Abstract
Among the mechanisms put-up by the host to defend against invading microorganisms, antimicrobial peptides represent the first line. In different species of mammals, the cathelicidin family of antimicrobial peptides AMPs has been identified, and in humans, LL-37 is the only type of cathelicidin identified. LL-37 has many different biological activities, such as regulation of responses to inflammation, besides its lipopolysaccharide (LPS)-neutralizing and antimicrobial and activities. Recently, employing a murine septic model that involves cecal ligation and puncture (CLP), we examined the effect of LL-37. The results indicated that LL-37 exhibits multiple protective actions on septic mice; firstly, the survival of CLP mice was found to be improved by LL-37 by the suppression of the macrophage pyroptosis that induces the release of pro-inflammatory cytokines (such as IL-1β) and augments inflammatory reactions in sepsis; secondly, the release of neutrophil extracellular traps (NETs), which have potent bactericidal activity, is enhanced by LL-37, and protects mice from CLP-induced sepsis; thirdly, LL-37 stimulates neutrophils to release antimicrobial microvesicles (ectosomes), which improve the pathological condition of sepsis. These findings indicate that LL-37 protects CLP septic mice through at least three mechanisms, i.e., the suppression of pro-inflammatory macrophage pyroptosis and the release of antimicrobial NETs (induction of NETosis) and ectosomes from neutrophils. Thus, LL-37 can be a potential therapeutic candidate for sepsis due to its multiple properties, including the modulation of cell death (pyroptosis and NETosis) and the release of antimicrobial NETs and ectosomes as well as its own bactericidal and LPS-neutralizing activities.
Keywords: antimicrobial peptide, cathelicidin, sepsis, pyroptosis, NETs, ectosome
1. Introduction
Sepsis is a frequent cause of mortality in the noncoronary intensive care unit (ICU). Sepsis results from harmful or detrimental host response to infection and it is a systemic host response [1,2]. Multiple organ failure, which mostly results from the excessive production of pro-inflammatory cytokines, arises because of the dysregulated inflammatory/immune responses during sepsis. Recent statistics indicate a decrease in sepsis mortality in hospitals, probably due to advances in patient care. Unfortunately, clinical trials revealed that many of the therapeutic approaches with anti-inflammatory cytokines are not effective [2,3]. Therefore, it is necessary to develop an effective and novel approach for sepsis treatment [2,3]. Many recent studies addressed the host cell death mechanisms, which likely underlie the dysregulated inflammatory/immune responses in sepsis [4,5,6].
Macrophages and dendritic cells, which are found in bacterial infection, undergo caspase-1-dependent cell death, called pyroptosis [7]. The cells undergoing pyroptosis release pro-inflammatory cytokines, such as interleukin (IL)-1β and IL-18, extracellularly [7,8]. IL-1β not only enhances both systemic and local inflammatory/immune responses [9] but also leads to tissue injury in sepsis, by synergistically acting along with other cytokines [10].
Neutrophils are the most abundant leukocytes and as an important part of the innate immune system in humans, protect the host against invading microorganisms [11,12]. Upon stimulation, neutrophils go through NETosis (a kind of programmed cell death) and trigger the release of neutrophil extracellular traps (NETs) [13]. NETs are capable of trapping microorganisms and exerting anti-bacterial activity through the NET-associated components’ action (e.g., DNA, histone and granule-derived proteins and peptides) [14,15]. Furthermore, stimulated neutrophils extracellularly release microvesicles (0.1-1.0 μm in diameter), called ectosomes, during the inflammatory response [16,17]. Ectosomes contain functional proteins of neutrophils [17,18], and exhibit bacteriostatic potential [19]. Notably, the ectosome level is reported to be augmented in surviving patients of sepsis [20,21].
Antimicrobial peptides are evolutionarily conserved among various species (vertebrates as well as invertebrates, the latter encompassing arthropods) [22,23]. These are also known as host defense peptides and take part in the innate immune response by exhibiting antimicrobial activities against both Gram-negative and -positive bacteria, and also viruses and fungi. Antimicrobial peptides (AMPs) belong to two main families, the defensins and cathelicidins. Besides acting as antimicrobials, AMPs are also capable of enhancing immunity by acting on host cells as immunomodulators to link innate and adaptive immunity [22,23] (Figure 1).
