or C-terminal α-helix alone is sufficient in the interaction with and permeabilization of mammalian cell membranes. Therefore, apparent cytotoxicity of the full-length fowlicidin-2 must be caused by the amino acid sequence in the central kink region. However, the 2 analogs containing Arg15 to Arg18 [fowlicidin-2(1–18) and fowlicidin-2(15–31)] exhibited substantially reduced cytotoxicities, although they were still higher than those of the peptide analogs containing the α-helix alone. The obvious reduction in toxicity associated with fowlicidin-2(1–18) and fowlicidin-2(15–31) is likely due to the conformational differences of the 4 amino-acid segment (Arg15 to Arg18) in these 2 analogs, as opposed to in the full-length peptide.
We have also revealed that the C-terminal α-helix alone [fowlicidin-2(19–31)] has no antibacterial or LPS-neutralizing activities (table 3, fig. 7). Moreover, the N-terminal α-helix [fowlicidin-2(1–14)] is weakly active against bacteria that have relatively low capacities to neutralize LPS (table 3, fig. 7). These results indicated that neither α-helical segment per se is sufficient to bind LPS and kill bacteria. However, it is interesting to note that both peptides are capable of permeabilizing the cytoplasmic membranes of E. coli ML-35p (fig. 5).
The addition of 4 amino acids in the central bending region (Arg15 to Arg18) to the N- or C-terminal α-helical segment is associated with a significant enhancement in both antibacterial and LPS-neutralizing activities, suggesting that this central segment is critically important in membrane interactions. Given that this segment has a strong positive charge due to the presence of 3 arginines, it is not surprising that this cationic region is capable of promoting the interactions of fowlicidin-2 with anionic LPS and bacterial membranes.
Cationicity, α-helicity and amphipathicity are among the most important physicochemical parameters that dictate the functional properties of α-helical antimicrobial peptides [9, 10, 11]. To a certain degree, these 3 parameters are often positively correlated with the antibacterial activity. Consistent with these observations, a gradual increase in cationicity, α-helicity and amphipathicity among all peptide analogs [fowlicidin-2(1–14), fowlicidin-2(1–15) and fowlicidin-2(1–18)] leads to a gradual enhancement in permeabilization of E. coli inner membranes (fig. 5), LPS neutralization (fig. 7) and antibacterial potency (table 3).
In summary, a comparison of the functional properties of all peptide analogs with those of the full-length fowlicidin-2 has enabled us to identify short analogs that have better therapeutic potentials. Although fowlicidin-2(1–14), fowlicidin-2(1–15) and fowlicidin-2(19–31) lack cytotoxicity, their antibacterial and LPS-neutralizing activities are disappointing and are indicative of little clinical utility. On the other hand, fowlicidin-2(1–18) and fowlicidin-2(15–31) have an MIC of 2–4 μM against most bacteria tested (table 3), with a minimum toxicity to human erythrocytes or intestinal Caco-2 cells even at 100 μM in the presence of serum (fig. 6). Both fowlicidin-2(1–18) and fowlicidin-2(15–31) are capable of blocking LPS-induced proinflammatory responses in RAW264.7 cells at levels that approach that of the parent peptide (fig. 7). Moreover, these 2 short peptide analogs kill bacteria irrespective of salt, and the antibacterial activity of fowlicidin-2(15–31) is not affected by serum (table 3, fig. 4). Therefore, both peptides represent better candidates with a significant improvement in the therapeutic window and safety, as compared with the parent peptide. The in vivo toxicity and antibacterial and anti-LPS efficacy of fowlicidin-2(1–18) and fowlicidin-2(15–31) are currently under evaluation.
