Abstract
Apela was recently identified as a new ligand of the apelin peptide jejunum (APJ) receptor. The purpose of this study was to investigate the role of apela in post‐myocardial infarction (post‐MI) recovery from cardiorenal damage. A murine MI model was established, and apela was then infused subcutaneously for two weeks. Echocardiographs were performed before and after infarction at the indicated times. Renal function was evaluated by serum and urine biochemistry. Immunohistochemistry of heart and kidney tissue was performed by in situ terminal deoxynucleotidyl transferase‐mediated dUPT nick end‐labelling reaction. Compared to the control group (MI/vehicle), the average value of the left ventricular ejection fraction in apela‐treated mice increased by 32% and 39% at 2‐ and 4‐week post‐MI, respectively. The mean levels of serum blood urea nitrogen,creatinine, N‐terminal pro‐brain natriuretic peptide and 24‐hour urine protein were significantly decreased at 4‐week post‐MI in apela‐treated mice relative to that of control animals. At the cellular level, we found that apela treatment significantly reduced myocardial fibrosis and cellular apoptosis in heart and kidney tissue. These data suggest that apela improves cardiac and renal function in mice with acute MI. The peptide may be potential therapeutic agent for heart failure.
Keywords: apela, apelin peptide jejunum receptor, cardiac function, myocardial infarction, renal function
1. INTRODUCTION
In recent years, research has found a non‐coding RNA transcription gene called Apela (Elabela or Toddler); this gene can be transcribed and translated to produce a secreted hormone containing 55 amino acids, which becomes a mature short peptide of 32 amino acids after enzymatic cleavage. Apela and apelin can also act on an orphan G protein‐coupled receptor called apelin peptide jejunum (APJ) receptor. 1 , 2 Previous studies showed that APJ receptors are widely expressed in human tissues and organs. 3 Exogenous apela can interact with APJ receptors in mammalian tissues and cells to exert corresponding biological effects. 4 , 5 , 6 , 7 , 8 , 9 , 10 Previous basic experiments have also shown that apelin can improve cardiac function in mice with myocardial infarction by inhibiting myocardial cell apoptosis, promoting angiogenesis and inhibiting myocardial fibrosis. 11 Sustained apela gene therapy can improve blood pressure in high‐salt diet hypertension rats. 12 Exogenous apela can also reduce pulmonary arterial pressure in mice pulmonary hypertension models. 13 Recently, clinical studies have shown that endogenous plasma apela levels are higher in patients with acute myocardial infarction (MI) than in healthy controls; furthermore, apela levels are also negatively correlated with left ventricular ejection fraction (LVEF). 14 These basic experiments and clinical studies suggest that apela is valuable in the diagnosis and treatment of cardiovascular disease. In this study, we prepared a heart failure model of MI in mice to further investigate the effects of exogenous apela intervention on the heart and kidney function of mice with AMI as well as to explore the possible underlying mechanisms.
2. MATERIAL AND METHODS
2.1. Drug
The peptide of apela with a full length of 32‐aa (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) is synthesized by Hangzhou DGpeptides Co., Ltd with a purity of >98%.
2.2. Preparation of MI model
Animal experiment was approved by the Committee on Ethics in the Care and Use of Laboratory Animals of Nanjing Medical University. Eight‐week‐old male SPF‐grade C57BL/6 mice were purchased from Shanghai Xipuer‐Bikai Experimental Animal Co., Ltd. Mice had ad libitum access to food and water in the breeding environment, and the indoor temperature was controlled at 23°C ± 2°C. Mice were intraperitoneally injected with 10% chloral hydrate (0.02 mL/10 g), and the trachea was intubated with a ventilator to control ventilation frequency: 133 breaths/min, tidal volume (1–1.5 mL)]. The chest was opened to expose the heart, and then, a 7‐0 suture was used to ligate the left anterior descending coronary artery about 2 mm below the left atrial appendage. The sham‐treated group underwent a similar procedure without ligation. Echocardiography was performed at 2 and 4 weeks after model preparation as previously described. 11 Briefly, mice were anesthetized with 2% isoflurane inhalation, and echocardiography was performed using a small animal ultrasound system (Vevo770, Canadian VISUALSONICS company) equipped with a 30‐MHz probe. M‐mode echocardiography was used to measure the left ventricular end‐systolic and end‐diastolic inner diameters, and the LVEF was calculated automatically.
