Abstract
The melanocortin receptor 4 (MC4R) signaling system consists of MC4R, MC4R ligands [melanocyte-stimulating hormone (MSH), adrenocorticotropin (ACTH), agouti-related protein (AgRP)], and melanocortin-2 receptor accessory protein 2 (MRAP2), and it has been proposed to play important roles in feeding and growth in vertebrates. However, the expression and functionality of this system have not been fully characterized in teleosts. Here, we cloned tilapia MC4R, MRAP2b, AgRPs (AgRP, AgRP2), and POMCs (POMCa1, POMCb) genes and characterized the interaction of tilapia MC4R with MRAP2b, AgRP, α-MSH, and ACTH in vitro. The results indicate the following. (1) Tilapia MC4R, MRAP2b, AgRPs, and POMCs share high amino acid identity with their mammalian counterparts. (2) Tilapia MRAP2b could interact with MC4R expressed in CHO cells, as demonstrated by Co-IP assay, and thus decrease MC4R constitutive activity and enhance its sensitivity to ACTH1-40. (3) As in mammals, AgRP can function as an inverse agonist and antagonist of MC4R, either in the presence or absence of MRAP2b. These data, together with the co-expression of MC4R, MRAP2b, AgRPs, and POMCs in tilapia hypothalamus, suggest that as in mammals, ACTH/α-MSH, AgRP, and MRAP2 can interact with MC4R to control energy balance and thus play conserved roles in the feeding and growth of teleosts.
Keywords: Nile tilapia, MC4R, MRAP2, ACTH, AgRP, α-MSH, β-MSH
1. Introduction
There has been increasing evidence showing that the melanocortin receptor 4 (MC4R) signaling system is crucial in the control of food intake and energy balance in the hypothalamus of vertebrates [1,2,3,4,5,6]. In mammals and birds, this signaling system consists of MC4R (a G protein-coupled receptor), MC4R ligands [α-melanocyte-stimulating hormone (α-MSH); adrenocorticotropin (ACTH), and agouti-related peptide (AgRP)], and melanocortin receptor 2 accessary protein 2 (MRAP2) [2,5]. α-MSH and ACTH are derived from the proopiomelanocortin (POMC) precursor and can activate MC4R and increase intracellular cAMP levels, while AgRP can act either as an antagonist to block α-MSH/ACTH action on MC4R, or as an inverse agonist to decrease the basal constitutive activity of MC4R in the absence of α-MSH/ACTH [1,7,8]. MRAP2 is a single-pass transmembrane protein and can form an antiparallel homodimer [9]. It can not only decrease the basal constitutive activity of MC4R, but also modulate its sensitivity and selectivity toward its ligands [2,5].
It is clear that in mammals, all the components of the MC4R signaling system are expressed in the hypothalamus and play a key role in the regulation of food intake, growth, and energy balance. α-MSH/ACTH secreted by POMC neurons can suppress the appetite via MC4R, while AgRP secreted by AgRP neurons can increase food intake by decreasing the constitutive activity of MC4R or antagonizing the action of α-MSH on MC4R [1]. Loss-of-function mutations in MC4R lead to obesity in mice [10]. Transgenic mice over-expressing AgRP show increased obesity, food intake, and hyperinsulinemia [11,12]. The mutation of MRAP2 in humans and mice also causes early-onset severe obesity [2]. All these findings support the notion that MC4R, α-MSH/ACTH, AgRP, and MRAP2 can form a complex interaction network to regulate the feeding, energy balance, and growth of animals [2,5].
As in mammals and birds, MC4R, AgRP, POMC, and MRAP2 have also been identified in some teleost species [7,13,14,15], and these molecules likely play similar roles in feeding, growth, and obesity within the hypothalamus [16,17,18]. The intracerebroventricular (icv) or intraperitoneal (ip) injection of MC4R agonists can decrease food intake in goldfish [19], zebrafish [3], and coho salmon [20], while transgenic zebrafish over-expressing AgRP display obesity, increased linear growth, and adipocyte hypotrophy [17]. Moreover, in zebrafish, MRAP2a/MRAP2b can also interact with MC4R, regulate food intake and growth, and modulate the sensitivity of MC4R to α-MSH/ACTH [3,4]. All these findings imply that the MC4R signaling system plays critical roles in food intake and growth, similar to that in mammals and birds [5,6,21].