Acknowledgment
We thank Robert Gallo of University of California, San Diego, for kindly providing E. coli strain ML-35p for use in the inner membrane permeabilization assays. We also thank Steve Hartson of Oklahoma State University for helping with mass spectrometry. We are grateful to Ulrich Melcher for his critical reading of the manuscript. This work was supported by grants from the NIH (S10-RR022392), NSF (MCB0236039 and EPS0236913), USDA CSREES (2008-35204-04544), Kansas State University COBRE and Targeted Excellence Programs, Oklahoma Center for the Advancement of Science and Technology (HR03-146, HR07-113 and AR07.2-087) and Oklahoma Agricultural Experiment Station (H-2507).
References
- 1.Zasloff M. Antimicrobial peptides of multicellular organisms. Nature. 2002;415:389–395. doi: 10.1038/415389a. [DOI] [PubMed] [Google Scholar]
- 2.Hancock RE, Diamond G. The role of cationic antimicrobial peptides in innate host defences. Trends Microbiol. 2000;8:402–410. doi: 10.1016/s0966-842x(00)01823-0. [DOI] [PubMed] [Google Scholar]
- 3.Selsted ME, Ouellette AJ. Mammalian defensins in the antimicrobial immune response. Nat Immunol. 2005;6:551–557. doi: 10.1038/ni1206. [DOI] [PubMed] [Google Scholar]
- 4.McPhee JB, Hancock RE. Function and therapeutic potential of host defence peptides. J Pept Sci. 2005;11:677–687. doi: 10.1002/psc.704. [DOI] [PubMed] [Google Scholar]
- 5.Oren Z, Shai Y. Mode of action of linear amphipathic alpha-helical antimicrobial peptides. Biopolymers. 1998;47:451–463. doi: 10.1002/(SICI)1097-0282(1998)47:6<451::AID-BIP4>3.0.CO;2-F. [DOI] [PubMed] [Google Scholar]
- 6.Lee IH, Cho Y, Lehrer RI. Effects of pH and salinity on the antimicrobial properties of clavanins. Infect Immun. 1997;65:2898–2903. doi: 10.1128/iai.65.7.2898-2903.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Ciornei CD, Sigurdardottir T, Schmidtchen A, Bodelsson M. Antimicrobial and chemoattractant activity, lipopolysaccharide neutralization, cytotoxicity, and inhibition by serum of analogs of human cathelicidin LL-37. Antimicrob Agents Chemother. 2005;49:2845–2850. doi: 10.1128/AAC.49.7.2845-2850.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Bartlett KH, McCray PB, Jr, Thorne PS. Reduction in the bactericidal activity of selected cathelicidin peptides by bovine calf serum or exogenous endotoxin. Int J Antimicrob Agents. 2004;23:606–612. doi: 10.1016/j.ijantimicag.2004.02.018. [DOI] [PubMed] [Google Scholar]
- 9.Chen Y, Mant CT, Farmer SW, Hancock RE, Vasil ML, Hodges RS. Rational design of alpha-helical antimicrobial peptides with enhanced activities and specificity/therapeutic index. J Biol Chem. 2005;280:12316–12329. doi: 10.1074/jbc.M413406200. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Tossi A, Sandri L, Giangaspero A. Amphipathic, alpha-helical antimicrobial peptides. Biopolymers. 2000;55:4–30. doi: 10.1002/1097-0282(2000)55:1<4::AID-BIP30>3.0.CO;2-M. [DOI] [PubMed] [Google Scholar]
- 11.Dathe M, Wieprecht T. Structural features of helical antimicrobial peptides: their potential to modulate activity on model membranes and biological cells. Biochim Biophys Acta. 1999;1462:71–87. doi: 10.1016/s0005-2736(99)00201-1. [DOI] [PubMed] [Google Scholar]