2.3. Grouping and drug administration
The experimental animals were divided three groups: sham operation procedure with saline treatment (sham + vehicle), MI with apela treatment (MI + apela), and MI with saline treatment (MI + vehicle). Apela (1 mg/kg/d) or an equal volume of saline was continuously administered for 2 weeks by a micro‐dosing osmotic pump (Alzet Model 1002, Alza Corp, Mountain View, CA, USA) implanted subcutaneously in the abdomen of mice.
2.4. Blood and urine biochemistry
Serum endogenous apela (Eiaab, Wuhan, China) and NT‐proBNP (Cloud‐Clone Corp, Houston, TX, USA) was measured by ELISA according to the manufacturer’s instructions. The serum urea nitrogen (BUN) and creatinine (Cr) were respectively detected using ELISA kits (Creative Diagnostics, USA) according to user’s manual. The 24‐h urine volume of mice was respectively collected before operation and 2 and 4 weeks after operation. The 24‐h urine protein content was measured with a urine protein quantitative test box (Jiancheng bioengineering, Nanjing, China).
2.5. Cardiac 2, 3, 5‐triphenyltetrazolium chloride staining
Mice were euthanized by intraperitoneal injection of excessive pentobarbital. The heart was quickly removed and was rinsed with ice‐cold saline to remove blood stains; it was then immediately frozen at −80℃ in a refrigerator for 3 min. Sections of the ventricle tissue were cut at 2‐mm thickness and placed in 1% 2, 3, 5‐triphenyltetrazolium chloride solution (Sangon Biotech, Shanghai, China); this was followed by incubation at 37°C in the dark for 30 min. The tissues were removed from the solution and photographed in sequence. The infarct area was measured using Image Pro Plus software. The infarct area (%) = the area of the infarcted area/the area of the left ventricle × 100%.
2.6. Heart tissue histology
Briefly, heart tissues were fixed with 4% formalin and embedded in paraffin. The 5‐μm‐thick sections were prepared and stained with Masson’s trichrome stain according to the manual of Masson’s trichromatic Staining Kit (KeyGen Biotech, Nanjing, China).
2.7. Immunohistochemical detection
Heart or kidney tissues were embedded in paraffin before staining. Then, 5‐μm‐thick sections were cut, deparaffinised and hydrated. After antigens were retrieved, endogenous peroxidase was blocked by incubation in 3% hydrogen peroxide. The tissue sections were incubated overnight at 4℃ with primary antibody anti‐CD31 (ab28364, Abcam, Cambridge, UK, 1:50) or MPO (ab208670, Abcam, Cambridge, UK, 1:1000). Samples were then incubated with a biotinylated secondary antibody and sequentially incubated in ABC‐peroxidase solution. Finally, samples were stained with 3, 3’‐diaminobenzidine, slightly counterstained with haematoxylin and fixed with neutral balata.
2.8. TUNEL assay
Sections were detected by TUNEL assay using an In Situ Cell Death Detection Kit (KGA703, KeyGen Biotech, Nanjing, China). Briefly, heart or kidney tissue sections with paraffin‐embedded were deparaffinised, rehydrated and antigen‐retrieved. The following procedures were according to the instructions of the TUNEL assay kit.
2.9. Statistical analysis
GraphPad Prism5 statistical software was used for data analysis. The data were expressed as mean value ± SD. The statistical differences were assessed using one‐way ANOVA or Student’s unpaired t test. A P value of <0.05 was considered significant.
3. RESULTS
3.1. Apela improves heart function in mice after MI
There was no significant change in serum NT‐proBNP or apela concentration in sham‐treated mice before MI and at 2 and 4 weeks after MI, whereas the NT‐proBNP or apela concentration in the control group (MI + vehicle) increased gradually after MI. The average NT‐proBNP or apela concentration at 2 and 4 weeks after MI was significantly lower in the apela‐treated group (MI + apela) than in the control group (Figure 1A and B). Correspondingly, the mean value of LVEF at 2 and 4 weeks after MI was significantly higher in the apela‐treated group than in the control group (Figure 1C). The average value of LVEF in apela‐treated mice increased by 32% and 39% at 2‐week and 4‐week post‐MI compared with control mice, respectively. Interestingly, we found a positive correlation between serum levels of apela and NT‐proBNP in the control mice at 2 weeks after MI (r = 0.936, P < 0.05), whereas there was a negatively correlation between apela (r = −0.891, P < 0.05) or NT‐proBNP (r = −0.976, P < 0.05) and LVEF in the control mice at 2‐week post‐MI (Table 1).