Despite the presence of the MC4R signaling system in teleosts, this system varies significantly between teleosts and mammals/birds. For instance, a single copy of each component (MC4R, POMC, AgRP, MRAP2) is present in mammalian and avian MC4R systems [1,5]. In contrast, two to three copies of POMC genes (e.g., POMCa1, POMCa2, and POMCb in barfin flounder) [22,23], two copies of AgRP genes (e.g., AgRP and AgRP2 in zebrafish) [24,25], and one to two copies of MRAP2 (e.g., MRAP2a and MRPA2b in zebrafish) [3,4] have been identified in teleosts. This difference raises a question of whether all the genes are expressed in the hypothalamus and function in a way similar to those in mammals and birds. Therefore, using tilapia as an animal model, our present study aimed to (1) identify and clone the genes of the MC4R signaling system; (2) examine whether MC4R can interact with MRAP2 (named MRAP2b in this study) and respond to their ligands, including the POMC-derived peptides (α-MSH, β-MSH, and ACTH1-40) and AgRP; and (3) examine the expression of the MC4R signaling system in the hypothalamus. The results from this study will provide comparative insights into the conserved roles of the MC4R signaling system in feeding and growth across vertebrates.
2. Results
2.1. Cloning of Tilapia MC4R, MRAP2b, POMCa1, POMCb, AgRP, and AgRP2 Coding Regions
To determine whether the MC4R signaling system exists in tilapia, we searched the tilapia genome using ortholog genes in humans and zebrafish. Finally, we identified seven genes of the MC4R signaling system in tilapia, including one MC4R, one MRAP2, three POMCs, and two AgRP genes. According to the synteny analysis shown in Figure 1 and Figure S1 and nomenclature in other teleosts (e.g., barfin flounder, zebrafish), we designated them as tilapia MC4R, MRAP2b, POMCa1, POMCa2, POMCb, AgRP, and AgRP2, respectively.
Using RT-PCR, we further amplified and cloned the coding regions of MC4R, MRAP2b, POMCa1, POMCb, AgRP, and AgRP2 from tilapia brain tissue. Sequence analysis revealed that tilapia MC4R (accession no.: MT500791) has seven typical transmembrane regions (TMD1–7) (Figure 2A). Similar to mammalian MC4R, tilapia MC4R has a conserved glycosylation site at its N-terminus and a conserved ‘DRY’ motif near the third transmembrane region. Sequence alignment showed that tilapia MC4R shares high amino acid sequence identities with zebrafish (78%), medaka (89%), amazon molly (93%), and zebra mbunda (99%), and it has a comparatively low identity with humans and mice (≈70%).
Tilapia MRAP2b cDNA (accession no: MT500790) encodes a protein of 235 amino acids. It shares a high degree of amino acid identities with that of medaka (79%), amazon molly (82%), and zebra mbunda (98%), but a comparatively low identity with that of zebrafish MRAP2b (50%) and MRAP2a (56%), chickens (49%), humans (54.0%), and mice (51%). Similar to human MRAP2, tilapia MRAP2b contains a glycosylation site at the N-terminus, which is a key motif (LKAHRYS) [26] for the formation of an antiparallel homodimer, and a long C-terminal tail containing three conserved regions across vertebrates (Figure 2B) [5].
Two POMC genes were cloned from Nile tilapia: POMCa1 (MT740811) and POMCb (MT740812). Each tilapia POMC precursor is predicted to generate α-MSH, ACTH, and β-MSH after cleavage at the dibasic residues (Figure 3). Moreover, we note the presence of an ε-MSH in the tilapia POMCb precursor. Although tilapia POMCa2 cDNA was not cloned in this study, similar to the POMCa1 precursor, the predicted tilapia POMCa2 precursor (XP_003458632) seems to be capable of producing α-MSH, β-MSH, ACTH, and β-endorphin (Figure 3C). Unlike mammalian POMC, tilapia POMCs cannot produce ɤ-MSH [27]. The full list of POMC-derived peptides in tilapia is given in Table 1.
Table 1.