Nearly 30 different cathelicidin types have been described in various species of mammals. In humans, however, there is only one type of cathelicidin, known as the human cationic antibacterial protein of 18 kDa (hCAP18). The hCAP18 has a C-terminal mature antibacterial peptide LL-37, which consists of 37 amino acid residues with the first two leucine residues (L1LGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES37) and has been found mostly in epithelial cells and neutrophils [24,25,26]. Besides having antimicrobial and lipopolysaccharide (LPS)-neutralizing activities [27,28], LL-37 also shows many biological activities, such as regulation of responses to inflammation [26,29]. Importantly, we demonstrated before that in neutrophils the spontaneous apoptosis is inhibited by LL-37 through purinergic receptor P2X7 as well as formyl-peptide receptor-like 1 (FPRL1) [30]. We also showed that LL-37, by neutralizing the action of LPS, decreases the apoptosis of endothelial cells induced by LPS [31]. These above results suggested that cell death is modulated by LL-37. Recently, we assessed the influence of LL-37 in a murine cecal ligation and puncture (CLP) sepsis model and revealed that the survival of CLP septic mice is improved by the administration of LL-37, which also caused the suppression of macrophage pyroptosis [32] and the release of NETs [33] and ectosomes [34] from neutrophils. Thus, in this article, based on our recent findings, the therapeutic potential of LL-37 on a murine sepsis model is reviewed.
2. Inhibition of the Macrophage Pyroptosis and Improvement of the CLP Mouse Survival by LL-37
Pyroptosis is a cell death pathway that is dependent on caspase-1 and occurs mostly in dendritic cells and macrophages, in association with the release of pro-inflammatory cytokines (IL-1β and IL-18) [7] (Figure 2). In addition, membrane perforation leads to cytosolic content release, which augments the inflammatory reactions [7,35]. Two separate stimuli, microbial-pathogen-associated molecular patterns (PAMPs) (including bacterial lipoproteins and LPS) and endogenous damage-associated molecular patterns (DAMPs) (for example, ATP and uric acid) are required for inducing pyroptosis [8,36]. These two stimuli trigger the formation of an inflammasome, a multi-protein complex (typically including caspase-1, NALP3 (NACHT domain-, leucine-rich repeat-, and pyrin domain (PYD)-containing protein 3) and ASC (apoptosis-associated speck-like protein containing a CARD)), which facilitates the conversion of pro-caspase-1 to active caspase-1 [37]. Subsequently, the activated caspase-1 catalyzes the cleavage of pro-IL-1β and pro-IL-18 to release IL-1β and IL-18, respectively, and N-terminal fragments of Gasdermin D, generated by activated caspase-1, oligomerize and create pores in the plasma membrane, leading to cell death (pyroptosis) [8,37]. It is important to note that caspase-1 genetic deletion leads to suppressed IL-1β levels and confers a protective effect on murine sepsis models and improves the survival of mice [38,39]. Therefore, the activation of caspase-1 and the resultant pyroptosis plays a significant part in sepsis pathogenesis and mortality [7,35]. Recently, we described that the LPS/ATP-induced pyroptosis as well as production of IL-1β are suppressed by LL-37 in macrophages by both curtailing the effect of LPS on CD14/TLR4 (Toll-like receptor 4) and preventing the P2X7 response to ATP in vitro [40] (Figure 3). Accordingly, we hypothesize that LL-37 exhibits protective effects in the murine septic model by inhibiting the pyroptosis of macrophages in vivo [32].
The results indicated that the administration of LL-37 (2 μg/mouse) intravenously, to the CLP septic mice, improves their survival (Figure 4), and the effect was dose-dependent, since LL-37 (1 μg/mouse and 2 μg/mouse) improved the survival rate to 14.3% and 36.4%, respectively [32]. Interestingly, the pyroptosis of peritoneal macrophages and the CLP-induced caspase-1 activation are inhibited by LL-37 (Figure 5). In addition, the levels of inflammatory cytokines (IL-1β, IL-6 and TNF-α) in both the peritoneal fluids and sera were reduced by LL-37, which also blocked the peritoneal macrophages activation (as assessed by the elevated intracellular levels of IL-1β, IL-6 and TNF-α). Finally, LL-37 decreased the bacterial load in both the peritoneal fluids as well as blood samples (Figure 6). Thus, our work indicates that LL-37 administration improves the survival of CLP septic mice by inhibiting activation and pyroptosis of macrophages, production of inflammatory cytokines, and bacterial growth.
However, the mechanism by which LL-37 prevents pyroptosis and the caspase-1 activation in the CLP model, in vivo, is not known. In addition, LL-37, due to its antimicrobial activity, may protect the CLP septic mice by lowering the burden of bacteria in the blood and by decreasing the pyroptosis of macrophages.
Furthermore, it has been reported that LPS, a major component of bacteria, is elevated in the sera and peritoneal fluids of sepsis models [42]. Moreover, dead/dying cells release ATP extracellularly, and thus it is increased in the plasma of CLP mice [43] and peritoneal fluid of E. coli-induced septic mice [44]. Importantly, we earlier described that LPS and ATP together induce macrophage pyroptosis, which is blocked by LL-37 through both LPS neutralization and inhibition of the P2X7 activation by ATP [40]. Thus, we propose that in the CLP septic mice, LPS and ATP are the primary inducers of caspase-1 activation and pyroptosis, as in the case of other sepsis models [45,46], and that LL-37 prevents the actions of LPS and ATP, both in vivo and in vitro, thereby inhibiting pyroptosis (caspase-1 activation) and improving the survival of CLP mice (Figure 3).