- 12.Epand RM, Vogel HJ. Diversity of antimicrobial peptides and their mechanisms of action. Biochim Biophys Acta. 1999;1462:11–28. doi: 10.1016/s0005-2736(99)00198-4. [DOI] [PubMed] [Google Scholar]
- 13.Zanetti M, Gennaro R, Skerlavaj B, Tomasinsig L, Circo R. Cathelicidin peptides as candidates for a novel class of antimicrobials. Curr Pharm Des. 2002;8:779–793. doi: 10.2174/1381612023395457. [DOI] [PubMed] [Google Scholar]
- 14.Bals R, Wilson JM. Cathelicidins: a family of multifunctional antimicrobial peptides. Cell Mol Life Sci. 2003;60:711–720. doi: 10.1007/s00018-003-2186-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Zaiou M, Gallo RL. Cathelicidins, essential gene-encoded mammalian antibiotics. J Mol Med. 2002;80:549–561. doi: 10.1007/s00109-002-0350-6. [DOI] [PubMed] [Google Scholar]
- 16.Lehrer RI, Ganz T. Cathelicidins: a family of endogenous antimicrobial peptides. Curr Opin Hematol. 2002;9:18–22. doi: 10.1097/00062752-200201000-00004. [DOI] [PubMed] [Google Scholar]
- 17.Cirioni O, Giacometti A, Ghiselli R, Bergnach C, Orlando F, Silvestri C, Mocchegiani F, Licci A, Skerlavaj B, Rocchi M, Saba V, Zanetti M, Scalise G. LL-37 protects rats against lethal sepsis caused by Gram-negative bacteria. Antimicrob Agents Chemother. 2006;50:1672–1679. doi: 10.1128/AAC.50.5.1672-1679.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Giacometti A, Cirioni O, Ghiselli R, Bergnach C, Orlando F, D'Amato G, Mocchegiani F, Silvestri C, Del Prete MS, Skerlavaj B, Saba V, Zanetti M, Scalise G. The antimicrobial peptide BMAP-28 reduces lethality in mouse models of staphylococcal sepsis. Crit Care Med. 2004;32:2485–2490. doi: 10.1097/01.ccm.0000148221.09704.22. [DOI] [PubMed] [Google Scholar]
- 19.Giacometti A, Cirioni O, Ghiselli R, Mocchegiani F, D'Amato G, Circo R, Orlando F, Skerlavaj B, Silvestri C, Saba V, Zanetti M, Scalise G. Cathelicidin peptide sheep myeloid antimicrobial peptide-29 prevents endotoxin-induced mortality in rat models of septic shock. Am J Respir Crit Care Med. 2004;169:187–194. doi: 10.1164/rccm.200307-971OC. [DOI] [PubMed] [Google Scholar]
- 20.Xiao Y, Cai Y, Bommineni YR, Fernando SC, Prakash O, Gilliland SE, Zhang G. Identification and functional characterization of three chicken cathelicidins with potent antimicrobial activity. J Biol Chem. 2006;281:2858–2867. doi: 10.1074/jbc.M507180200. [DOI] [PubMed] [Google Scholar]
- 21.Bommineni YR, Dai H, Gong YX, Soulages JL, Fernando SC, Desilva U, Prakash O, Zhang G. Fowlicidin-3 is an alpha-helical cationic host defense peptide with potent antibacterial and lipopolysaccharide-neutralizing activities. FEBS J. 2007;274:418–428. doi: 10.1111/j.1742-4658.2006.05589.x. [DOI] [PubMed] [Google Scholar]
- 22.Xiao Y, Dai H, Bommineni YR, Soulages JL, Gong YX, Prakash O, Zhang G. Structure-activity relationships of fowlicidin-1, a cathelicidin antimicrobial peptide in chicken. FEBS J. 2006;273:2581–2593. doi: 10.1111/j.1742-4658.2006.05261.x. [DOI] [PubMed] [Google Scholar]
- 23.Sreerama N, Venyaminov SY, Woody RW. Estimation of protein secondary structure from circular dichroism spectra: inclusion of denatured proteins with native proteins in the analysis. Anal Biochem. 2000;287:243–251. doi: 10.1006/abio.2000.4879. [DOI] [PubMed] [Google Scholar]