Peptide | Gene | Amino Acid Sequence |
---|---|---|
ACTHs | POMCa1 | SYSMEHFRWGKPVGRKRRPVKVYTSNGVAEESAEVFPEEM |
POMCa2 | SYSMEHFRWGKPVGRKRRPIKIYTTNGLEEESAELFPGEM | |
POMCb | SYSMEHFRWGKPSGRKRRPVKVFASSLEGGSSSEGRFPFQ | |
α-MSHs | POMCa1 | SYSMEHFRWGKPV |
POMCa2 | SYSMEHFRWGKPV | |
POMCb | SYSMEHFRWGKPS | |
β-MSHs | POMCa1 | DGSYKMKHFRWSGPPAS |
POMCa2 | DEMYKMKHFRWGGLPAS | |
POMCb | DRTYKMSHFRWGSPPAS | |
ε-MSH | POMCb | SYRMEHFRWGKPA |
β-endorphins | POMCa1 | YGGFMKSWDERSQRPLLTLFKNVINKEGQQQK |
POMCa2 | YGGFMKSWDERSQRPLITLFKNVINKEAQEEKREQ | |
a POMCb | NGGFMKPWEEKPQGQLAKFFRNILVKDVKRIMG |
Note: ‘a’ indicates that β-endorphin derived from the POMCb precursor may not be a bioactive peptide (due to loss of a ‘YGGFM motif’).
As in zebrafish and medaka, two AgRP genes, namely AgRP (MT740813) and AgRP2 (MT740814), were identified and cloned in tilapia. The amino acid sequence identity shared between mature tilapia AgRP (142 aa) and AgRP2 (116 aa) is low (23.4%). However, tilapia AgRP and AgRP2 share high amino acid sequence identities with zebrafish AgRP (51%) and AgRP2 (45%) respectively, with the five putative disulfide bonds fully conserved across vertebrates (Figure 4) [24,25].
2.2. Functionality of Tilapia MC4R in the Absence or Presence of MRAP2b
To detect whether α-MSH/ACTH can activate tilapia MC4R, we used synthetic tilapia α-MSH, β-MSH, and ACTH1-40 (derived from tilapia POMCa1 precursor) to treat CHO cells transiently expressing tilapia MC4R, and then, the receptor-stimulated cAMP/PKA signaling pathway was monitored by a pGL3-CRE-luciferase reporter system, as established in our previous study [5,28].
As shown in Figure 5, tilapia α-MSH, β-MSH, and ACTH could activate MC4R expressed in CHO cells and stimulate the luciferase activity dose-dependently. The EC50 values of ACTH, α-MSH, and β-MSH were 0.246 ± 0.048, 0.955 ± 0.262, and 0.421 ± 0.190 nM, respectively (Table 2).
Table 2.
Peptides | EC50 (nM) | |
---|---|---|
MC4R | MC4R + MRAP2b | |
ACTH | 0.246 ± 0.048 | 0.032 ± 0.005 |
α-MSH | 0.955 ± 0.262 | 0.786 ± 0.162 |
β-MSH | 0.421 ± 0.190 | 0.572 ± 0.122 |
In the presence of tilapia MRAP2b, the potency of ACTH was significantly improved, and its EC50 value was reduced to 0.032 ± 0.005 nM. In contrast, the EC50 values of α-MSH (0.786 ± 0.162 nM) and β-MSH (0.572 ± 0.122 nM) showed little or no significant change (Table 2).
These findings clearly indicate that tilapia MC4R can be activated efficiently by α-MSH, β-MSH, and ACTH and can act as a common receptor for three peptides. However, in the presence of MRAP2b, MC4R can act as an ACTH-preferring receptor, as previously reported in zebrafish, chickens, and pigs [3,5,21].
To confirm the interaction between tilapia MRAP2b and MC4R, Co-IP assay was used in this study. In CHO cells expressing pcDNA3.1-Myc-MRAP2b and pcDNA3.1-3xFlag-MC4R plasmids, magnetic beads immobilized with anti-Flag protein were used to test whether MC4R could interact with MRAP2b. As shown in Figure 6, two positive bands (30–35 kDa) of MRAP2b protein were detected in IP samples co-expressing tilapia MC4R and MRAP2b, supporting the interaction between the two proteins.
2.3. AgRP Can Act as an Inverse Agonist of Tilapia MC4R
It was reported that MC4R displays a basal constitutive activity and AgRP can act as an inverse agonist to inhibit this basal constitutive activity in mammals, birds, and zebrafish [3,5,29]. To investigate whether AgRP can inhibit the basal activity of tilapia MC4R, using a dual-luciferase reporter system [5], we analyzed the inhibitory action of recombinant human AgRP on the basal constitutive activity of tilapia MC4R in the absence or presence of MRAP2b.