TABLE 1.
Apela | NT‐proBNP | LVEF (%) | |
---|---|---|---|
Apela | 1 | 0.936* | −0.891* |
NT‐proBNP | 0.936* | 1 | −0.976* |
LVEF(%) | −0.891* | ‐0.976* | 1 |
Abbreviations: LVEF, Left ventricular ejection fraction, NT‐proBNP, N‐terminal brain natriuretic peptide, MI, Myocardial infarction.
P < 0.05.
3.2. Apela improves kidney function in mice after MI
Regarding serum BUN and Cr levels, compared to their baseline levels in mice before MI, their levels were higher at the 2 and 4 weeks after MI. The average BUN and Cr concentrations were lower in apela‐treated mice than in control mice (MI + vehicle) at 2 and 4 weeks after MI (Figure 2A and B). Compared with control mice, the average value of 24‐h urine volume significantly increased at 2 and 4 weeks after MI in apela‐treated mice (Figure 2C); furthermore, in apela‐treated mice, the mean value of 24‐h urine protein content was lower than that in control mice (Figure 2D).
3.3. Apela limits MI area and reduces myocardial fibrosis
Histopathological results showed that compared with the control group, the apela‐treated group showed significantly decreased mean value of the area of myocardial infarction at 4 weeks after MI (Figure 3A and B). Masson staining of the myocardial tissue in the control group showed obvious interstitial fibrosis at 4 weeks after MI, whereas the myocardial interstitial fibrosis was significantly reduced in apela‐treated mice (Figure 3C).
3.4. Apela increases the proportion of CD31‐positive cells in the heart
To observe the myocardial neovascularization after infarction, we applied immunohistochemistry to detect the expression of neovascular endothelial cell marker CD31. 15 The results showed that the proportion of CD31‐positive cells near the infarcted area of myocardial tissue was significantly higher in the apela‐treated group than in the control group at 4 weeks after MI (Figure 4A and B).
3.5. Apela reduces the proportion of TUNEL‐positive cells in heart and kidney tissues
To observe the apoptosis of heart and kidney tissues after MI, we used TUNEL staining to evaluate the ratio of TUNEL‐positive cells. The results showed that at 4 weeks after MI, the percentage of TUNEL‐positive cells in the non‐infarcted area of the heart was significantly lower in the apela‐treated group than in the control group (Figure 5A). Similarly, the ratio of TUNEL‐positive cells in kidney tissues was significantly lower in apela‐treated mice than in control mice at 4 weeks after MI (Figure 5B).
3.6. Apela inhibits MPO expression in kidney tissue
Myeloperoxidase (MPO) is a haemoglobin protein that is rich in neutrophils and is widely used as a marker of inflammation. 16 Immunohistochemical tests showed that at 4 weeks after MI, the percentage of MPO‐positive cells in kidney tissues of the control group was significantly higher than it was before MI, while the ratio of MPO‐positive cells was significantly lower in the apela‐treated group than in the control group (Figure 6A and B).