- 24.Wüthrich K. New York: Wiley; 1986. NMR of Proteins and Nucleic Acids. [Google Scholar]
- 25.Wüthrich K, Billeter M, Braun W. Pseudo-structures for the 20 common amino acids for use in studies of protein conformations by measurements of intramolecular proton-proton distance constraints with nuclear magnetic resonance. J Mol Biol. 1983;169:949–961. doi: 10.1016/s0022-2836(83)80144-2. [DOI] [PubMed] [Google Scholar]
- 26.Brunger AT, Adams PD, Clore GM, DeLano WL, Gros P, Grosse-Kunstleve RW, Jiang JS, Kuszewski J, Nilges M, Pannu NS, Read RJ, Rice LM, Simonson T, Warren GL. Crystallography and NMR system: a new software suite for macromolecular structure determination. Acta Crystallogr D Biol Crystallogr. 1998;54:905–921. doi: 10.1107/s0907444998003254. [DOI] [PubMed] [Google Scholar]
- 27.Nicholls A, Sharp KA, Honig B. Protein folding and association: insights from the interfacial and thermodynamic properties of hydrocarbons. Proteins. 1991;11:281–296. doi: 10.1002/prot.340110407. [DOI] [PubMed] [Google Scholar]
- 28.Dorschner RA, Lopez-Garcia B, Peschel A, Kraus D, Morikawa K, Nizet V, Gallo RL. The mammalian ionic environment dictates microbial susceptibility to antimicrobial defense peptides. FASEB J. 2006;20:35–42. doi: 10.1096/fj.05-4406com. [DOI] [PubMed] [Google Scholar]
- 29.Steinberg DA, Lehrer RI. Designer assays for antimicrobial peptides: disputing the ‘one-size-fits-all’ theory. Methods Mol Biol. 1997;78:169–186. doi: 10.1385/0-89603-408-9:169. [DOI] [PubMed] [Google Scholar]
- 30.Turner J, Cho Y, Dinh NN, Waring AJ, Lehrer RI. Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils. Antimicrob Agents Chemother. 1998;42:2206–2214. doi: 10.1128/aac.42.9.2206. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Laskowski RA, Rullmannn JA, MacArthur MW, Kaptein R, Thornton JM. AQUA and PROCHECK-NMR: programs for checking the quality of protein structures solved by NMR. J Biomol NMR. 1996;8:477–486. doi: 10.1007/BF00228148. [DOI] [PubMed] [Google Scholar]
- 32.Yu K, Park K, Kang SW, Shin SY, Hahm KS, Kim Y. Solution structure of a cathelicidin-derived antimicrobial peptide, CRAMP as determined by NMR spectroscopy. J Pept Res. 2002;60:1–9. doi: 10.1034/j.1399-3011.2002.01968.x. [DOI] [PubMed] [Google Scholar]
- 33.Tack BF, Sawai MV, Kearney WR, Robertson AD, Sherman MA, Wang W, Hong T, Boo LM, Wu H, Waring AJ, Lehrer RI. SMAP-29 has two LPS-binding sites and a central hinge. Eur J Biochem. 2002;269:1181–1189. doi: 10.1046/j.0014-2956.2002.02751.x. [DOI] [PubMed] [Google Scholar]
- 34.Travis SM, Anderson NN, Forsyth WR, Espiritu C, Conway BD, Greenberg EP, McCray PB Jr., Lehrer RI, Welsh MJ, Tack BF. Bactericidal activity of mammalian cathelicidin-derived peptides. Infect Immun. 2000;68:2748–2755. doi: 10.1128/iai.68.5.2748-2755.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Sawai MV, Waring AJ, Kearney WR, McCray PB, Jr, Forsyth WR, Lehrer RI, Tack BF. Impact of single-residue mutations on the structure and function of ovispirin/novispirin antimicrobial peptides. Protein Eng. 2002;15:225–232. doi: 10.1093/protein/15.3.225. [DOI] [PubMed] [Google Scholar]