3. LL-37 induces NET Release from Neutrophils and Reduces the Inflammatory Response in CLP Mice
Neutrophils function as the first line of host defense against invading microorganisms [11,12]; and they exert antimicrobial activity through phagocytosis and the subsequent killing of microorganisms by the actions of reactive oxygen species and antimicrobial granule proteins or peptides. Moreover, upon stimulation, neutrophils undergo NETosis and release NETs [13] (Figure 7). NETs are capable of trapping the microorganisms and by the action of NET-associated components (DNA, histone and granule proteins and peptides) show anti-bacterial activity [14,15].
As described above, the intravenous administration of LL-37 enhanced the survival of murine CLP sepsis model [32]. Moreover, it is demonstrated that LL-37 induces NET release from neutrophils in vitro [48]. Thus, we hypothesized that LL-37 may induce the release of NETs from neutrophils in vivo and protect mice from CLP-induced sepsis. To test this hypothesis, we evaluated the effect of LL-37 on the levels of inflammatory cytokines (TNF-α and IL-1β), triggering receptor expressed on myeloid cells (TREM)-1 and DAMPs (histone-DNA complex and high-mobility group protein 1 (HMGB1)) as well as NETs (determined as myeloperoxidase (MPO)-DNA complex) in plasma and peritoneal fluids of CLP septic mice [33].
The findings suggested that LL-37 administration, intravenously, prevented the upsurge in DAMPs as well as TNF-α, IL-1β and soluble TREM-1 in peritoneal fluids and plasma (Figure 8 and Figure 9). Interestingly, LL-37 significantly reduced the increase in the number of peritoneal polymorphonuclear cells (neutrophil) during sepsis. In addition, LL-37 lowered the microbial burden in circulation and also in peritoneal fluids. Importantly, LL-37 administration significantly increased the level of NETs in plasma and peritoneal fluids of CLP mice (Figure 10). In addition, we established in vitro that LL-37 directly stimulates bone marrow-derived neutrophils to release NETs and the NETs possess the bactericidal activity (Figure 11).
TREM-1 is expressed mainly on monocytes/macrophages and neutrophils and is recognized as a novel receptor, which participates in the amplification of inflammatory responses in sepsis [49]. Moreover, membrane-anchored TREM-1 is shed by metalloproteinases as a soluble form of TREM-1 [50], and soluble TREM-1 can be used as a potential marker for identifying clinically ill patients with infection [51].
DAMPs are host cell-derived biomolecules that function as potent activators of innate immune system initiating systemic inflammatory response syndrome (SIRS), multiple organ failure and death in sepsis [52]. DAMPs consist of nuclear or cytosolic molecules, such as DNA, histone, HMGB1 and ATP, and are released outside the cells following tissue injury or cell death [8,53].
Based on these findings, our observations suggest that LL-37 stimulates the release, in vivo, of bactericidal NETs, thereby suppressing the bacterial growth and improving the inflammatory responses of sepsis, as evidenced by the suppression of inflammatory cytokines, soluble TREM-1 and DAMPs (host cell death) and the change of inflammatory cell number, and protects mice from lethal sepsis [33].
4. LL-37 Stimulates the Release of Antimicrobial Ectosomes from Neutrophils and Improves the Septic Condition
Various host cells release extracellular vesicles including ectosomes (100-1000 nm in diameter) and exosomes (30–150 nm in diameter) that mediate intercellular communications [16,17] (Figure 12). During the inflammatory response, neutrophils release microvesicles, named ectosomes, which bud off from the cell membrane [16,17]. Ectosomes express the cell surface molecules originating from neutrophils such as Ly6G and phosphatidylserine, and contain functional proteins of neutrophils [17,18]. Interestingly, ectosomes released from bacteria-stimulated neutrophils exhibit bacteriostatic potential [19]. Moreover, the ectosome level is reported to be augmented in surviving patients of sepsis [20,21]; thus, ectosomes are speculated to play a protective role in sepsis. Since the survival of a murine CLP sepsis model is improved by LL-37 [32,33], we investigated the mechanisms of LL-37-mediated protective action against sepsis, by addressing the effect of LL-37 on the release of ectosomes in the CLP model [34].
The findings showed that administration of LL-37 enhances the level of ectosomes in the peritoneal exudates and plasma of CLP-operated mice as well as Sham (the same procedure but without ligation and puncture) mice (Figure 13), suggesting that the enhanced level of ectosomes may be associated with the survival of CLP mice. In addition, the bacterial load was decreased in LL-37-injected CLP mice compared with PBS-injected CLP mice; thus, it could be speculated that the enhanced level of ectosomes is associated with the lower bacterial load in LL-37-injected CLP mice. To further confirm the antibacterial activity of ectosomes, we assessed the antibacterial activity of ectosome fractions isolated from PBS- and LL-37-injected CLP mice. Importantly, both fractions possessed the antibacterial potential, and interestingly, the fraction from LL-37-injected CLP mice displayed higher potential than that from PBS-injected CLP mice (Figure 14a). These observations suggest that LL-37 elevates the level of ectosomes with higher antibacterial potential, thereby reducing the bacterial load in CLP mice.