4. DISCUSSION
The APJ receptor, also known as the orphan G protein‐coupled receptor, was first isolated by O 'Dowd et al. in 1993. 17 In 1998, Tatemoto et al extracted and purified the first APJ receptor endogenous ligand from bovine gastric secretions and named it apelin. 18 After 2 decades of research, it has been found that apelin and APJ receptor are widely expressed in mammalian tissues and organs. The apelin/APJ receptor system exerts various biological effects through endocrine or para/autocrine manner, and it interacts with the digestive system, respiratory system, endocrine and reproductive system, central nervous system and cardiovascular system. In particular, apelin plays an important role in the occurrence and development of heart failure. 19 , 20
In recent years, two independent research teams from the United States and Singapore have discovered APJ receptor's second endogenous ligand named apela (Elabela/Toddler). The 10 amino acids at the carboxy terminus of the mature 32‐aa‐apela are highly conserved in vertebrates. The molecular structure shows that apela and apelin are basic amino acids and have the same isoelectric point and are APJ receptor's acting ligands; this suggests that apela and apelin have biological similarities. 1 , 2 Functional studies have also shown that apela and apelin can promote cardiomyocyte differentiation, induce angiogenesis and dilate aorta in vitro. 21 , 22 , 23 , 24 In vivo experiments have found that apelin and its structural homologs can alleviate myocardial ischaemia and reperfusion injury. 25 , 26
Sato et al. showed that apela can prevent pressure overload heart failure caused by transverse aortic constriction in mice. 27 Yurdaer et al found that the apela level was positively correlated with NT‐proBNP (r = 0.586, P < 0.05), whereas the levels of apela ((r = −0.551, P < 0.05) or NT‐proBNP (r = −0.684, P < 0.05) were negatively correlated with LVEF in patients with acute MI. 14 BNP or NT‐proBNP is an important biomarker to evaluate the severity and prognosis of heart function. It is mainly secreted from the ventricle, and its synthesis and secretion are closely related with the ventricular load and wall tension. 28 As the BNP produced in decompensated heart failure is not enough to antagonize the activated rennin‐angiotensin‐aldosterone system (RAAS) and sympathetic nervous system (SNS), so exogenous recombinant human BNP is widely used to treat decompensated heart failure. 29 In our study, we also observed that serum NT‐proBNP increased significantly while LVEF declined in mice with AMI. After intervention with exogenous apela, NT‐proBNP decreased significantly and LVEF increased significantly at 2 and 4 weeks after MI. These results suggest that apela can not only prevent heart failure caused by pressure overload but also improve heart failure caused by acute myocardial ischaemia. More interestingly, our results are partially similar to that of Yurdaer et al. We also found that endogenous apela or NT‐proBNP was parallel regulated in mice post‐MI, and the expression of apela was significantly correlated with LVEF at 2 weeks after MI. We speculate that endogenous apela is similar to BNP, which increases in decompensated heart failure, but the amount of endogenous apela is not enough to reverse decreased heart function. Therefore, exogenous apela is needed to improve cardiac function of heart failure. Further large‐sample and perspective clinical studies would help to clarify the relationship between apela levels and heart failure in real world.
Pathological and immunohistological results show that apela can limit the area of myocardial infarction, reduce myocardial interstitial fibrosis and increase the proportion of CD31‐positive cells near the infracted area while significantly reducing the proportion of TUNEL‐positive cells. It is suggested that apela can promote angiogenesis and inhibit cardiomyocyte apoptosis in vivo. We speculate that apela improves cardiac function after MI via the combined effects of limiting infarct size, inhibiting interstitial fibrosis, promoting angiogenesis and reducing myocardial cell apoptosis. Previous studies indicated that about 18.2%–53.3% of C57BL/6 mice died of cardiac rupture within one week after MI. 30 , 31 Whether or not apela could prevent cardiac rupture in mice after MI was not examined in the present study, which would be worthwhile to be studied in further research work.
More interestingly, apela can improve not only the heart function in MI mice but also the kidney function. Coquerel et al. found that apela and apelin can improve renal function in septic shock rats and that apela has a stronger ability to inhibit plasma inflammatory cytokines than apelin. 32 Chen et al. made a mouse model of acute kidney insufficiency (AKI) by renal ischaemia/reperfusion and found that apela can inhibit renal cell apoptosis, DNA damage and inflammation and fibrosis of renal tissue in AKI mice. 33 In this study, we observed that apela increased 24‐h urine volume and decreased urinary protein excretion significantly in mice after MI. Serum creatinine and urea nitrogen levels were also significantly lower in apela‐treated mice than in control mice. Immunostaining results showed that apela could inhibit the inflammatory response and apoptosis of renal cells in mice after MI.