As shown in Figure 7, tilapia MC4R displays a strong basal constitutive activity and induces a 4-fold increase in the luciferase activity of CHO cells expressing MC4R; however, its basal activity could be significantly inhibited by the co-expression of tilapia MRAP2b.
In addition, 10 nM of human AgRP could weakly, but significantly, inhibit the basal activity of MC4R in the absence of MRAP2; however, this inhibitory effect was attenuated by the presence of MRAP2b. This finding indicates that AgRP could act as an inverse agonist for tilapia MC4R (Figure 7).
2.4. AgRP Can Antagonize ACTH/α-MSH Actions on MC4R
To determine whether AgRP can antagonize the action of α-MSH or ACTH on tilapia MC4R in the presence or absence of MRAP2b, tilapia MC4R was expressed alone or co-expressed with MRAP2b in CHO cells; then, it was investigated by co-treatment with 10 nM tilapia α-MSH/ACTH and human AgRP (1 nM and 10 nM). As shown in Figure 8, AgRP could block the effect of α-MSH or ACTH on tilapia MC4R dose-dependently, either in the absence or presence of MRAP2b.
2.5. Tissue Expression of MC4R, MRAP2b, POMCs, and AgRPs in Tilapia
To examine the tissue expression of the MC4R signaling system in tilapia, we analyzed the transcriptomic data of tilapia tissues (kidneys, heart, skin, eye, blood, ovaries, liver, testes, brain, skeletal muscle, and whole embryos) submitted to the SRA Library of NCBI Database. As shown in Figure 9, all the genes of the MC4R signaling system (MC4R, MRAP2b, AgRP, AgRP2, POMCa1, POMCa2, and POMCb) were found to be abundantly expressed in brain tissue. Interestingly, we also found the mRNA expression of some of these genes in the testes (MC4R, MRAP2b, AgRP, AgRP2, and POMCa2), whole embryos (MC4R, MRAP2b, AgRP2, and POMCa1), ovaries (AgRP, POMCa2, and MC4R), eyes (MC4R and AgRP), kidneys (AgRP and POMCa2), skin (AgRP2 and POMCb), skeletal muscle (AgRP2), and heart (AgRP2) (Figure 9).
2.6. Fasting Induces Hypothalamic AgRP Expression in Growing Tilapia
Since all the genes of the MC4R signaling system are expressed in the brain, we further analyzed the RNA-seq data of the hypothalamus from growing tilapia (body weight: ≈38 g). As shown in Figure 10, all the genes are expressed in the hypothalamus. Moreover, we found that 3-day or 6-day fasting could increase the mRNA levels of AgRP by more than 2-fold (Figure 10), as detected by quantitative real-time RT-PCR.
3. Discussion
The MC4R signaling system has long been proposed to play important roles in the energy balance of teleosts, particularly in the regulation of appetite and growth [19,30,31]. However, the expression and functionality of this MC4R signaling system have not been fully characterized in teleosts. Here, we cloned the genes of the MC4R signaling system and characterized their interaction and expression. Moreover, we found that fasting could significantly induce AgRP expression in the hypothalamus. Our data supports the notion that the MC4R signaling system functions in teleosts in a way analogous to that in mammals and birds [2,3,5].
3.1. Identification of MC4R Signaling System in Nile Tilapia
Although MC4R, MRAP2, AgRPs, and POMCs have been predicted to exist in the tilapia genome, the cDNAs of most genes have not been cloned [23,32,33]. In this study, we cloned the coding regions of the six genes from the tilapia brain.