Since neutrophil granule molecules are contained in ectosomes [17,18], we examined the involvement of neutrophil granule molecules in the antibacterial activity of ectosomes. Western blot analysis indicated that the neutrophil granule-derived antimicrobial molecules, such as lactoferrin, MPO and CRAMP (cathelicidin-related antimicrobial peptide, a mouse ortholog of human cathelicidin peptide) were detected in the ectosome fractions isolated from peritoneal exudates of both PBS- and LL-37-injected CLP mice. In addition, the fraction from LL-37-injected CLP mice had increased amounts of these antimicrobial molecules compared with that from PBS-injected CLP mice (Figure 14b). In addition, anti-lactoferrin or anti-CRAMP antibody partially but substantially abrogated the antibacterial activity of ectosome fractions from PBS- and LL-37-injected CLP mice, suggesting the involvement of lactoferrin and CRAMP in the antibacterial potential of ectosomes. Collectively, these findings indicate that LL-37 stimulates the release of ectosomes containing higher amounts of antibacterial molecules (lactoferrin and CRAMP) in CLP mice, which may exert the antibacterial action and reduce the bacterial load, thereby improving the survival of septic mice.
Moreover, we examined whether LL-37 is able to stimulate neutrophils ex vivo, to release ectosomes and whether the administration of ectosomes ameliorates a murine septic CLP model in vivo. Importantly, LL-37 directly activated mouse bone marrow-derived neutrophils, ex vivo, to release ectosomes (Figure 15a). In addition, the LL-37-triggered ectosomes have the antibacterial potential, and the administration of these ectosomes to CLP mice led to improved survival of mice and reduced bacterial load (Figure 15b).
Collectively, these findings indicate that LL-37 stimulates neutrophils to release antibacterial ectosomes, thereby eliminating bacteria, and protecting mice from lethal sepsis.
5. Perspective
Cationic antimicrobial peptides target cell surface anionic lipids such as phosphatidyl glycerol and cardiolipin that are abundant in microorganisms; the action is not receptor-based but involves a less specific interaction with microbial membrane components [54,55]. In contrast, the mammalian cell membrane is mainly composed of electrically neutral phospholipids such as phosphatidylcholine and sphingomyelin, for which the affinity of the antimicrobial peptides is generally low [53]. The simple electrostatic interaction between cationic antimicrobial peptides and microbial membrane lipids provides selective toxicity (bacteria versus mammalian cells) as well as a broad spectrum of antimicrobial activities. Moreover, the development of microbial resistance is assumed to be low, because the target molecules (anionic lipids) are important components conserved among microorganisms, and the molecular recognition between cationic peptides and target molecules is rather lenient [54,55]. In addition, the peptides are small and relatively easy to synthesize. From these points of view, cationic antimicrobial peptides could be promising candidates for new antibiotics with therapeutic value. Moreover, cationic host defense peptides are expected to protect the host against pathogens not only by being directly antimicrobial but also by modulating the immune responses and boosting infection-resolving immunity while dampening potentially harmful pro-inflammatory (septic) responses [56,57,58,59].
However, it should be noted that as cationic antimicrobial peptides act principally via electrostatic attraction, and hydrophobic partitioning into the membrane targets, they could also bind to various host components such as anionic constituents of host cell membranes, leading to potentially harmful side effects on the host [55]. In this context, it has been demonstrated that high concentrations of cationic antimicrobial peptides are occasionally toxic to host cells [26]. Thus, cationic antimicrobial peptides should be cautiously administered in vivo, considering their toxic effects on host cells.
Our studies have revealed that LL-37 exhibits multiple functions in sepsis. Firstly, LL-37 enhances the survival of CLP mice by reducing the macrophage pyroptosis that induces the secretion of pro-inflammatory cytokines (such as IL-1β) and augments inflammatory reactions in sepsis [32]. Secondly, LL-37 induces the release of NETs with potent bactericidal activity and protects mice from CLP-induced sepsis [33]. Thirdly, LL-37 stimulates neutrophils to release antimicrobial ectosomes, which improve murine sepsis [34]. These findings indicate that LL-37 protects CLP septic mice through at least three mechanisms, i.e., the suppression of pro-inflammatory macrophage pyroptosis and the release of antimicrobial NETs (induction of NETosis) and ectosomes from neutrophils. Thus, LL-37 can be a promising candidate as a therapeutic agent for sepsis because of its multiple functions, including modulation of cell death (pyroptosis and NETosis) and release of antimicrobial NETs and ectosomes as well as its own bactericidal and LPS-neutralizing activities (Figure 16). Furthermore, our findings likely open novel paths for designing immunomodulatory peptide drugs, using LL-37 as the lead molecule with multiple actions on the pathogenesis of sepsis.