Acute myocardial infarction weakens myocardial contractility and decreases left ventricular ejection fraction, thus resulting in reduced cardiac output and insufficient perfusion of important organs, such as the kidney. In addition, the activation of the RAAS and the SNS increased the levels of angiotensin II and inflammatory cytokines, causing imbalance in the diastolic and contractile functions of the glomerular afferent and efferent arteries. This eventually leads to a decrease in the glomerular filtration rate. 34
In recent years, cardiorenal syndrome (CRS) caused by the interconnection and influence of heart and kidney diseases has attracted the attention of cardiologists and nephrologists but mechanistic pathways have yet to be fully elucidated. 35 Cardiorenal syndrome is a clinical syndrome wherein acute or chronic dysfunction of the heart or kidney causes acute or chronic functional impairment of another organ. The American Heart Association classifies it into five types based on the incidence of heart and kidney disease. Acute renal failure secondary to acute heart failure is called type I cardiorenal syndrome, which is also a common type of cardiorenal syndrome in clinical practice. Once patients with acute heart failure are associated with renal insufficiency, the mortality and disability rates increase significantly. Therefore, effectively preventing cardiorenal syndrome remains a challenge in clinical practice. 36 , 37 The data in our study suggest that apela improves cardiac and renal function in mice with acute MI. The most common cause of acute heart failure is AMI, and the abnormal haemodynamics as well as activation of the RAAS and SNS are the major factors that mediate acute heart failure secondary to AMI. 38 Besides haemodynamic and neurohumoral factors, there are other major pathophysiological mechanisms, including hypertension, inflammation and oxidative stress, involved in CRS. 39 , 40 In the present study, the effects of apela on blood pressure, inflammation mediators or other major factors in mice after MI were not examined, which would be worthwhile to be studied in the future.
5. CONCLUSIONS
In summary, our results reveal that apela can improve not only cardiac function after MI but also reserve renal function. We suggest that it is possible to develop apela as a clinical drug in the future that can not only treat heart failure but also prevent type I cardiorenal syndrome.
CONFLICTS OF INTEREST
The authors declare no any conflicts of interest in this work.
AUTHOR CONTRIBUTION
Yang Pan: Data curation (equal); Formal analysis (equal); Investigation (equal); Methodology (equal); Project administration (equal); Writing‐original draft (equal). Quanyi Li: Data curation (equal); Investigation (equal); Methodology (equal). Hong Yan: Data curation (equal); Methodology (equal). Jin Huang: Investigation (equal); Supervision (equal). Zhi Wang: Data curation (equal); Funding acquisition (lead); Investigation (equal); Methodology (equal); Project administration (lead); Writing‐original draft (equal). Dr. Zhi Wang and Yang Pan designed and performed the study. Yang Pan and Quanyi Li analysed the results. Hong Yan gave us constructive advice in experiment. Dr. Zhi Wang and Yang Pan wrote the manuscript. Dr. Jin Huang reviewed the manuscript. All the authors approved the final version.
ACKNOWLEDGEMENTS
The work was supported from the National Natural Science Foundation of China (Award No. 81570365). We thank Xiaoyuan Wu, Chenxi Zhang from Central Laboratory of Nanjing Chest Hospital for their valuable help in experiments.
Pan Y, Li Q, Yan H, Huang J, Wang Z. Apela improves cardiac and renal function in mice with acute myocardial infarction. J Cell Mol Med. 2020;24:10382–10390. 10.1111/jcmm.15651
DATA AVAILABILITY STATEMENT
All data generated or analysed during this study are included in this article.