Interestingly, three POMC paralogs (named POMCa1, POMCa2, and POMCb) have been identified, similar to previous reports in other ray-finned fish, such as barifin flounder, cichlid fish, and sea bream [22,23,34,35]. As in other teleosts, three tilapia POMC precursors are likely capable of producing three bioactive peptides, namely α-MSH, β-MSH, and ACTH; however, they cannot produce ɤ-MSH present in lungfish, paddlefish, sturgeons, and tetrapods [36,37,38,39]. Moreover, similar to human POMC, tilapia POMCa1 and POMCa2 are likely capable of producing β-endorphins [7,33]. Interestingly, unlike POMCa1 and POMCa2, tilapia POMCb can produce an additional ε-MSH (SYRMEHFRWGKAP), which is also present in the cichlid POMC precursor [23], but it cannot produce a bioactive β-endorphin (which lacks the ‘YGFFM’ motif crucial for the bioactivity of opioid peptides) (Table 1) [7,40]. It was reported that the tissue-specific processing of the POMC precursor by prohormone convertases (PCs) could produce distinct bioactive peptides in target tissues. For instance, in mammals, under the endoproteolytic processing of PC1/3, the POMC precursor can produce mainly ACTH and a minor portion of β-endorphin in pituitary corticotrophs, whereas under the processing of PC2 (and PC1/3), the POMC precursor can produce α-MSH, β-MSH, and β-endorphin as the end products in the hypothalamus and intermediate pituitary [7]. Therefore, the presence of multiple tilapia POMCs also raises an open question of whether all the bioactive peptides listed in Table 1 can be produced after post-translational processing in vivo.
In addition to POMCs, we also identified and cloned two AgRPs (AgRP and AgRP2) from the tilapia brain, similar to the findings in other teleosts (e.g., zebrafish, sea bass, and medaka). Synteny analysis revealed that tilapia AgRP is orthologous to AgRP of humans, chickens, and zebrafish, and it shares a high amino acid sequence identity to human AgRP (Supplementary Materials Figure S1) [24], while AgRP2 seems to exist in teleosts, but it is likely lost in tetrapods, as previously proposed [13]. Although the amino acid sequence identity shared between the two AgRPs is low (23.4% identity), the cysteine knot structure essential for their confirmation and biological functions are fully conserved in the two proteins, indicating that the two AgRPs are likely originated from an ancestral gene [13].
In this study, we also cloned MC4R and MRAP2b from tilapia brain. Synteny analysis showed that both genes are orthologous to the MC4R and MRAP2 of humans, chickens, and zebrafish (MRAP2b) [4,5]. Sequence comparison revealed that MC4R is extremely conserved across vertebrates, particularly in the transmembrane regions. Although MRAP2b shows a high degree of variation in its cytoplasmic tail, the transmembrane domain and ‘LKAHRYS’ motif for anti-parallel homodimer formation are highly conserved across vertebrates [9]. The cloning of these genes confirms the presence and expression of the MC4R signaling system in Nile tilapia, as previously reported in chickens and mammals [5].
3.2. The Functionality of the Tilapia MC4R Signaling System
The presence of all MC4R signaling components in tilapia led us to further examine their interaction in vitro. We elucidated that in the absence of MRAP2b, tilapia MC4R could be potently activated by tilapia ACTH1-40, α-MSH, and β-MSH and stimulate the cAMP/PKA signaling pathway, as monitored by pGL3-CRE-luciferease reporter assay. This finding indicates that as in chickens, ACTH, α-MSH, and β-MSH can function as the ligands for tilapia MC4R [5]. Our finding partly agrees with recent findings in spotted gar, tilapia, topmouth culter, and zebrafish, showing that MC4R could be activated by mammalian α-MSH (or NDP-α-MSH) and ACTH1-24/ACTH1-39 with similar potencies [3,15,41,42]. Interestingly, in the presence of MRAP2b, the sensitivity and selectivity of MC4R for ACTH1-40 increase by ≈8-fold (EC50: 0.246 nM vs. 0.032 nM), while its sensitivity to α-MSH and β-MSH shows little or no change (Table 2). This finding clearly indicates that MC4R can interact with MRAP2b, and thus, it acts as an ‘ACTH-preferring receptor’ in tilapia. Our finding contrasts that from a recent study in tilapia, in which MRAP2b cannot significantly alter the EC50 value of ACTH1-39 in activating tilapia MC4R when expressed in HEK293 cells [41]. The reason for this discrepancy is unknown. However, our finding is consistent with the findings in chickens [5], zebrafish [3], and humans [43], in which MC4R becomes an ACTH-preferring receptor in the presence of MRAP2. Taken together with our co-IP assay results showing the interaction of tilapia MRAP2b with MC4R in vitro (Figure 6), our findings strongly suggest that tilapia MC4R can interact with MRAP2b and act as an ‘ACTH-preferring receptor’.
It was reported that MC4R has a high basal constitutive activity in chickens and mammals [1]. In this study, we proved that tilapia MC4R also has a strong basal constitutive activity, as monitored by dual-luciferase reporter assay. Moreover, we found that MRAP2b can inhibit the basal constitutive activity of tilapia MC4R, as recently reported in orange-spotted grouper, topmouth culter, and tilapia [15,41,42].