Acknowledgments
The author is grateful to Zhongshuang Hu and Yumi Kumagai (Department of Host Defense and Biochemical Research, Juntendo University, Graduate School of Medicine), and Hiroshi Hosoda (Department of Molecular Microbiology, Faculty of Life Sciences, Tokyo University of Agriculture) for performing excellent experiments and publishing their data in the journals, described in this review; Niyonsaba François (Atopy Research Center, Juntendo University, Graduate School of Medicine), Kaori Suzuki (Department of Host Defense and Biochemical Research, Juntendo University, Graduate School of Medicine), Taisuke Murakami (Department of Microbiology and Immunology, Gifu University of Medical Science), and Toshiaki Iba (Department of Emergency and Disaster Medicine, Juntendo University, Graduate School of Medicine) the helpful suggestion and discussion.
Author Contributions
I.N. prepared this manuscript by discussing with H.T. and J.R., based on the data already published [32,33,34]. All authors have read and agreed to the published version of the manuscript.
Funding
This research was funded in part by a Grant-in-Aid (grant numbers 23590519, 26460538, 17K08840 and 20K07486) for Scientific Research from Japan Society for the Promotion of Science, and a Grant-in-Aid (grant numbers S0991013 and S1201013) from the Ministry of Education, Culture, Sports, Science and Technology, Japan (MEXT) for the Foundation of Strategic Research Projects in Private Universities.
Conflicts of Interest
The authors declare no conflict of interest.
References
- 1.Singer M., Deutschman C.S., Seymour C.W., Shankar-Hari M., Annane D., Bauer M., Bellomo R., Bernard G.R., Chiche J.D., Coopersmith C.M., et al. The third international consensus definitions for sepsis and septic Shock (Sepsis-3) JAMA. 2016;315:801–810. doi: 10.1001/jama.2016.0287. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Angus D.C. The search for effective therapy for sepsis: Back to the drawing board? JAMA. 2011;306:2614–2615. doi: 10.1001/jama.2011.1853. [DOI] [PubMed] [Google Scholar]
- 3.O’Brien J.M., Jr., Ali N.A., Aberegg S.K., Abraham E. Sepsis. Am. J. Med. 2007;120:1012–1022. doi: 10.1016/j.amjmed.2007.01.035. [DOI] [PubMed] [Google Scholar]
- 4.Pinsky M.R. Dysregulation of the immune response in severe sepsis. Am. J. Med. Sci. 2004;328:220–229. doi: 10.1097/00000441-200410000-00005. [DOI] [PubMed] [Google Scholar]
- 5.Wesche D.E., Lomas-Neira J.L., Perl M., Chung C.S., Ayala A. Leukocyte apoptosis and its significance in sepsis and shock. J. Leukoc. Biol. 2005;78:325–337. doi: 10.1189/jlb.0105017. [DOI] [PubMed] [Google Scholar]
- 6.Pinheiro da Silva F., Nizet V. Cell death during sepsis: Integration of disintegration in the inflammatory response to overwhelming infection. Apoptosis. 2009;14:509–521. doi: 10.1007/s10495-009-0320-3. [DOI] [PubMed] [Google Scholar]
- 7.Miao E.A., Rajan J.V., Aderem A. Caspase-1-induced pyroptotic cell death. Immunol. Rev. 2011;243:206–214. doi: 10.1111/j.1600-065X.2011.01044.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Bergsbaken T., Fink S.L., Cookson B.T. Pyroptosis: Host cell death and inflammation. Nat. Rev. Microbiol. 2011;7:99–109. doi: 10.1038/nrmicro2070. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Gabay C., Lamacchia C., Palmer G. IL-1 pathways in inflammation and human diseases. Nat. Rev. Rheumatol. 2010;6:232–241. doi: 10.1038/nrrheum.2010.4. [DOI] [PubMed] [Google Scholar]
- 10.Casey L.C., Balk R.A., Bone R.C. Plasma cytokine and endotoxin levels correlate with survival in patients with the sepsis syndrome. Ann. Intern. Med. 1993;119:771–778. doi: 10.7326/0003-4819-119-8-199310150-00001. [DOI] [PubMed] [Google Scholar]
- 11.Mantovani A., Cassatella M.A., Costantini C., Jaillon S. Neutrophils in the activation and regulation of innate and adaptive immunity. Nat. Rev. Immunol. 2011;11:519–531. doi: 10.1038/nri3024. [DOI] [PubMed] [Google Scholar]
- 12.Nathan N. Neutrophils and immunity: Challenges and opportunities. Nat. Rev. Immunol. 2006;6:173–182. doi: 10.1038/nri1785. [DOI] [PubMed] [Google Scholar]