REFERENCES
- 1. Chng SC, Ho L, Tian J, Reversade B. ELABELA: A hormone essential for heart development signals via the apelin receptor. Dev Cell. 2013;27(6):672–680. [DOI] [PubMed] [Google Scholar]
- 2. Pauli A, Norris ML, Valen E, et al. Toddler: an embryonic signal that promotes cell movement via Apelin receptors. Science. 2014;343(6172):1248636. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3. Wang Z, Yu D, Wang M, et al. Elabela‐apelin receptor signaling pathway is functional in mammalian systems. Sci Rep. 2015;2(5):8170. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4. Chapman NA, Dupre DJ, Rainey JK. The apelin receptor: physiology, pathology, cell signaling, and ligand modulation of a peptide‐activated class A GPCR. Biochem Cell Biol. 2014;92:431–440. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5. Goidescu CM, Vida‐Simiti LA. The apelin‐APJ system in the evolution of heart failure. Clujul Med. 2015;88(1):3–8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6. Sunjaya AP, Sunjaya AF, Ferdinal F. Apela/Elabela/Toddler: New perspectives in molecular mechanism of heart failure. Glob Cardiol Sci Pract. 2019;2019(2):e201915. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7. Shin K, Kenward C, Rainey JK. Apelinergic system structure and function. Compr Physiol. 2017;8(1):407–450. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8. Zhang Y, Wang Y, Lou Y, et al. Elabela, a newly discovered APJ ligand: Similarities and differences with Apelin. Peptides. 2018;109:23–32. [DOI] [PubMed] [Google Scholar]
- 9. Kuba K, Sato T, Imai Y, Yamaguchi T. Apelin and Elabela/Toddler; double ligands for APJ/Apelin receptor in heart development, physiology, and pathology. Peptides. 2019;111:62–70. [DOI] [PubMed] [Google Scholar]
- 10. Deng C, Chen H, Yang N, Feng Y, Hsueh AJ. Apela regulates fluid homeostasis by binding to the APJ receptor to activate Gi signaling. J Biol Chem. 2015;290(30):18261–18268. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11. Li L, Zeng H, Chen JX. Apelin‐13 increases myocardial progenitor cells and improves repair postmyocardial infarction. Am J Physiol Heart Circ Physiol. 2012;303(5):H605–H618. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12. Schreiber CA, Holditch SJ, Generous A, Ikeda Y. Sustained ELABELA gene therapy in high‐salt diet‐induced hypertensive rats. Curr Gene Ther. 2017;16(5):349–360. [DOI] [PubMed] [Google Scholar]
- 13. Yang P, Read C, Kuc RE, et al. Elabela/toddler is an endogenous agonist of the apelin APJ receptor in the adult cardiovascular system, and exogenous administration of the peptide compensates for the downregulation of its expression in pulmonary arterial hypertension. Circulation. 2017;135(12):1160–1173. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14. Dönmez Y, Acele A. Increased Elabela levels in the acute ST segment elevation myocardial infarction patients. Medicine (Baltimore). 2019;98(43):e17645. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15. Rakocevic J, Orlic D, Mitrovic‐Ajtic O, et al. Endothelial cell markers from clinician's perspective. Exp Mol Pathol. 2017;102(2):303–313. [DOI] [PubMed] [Google Scholar]
- 16. Anatoliotakis N, Deftereos S, Bouras G, et al. Myeloperoxidase: Expressing inflammation and oxidative stress in cardiovascular disease. Curr Top Med Chem. 2013;13(2):115–138. [DOI] [PubMed] [Google Scholar]
- 17. O'Dowd BF, Heiber M, Chan A, et al. A human gene that shows identity with the gene encoding the angiotensin receptor is located on chromosome 11. Gene. 1993;136(1–2):355–360. [DOI] [PubMed] [Google Scholar]
- 18. Tatemoto K, Hosoya M, Habata Y, et al. Isolation and characterization of a novel endogenous peptide ligand for the human APJ receptor. Biochem Biophys Res Commun. 1998;251(2):471–476. [DOI] [PubMed] [Google Scholar]
- 19. Galanth C, Hus‐Citharel A, Li B, et al. Apelin in the control of body fluid homeostasis and cardiovascular functions. Curr Pharm Des. 2012;18:789–798. [DOI] [PubMed] [Google Scholar]
- 20. O'Carroll A‐M, Lolait SJ, Harris LE, et al. The apelin receptor APJ :journey from an orphan to a multifaceted regulator of homeostasis. J Endocrinol. 2013;219:R13–R35. [DOI] [PubMed] [Google Scholar]