- 13.Camicia G., Pozner R., de Larrañaga G. Neutrophil extracellular traps in sepsis. Shock. 2014;42:286–294. doi: 10.1097/SHK.0000000000000221. [DOI] [PubMed] [Google Scholar]
- 14.Remijsen Q., Kuijpers T.W., Wirawan E., Lippens S., Vandenabeele P., Vanden Berghe T. Dying for a cause: NETosis, mechanisms behind an antimicrobial cell death modality. Cell Death Differ. 2011;18:581–588. doi: 10.1038/cdd.2011.1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.McDonald B., Urrutia R., Yipp B.G., Jenne C.N., Kubes P. Intravascular neutrophil extracellular traps capture bacteria from the bloodstream during sepsis. Cell Host Microbe. 2012;12:324–333. doi: 10.1016/j.chom.2012.06.011. [DOI] [PubMed] [Google Scholar]
- 16.György B., Szabó T.G., Pásztói M., Pál Z., Misják P., Aradi B., László V., Pállinger E., Pap E., Kittel A., et al. Membrane vesicles, current state-of-the-art: Emerging role of extracellular vesicles. Cell. Mol. Life Sci. 2011;68:2667–2688. doi: 10.1007/s00018-011-0689-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Kalra H., Drummen G.P., Mathivanan S. Focus on extracellular vesicles: Introducing the next small big thing. Int. J. Mol. Sci. 2016;17:170. doi: 10.3390/ijms17020170. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Nauseef W.M., Borregaard N. Neutrophils at work. Nat. Immunol. 2014;15:602–611. doi: 10.1038/ni.2921. [DOI] [PubMed] [Google Scholar]
- 19.Timár C.I., Lorincz A.M., Csépányi-Kömi R., Vályi-Nagy A., Nagy G., Buzás E.I., Iványi Z., Kittel A., Powell D.W., McLeish K.R., et al. Antibacterial effect of microvesicles released from human neutrophilic granulocytes. Blood. 2013;121:510–518. doi: 10.1182/blood-2012-05-431114. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Dalli J., Norling L.V., Montero-Melendez T., Canova D.F., Lashin H., Pavlov A.M., Sukhorukov G.B., Hinds C.J., Perretti M. Microparticle alpha-2-macroglobulin enhances pro-resolving responses and promotes survival in sepsis. EMBO Mol. Med. 2014;6:27–42. doi: 10.1002/emmm.201303503. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Lashin H.M.S., Nadkarni S., Oggero S., Jones H.R., Knight J.C., Hinds C.J., Perretti M. Microvesicle subsets in sepsis due to community acquired pneumonia compared to faecal peritonitis. Shock. 2018;49:393–401. doi: 10.1097/SHK.0000000000000989. [DOI] [PubMed] [Google Scholar]
- 22.Nagaoka I. Have host defense peptides been acting in innate immunity since the trilobites of the Cambrian period 540 million years ago? Juntendo Med. J. 2016;62:96–97. doi: 10.14789/jmj.62.96. [DOI] [Google Scholar]
- 23.Niyonsaba F., Nagaoka I., Ogawa H., Okumura K. Multifunctional antimicrobial proteins and peptides: Natural activators of immune systems. Curr. Pharm. Des. 2009;15:2393–2413. doi: 10.2174/138161209788682271. [DOI] [PubMed] [Google Scholar]
- 24.Larrick J.W., Hirata M., Balint R.F., Lee J., Zhong J., Wright S. Human CAP18: A novel antimicrobial lipopolysaccharide-binding protein. Infec. Immun. 1995;63:1291–1297. doi: 10.1128/IAI.63.4.1291-1297.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Gudmundsson G.H., Agerberth B., Odeberg J., Bergman T., Olsson B., Salcedo R. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. Eur. J. Biochem. 1996;238:325–332. doi: 10.1111/j.1432-1033.1996.0325z.x. [DOI] [PubMed] [Google Scholar]
- 26.Dürr U.H., Sudheendra U.S., Ramamoorthy A. LL-37, the only human member of the cathelicidin family of antimicrobial peptides. Biochem. Biophys. Acta. 2006;1758:1408–1425. doi: 10.1016/j.bbamem.2006.03.030. [DOI] [PubMed] [Google Scholar]
- 27.Nagaoka I., Kuwahara-Arai K., Tamura H., Hiramatsu K., Hirata M. Augmentation of the bactericidal activities of human cathelicidin CAP18/LL-37-derived antimicrobial peptides by amino acid substitutions. Inflamm. Res. 2005;54:66–73. doi: 10.1007/s00011-004-1323-8. [DOI] [PubMed] [Google Scholar]
- 28.Nagaoka I., Hirota S., Niyonsaba F., Hirata M., Adachi Y., Tamura H., Heumann D. Cathelicidin family of antibacterial peptides CAP18 and CAP11 inhibit the expression of TNF-α by blocking the binding of LPS to CD14+ cells. J. Immunol. 2001;167:3329–3338. doi: 10.4049/jimmunol.167.6.3329. [DOI] [PubMed] [Google Scholar]
- 29.Hancock R.E., Diamond G. The role of cationic antimicrobial peptides in innate host defences. Trends Microbiol. 2000;8:402–410. doi: 10.1016/S0966-842X(00)01823-0. [DOI] [PubMed] [Google Scholar]
- 30.Nagaoka I., Tamura H., Hirata M. An antimicrobial cathelicidin peptide, human CAP18/LL-37, suppresses neutrophil apoptosis via the activation of formyl-peptide receptor-like 1 and P2X7. J. Immunol. 2006;176:3044–3052. doi: 10.4049/jimmunol.176.5.3044. [DOI] [PubMed] [Google Scholar]
- 31.Suzuki K., Murakami T., Kuwahara-Arai K., Tamura H., Hiramatsu K., Nagaoka I. Human anti-microbial cathelicidin peptide LL-37 suppresses the LPS-induced apoptosis of endothelial cells. Int. Immunol. 2011;23:185–193. doi: 10.1093/intimm/dxq471. [DOI] [PubMed] [Google Scholar]
- 32.Hu Z., Murakami T., Suzuki K., Tamura H., Reich J., Kuwahara-Arai K., Iba T., Nagaoka I. Antimicrobial cathelicidin peptide LL-37 inhibits the pyroptosis of macrophages and improves the survival of polybacterial septic mice. Int. Immunol. 2016;28:245–253. doi: 10.1093/intimm/dxv113. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Hosoda H., Nakamura K., Hu Z., Tamura H., Reich J., Kuwahara-Arai K., Iba T., Tabe Y., Nagaoaka I. Antimicrobial cathelicidin peptide LL-37 induces NET formation and suppresses the inflammatory responses in a mouse septic model. Mol. Med. Rep. 2017;16:5618–5626. doi: 10.3892/mmr.2017.7267. [DOI] [PubMed] [Google Scholar]
- 34.Kumagai Y., Murakami T., Kuwahara-Arai K., Iba T., Reich J., Nagaoka I. Antimicrobial peptide LL-37 ameliorates a murine sepsis model via the induction of microvesicle release from neutrophils. Innate Immun. 2020 doi: 10.1177/1753425920936754. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Croker B.A., O’Donnell J.A., Gerlic M. Pyroptotic death storms and cytopenia. Curr. Opin. Immunol. 2014;26:128–137. doi: 10.1016/j.coi.2013.12.002. [DOI] [PubMed] [Google Scholar]
- 36.Cinel I., Opal S.M. Molecular biology of inflammation and sepsis: A primer. Crit. Care Med. 2009;37:291–304. doi: 10.1097/CCM.0b013e31819267fb. [DOI] [PubMed] [Google Scholar]
- 37.Latz E. The inflammasomes: Mechanisms of activation and function. Curr. Opin. Immunol. 2010;22:28–33. doi: 10.1016/j.coi.2009.12.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Li P., Allen H., Banerjee S., Franklin S., Herzog L., Johnston C., McDowell J., Paskind M., Rodman L., Salfeld J., et al. Mice deficient in IL-1β-converting enzyme are defective in production of mature IL-1β and resistant to endotoxic shock. Cell. 1995;80:401–411. doi: 10.1016/0092-8674(95)90490-5. [DOI] [PubMed] [Google Scholar]
- 39.Wang W., Faubel S., Ljubanovic D., Mitra A., Falk S.A., Kim J., Tao Y., Soloviev A., Reznikov L.L., Dinarello C.A., et al. Endotoxemic acute renal failure is attenuated in caspase-1-deficient mice. Am. J. Physiol. Renal Physiol. 2005;288:997–1004. doi: 10.1152/ajprenal.00130.2004. [DOI] [PubMed] [Google Scholar]
- 40.Hu Z., Murakami T., Suzuki K., Tamura H., Kuwahara-Arai K., Iba T., Nagaoka I. Antimicrobial cathelicidin peptide LL-37 inhibits the LPS/ATP-induced pyroptosis of macrophages by dual mechanism. PLoS ONE. 2014;9:e85765. doi: 10.1371/journal.pone.0085765. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Wu J., Lin S., Wan B., Velani B., Zhu Y. Pyroptosis in liver disease: New insights into disease mechanisms. Aging Dis. 2019;10:1094–1108. doi: 10.14336/AD.2019.0116. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42.Li B., Yu M., Pan X., Ren C., Peng W., Li X., Jiang W., Zheng J., Zhou H. Artesunate reduces serum lipopolysaccharide in cecal ligation/puncture mice via enhanced LPS internalization by macrophages through increased mRNA expression of scavenger receptors. Int. J. Mol. Sci. 2014;15:1143–1161. doi: 10.3390/ijms15011143. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Sumi Y., Woehrle T., Chen Y., Bao Y., Li X., Yao Y., Inoue Y., Tanaka H., Junger W.G. Plasma ATP is required for neutrophil activation in a mouse sepsis model. Shock. 2014;42:142–147. doi: 10.1097/SHK.0000000000000180. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Xiang Y., Wang X., Yan C., Gao Q., Li S.A., Liu J., Zhou K., Guo X., Lee W., Zhang Y. Adenosine-5’-triphosphate (ATP) protects mice against bacterial infection by activation of the NLRP3 inflammasome. PLoS ONE. 2013;8:e63759. doi: 10.1371/journal.pone.0063759. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Griffiths R.J., Stam E.J., Downs J.T., Otterness I.G. ATP induces the release of IL-1 from LPS-primed cells in vivo. J. Immunol. 1995;154:2821–2828. [PubMed] [Google Scholar]