- 21. Humada J, Kimura J, Ishida J, et al. Evaluation of novel cyclic analogues of apelin. Int J Mol Med. 2008;22:547–552. [PubMed] [Google Scholar]
- 22. Zhong J, Yu X, Huang Y, et al. Apelin modulates aortic vascular tone via endothelial nitric oxide synthase phosphorylation pathway in diabetic mice. Cardiovasc Res. 2007;74:388–395. [DOI] [PubMed] [Google Scholar]
- 23. Wang Z, Huang J. Apela promotes cardiomyocyte differentiation from transgenic human embryonic stem cell lines. Appl Biochem Biotechnol. 2019;189(2):396–410. [DOI] [PubMed] [Google Scholar]
- 24. Wang I‐N, Wang X, Ge X, et al. Apelin enhances directed cardiac differentiation of mouse and human embryonic stem cells. PLoS One. 2012;7(6):e38328. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25. Koguchi W, Kobayashi N, Takeshima H, Ishikawa M, Sugiyama F, Ishimitsu T. Cardioprotective effect of apelin‐13 on cardiac performance and remodeling in end‐stage heart failure. Circ J. 2012;76(1):137–144. [DOI] [PubMed] [Google Scholar]
- 26. Pisarenko OlegI, Serebryakova LarisaI, Studneva IrinaM, et al. Effects of structural analogues of apelin‐12 in acute myocardial infarction in rats. J Pharmacol Pharmacother. 2013;4(3):198–203. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27. Sato T, Sato C, Kadowaki A, et al. ELABELA‐APJ axis protects from pressure overload heart failure and angiotensin II‐induced cardiac damage. Cardiovasc Res. 2017;113(7):760–769. [DOI] [PubMed] [Google Scholar]
- 28. Abuzaanona A, Lanfear D. Pharmacogenomics of the natriuretic peptide system in heart failure. Curr Heart Fail Rep. 2017;14(6):536–542. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29. Pan HY, Zhu JH, Gu Y, Yu XH, Pan M, Niu HY. Comparative effects of recombinant human brain natriuretic peptide and dobutamine on acute decompensated heart failure patients with different blood BNP levels. BMC Cardiovasc Disord. 2014;14:31. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30. Sun M, Dawood F, Wen W‐H, et al. Excessive tumor necrosis factor activation after infarction contributes to susceptibility of myocardial rupture and left ventricular dysfunction. Circulation. 2004;110(20):3221–3228. [DOI] [PubMed] [Google Scholar]
- 31. Gao XM, Dart AM, Dewar E, Jennings G, Du XJ. Serial echocardiographic assessment of left ventricular dimensions and function after myocardial infarction in mice. Cardiovasc Res. 2000;45(2):330–338. [DOI] [PubMed] [Google Scholar]
- 32. Coquerel D, Chagnon F, Sainsily X, et al. ELABELA improves cardio‐renal outcome in fatal experimental septic shock. Crit Care Med. 2017;45(11):e1139–e1148. [DOI] [PubMed] [Google Scholar]
- 33. Chen H, Wang L, Wang W, et al. ELABELA and an ELABELA Fragment Protect against AKI. J Am Soc Nephrol. 2017;28(9):2694–2707. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34. Ronco C, Bellasi A, Di Lullo L. Implication of acute kidney injury in heart failure. Heart Fail Clin. 2019;15(4):463–476. [DOI] [PubMed] [Google Scholar]
- 35. Waldum B, Os I. The cardiorenal syndrome: What the cardiologist needs to know. Cardiology. 2013;126(3):175–186. [DOI] [PubMed] [Google Scholar]
- 36. Rangaswami J, Bhalla V, Blair JEA, et al. Cardiorenal syndrome: Classification, pathophysiology, diagnosis, and treatment strategies: A scientific statement from the American Heart Association. Circulation. 2019;139(16):e840–e878. [DOI] [PubMed] [Google Scholar]
- 37. Damman K, Testani JM. The kidney in heart failure: an update. Eur Heart J. 2015;36(23):1437–1444. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38. Kurmani S, Squire I. Acute heart failure: Definition, classification and epidemiology. Curr Heart Fail Rep. 2017;14(5):385–392. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39. Yogasundaram H, Chappell MC, Braam B, Oudit GY. Cardiorenal syndrome and heart failure‐challenges and opportunities. Can J Cardiol. 2019;35(9):1208–1219. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40. Cabandugama PK, Gardner MJ, Sowers JR. The renin angiotensin aldosterone system in obesity and hypertension: roles in the cardiorenal metabolic syndrome. Med Clin North Am. 2017;101(1):129–137. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
All data generated or analysed during this study are included in this article.