- 46.Cauwels A., Rogge E., Vandendriessche B., Shiva S., Brouckaert P. Extracellular ATP drives systemic inflammation, tissue damage and mortality. Cell Death Dis. 2014;5:e1102. doi: 10.1038/cddis.2014.70. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47.Guimarães-Costa A.B., Nascimento M.T., Wardini A.B., Pinto-da-Silva L.H., Saraiva E.M. ETosis: A microbicidal mechanism beyond cell death. J. Parasitol. Res. 2012;2012:929743. doi: 10.1155/2012/929743. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Neumann A., Berends E.T., Nerlich A., Molhoek E.M., Gallo R.L., Meerloo T., Nizet V., Naim H.Y., von Kockritz-Blickwede M. The antimicrobial peptide LL-37 facilitates the formation of neutrophil extracellular traps. Biochem. J. 2014;464:3–11. doi: 10.1042/BJ20140778. [DOI] [PubMed] [Google Scholar]
- 49.Bouchon A., Facchetti F., Weigand M.A., Colonna M. TREM-1 amplifies inflammation and is a crucial mediator of septic shock. Nature. 2001;410:1103–1107. doi: 10.1038/35074114. [DOI] [PubMed] [Google Scholar]
- 50.Gómez-Piña V., Soares-Schanoski A., Rodríguez-Rojas A., del Fresno C., García F., Vallejo-Cremades M.T., Fernández-Ruiz I., Arnalich F., Fuentes-Prior P., López-Collazo E. Metalloproteinases shed TREM-1 ectodomain from lipopolysaccharide-stimulated human monocytes. J. Immunol. 2007;179:4065–4073. doi: 10.4049/jimmunol.179.6.4065. [DOI] [PubMed] [Google Scholar]
- 51.Gibot S., Kolopp-Sarda M.N., Bene M.C., Cravoisy A., Levy B., Faure G.C., Bollaert P.E. Plasma level of a triggering receptor expressed on myeloid cells-1: Its diagnostic accuracy in patients with suspected sepsis. Ann. Intern. Med. 2004;141:9–15. doi: 10.7326/0003-4819-141-1-200407060-00009. [DOI] [PubMed] [Google Scholar]
- 52.Matzinger P: The danger model: A renewed sense of self. Science. 2002;296:301–305. doi: 10.1126/science.1071059. [DOI] [PubMed] [Google Scholar]
- 53.Xu J., Zhang X., Pelayo R., Monestier M., Ammollo1 C.Y., Semeraro F., Taylor F.B., Esmon N.L., Lupu F., Esmon C.T. Extracellular histones are major mediators of death in sepsis. Nat. Med. 2009;15:1318–1321. doi: 10.1038/nm.2053. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54.Matsuzaki K. Why and how are peptide-lipid interactions utilized for self-defense? Magainins and tachyplesins as archetypes. Biochim. Biophys. Acta. 1999;1462:1–10. doi: 10.1016/S0005-2736(99)00197-2. [DOI] [PubMed] [Google Scholar]
- 55.Tossi A., Sandri L., Giangaspero A. Amphipathic, α-helical antimicrobial peptides. Biopolymers. 2000;55:4–30. doi: 10.1002/1097-0282(2000)55:1<4::AID-BIP30>3.0.CO;2-M. [DOI] [PubMed] [Google Scholar]
- 56.Hancock R.E., Sahl H.G. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nat. Biotechnol. 2006;24:1551–1557. doi: 10.1038/nbt1267. [DOI] [PubMed] [Google Scholar]
- 57.Mookherjee N., Hancock R.E. Cationic host defence peptides: Innate immune regulatory peptides as a novel approach for treating infections. Cell. Mol. Life Sci. 2007;64:922–933. doi: 10.1007/s00018-007-6475-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Schuerholz T., Doemming S., Hornef M., Martin L., Simon T.P., Heinbockel L., Brandenburg K., Marx G. The anti-inflammatory effect of the synthetic antimicrobial peptide 19-2.5 in a murine sepsis model: A prospective randomized study. Crit. Care. 2013;17:R3. doi: 10.1186/cc11920. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Pfalzgraff A., Heinbockel L., Su Q., Brandenburg K., Weindl G. Synthetic anti-endotoxin peptides inhibit cytoplasmic LPS-mediated responses. Biochem. Pharmacol. 2017;140:64–72. doi: 10.1016/j.bcp.2017.05.015. [DOI] [PubMed] [Google Scholar]