In mammals and chickens, AgRP has been demonstrated to function either as an antagonist to block the action of α-MSH and/or ACTH on MC4R, or as an inverse agonist to inhibit the basal activity of MC4R [1,5]. Here, we proved that as in chickens [5], AgRP can dose-dependently block the action of α-MSH and ACTH1-40 on tilapia MC4R activation in the presence or absence of MRAP2b. Moreover, AgRP can inhibit the basal activity of tilapia MC4R, and this inhibitory effect diminishes in the presence of MRAP2b. All these findings confirm that as in mammals and birds, AgRP can function as both the antagonist and inverse agonist of MC4R in tilapia [1,5,41]. Since we have no recombinant tilapia AgRP2 in our hands, it remains unclear whether tilapia AgRP2 has a function similar to that of AgRP. However, there is a piece of evidence showing that AgRP2 functions as a potent antagonist of melanocortin receptor 1 (MC1R) in zebrafish [25]. Considering the high structural similarity shared between tilapia and zebrafish AgRP2 (45% sequence identity), it implies that similar to that in zebrafish, the action of AgRP2 is likely mediated by MC1R in tilapia [25].
3.3. Tissue Expression of MC4R Signaling System in Tilapia
Using the transcriptomic data of 10 tilapia tissues and whole embryos deposited in the public database, we analyzed the tissue expression of the MC4R signaling system and found that the expression of MC4R, MRAP2b, AgRP, AgRP2, POMCa1, POMCa2, and POMCb is restricted to the brain and several extra-brain tissues (e.g., gonads) (Figure 9).
In the brain, all genes were detected to be highly or moderately expressed. This finding is consistent with previous reports in teleosts, such as zebrafish [3] and medaka [6], in which all the genes are expressed in the brain as detected by qRT-PCR assays. Furthermore, we found that all the genes are expressed in the hypothalamus of growing tilapia, suggesting that the central MC4R signaling system plays roles in the control of feeding and energy balance in tilapia. In agreement with this speculation, we proved that 3-day or 6-day fasting causes a > 2-fold increase of AgRP expression in tilapia hypothalamus, suggesting AgRP may play a role in the regulation of appetite and energy balance. Our observation is consistent with the findings in zebrafish [24], sea bass [44], and goldfish [31] in which fasting increases AgRP expression in their hypothalamus. In addition, the injection of MC4R antagonists (HS024) can stimulate food intake in goldfish and rainbow trout [30,45], and ip/icv injection of MC4R agonists (ACTH, MTII) can reduce the feeding in zebrafish [3], goldfish [30], and rainbow trouts [45]. Taken together, these evidence led us to hypothesize that as in zebrafish, AgRP and ACTH/α-MSH competitively act on the MC4R or MC4R-MRAP2 complex, to regulate feeding and growth in Nile tilapia (Figure 11) [3]. Although two AgRPs are expressed in the hypothalamus of teleosts such as zebrafish and tilapia, only AgRP has been reported to be expressed in the zebrafish/goldfish hypothalamic lateral tuberal nucleus, which is a structure homologous to mammalian arcuate nucleus [31]. Since AgRP2 has been proven to be a potent antagonist of MC1R (not MC4R) in zebrafish [25], the central action of AgRP2 seems unlikely to be mediated by MC4R.
Outside the brain, POMCa1 is predominantly expressed in tilapia pituitary (Figure 10), while other components of the MC4R system show little or no expression. This finding differs from those in barfin flounder and gilthead sea bream, in which both POMCa1 and POMCa2 are abundantly expressed in pituitary melanotrophs and corticotrophs [34,46,47]. The predominant expression of POMCa1 in tilapia pituitary suggests that ACTH and α-MSH derived from the POMCa1 precursor can be released from corticotrophs and melanotrophs respectively and act on peripheral tissues via an endocrine route, such as the regulation of skin pigmentation and inter-renal cortisol production [48].
Of particular interest to note is that POMCb is highly expressed in the skin. Similarly, POMCb is also expressed in the skin of barfin flounder [35,48]. In addition, α-MSH/ACTH immunoreactivity was detected in the germinal layer of African lungfish skin epidermis [49]. These findings support the hypothesis that α-MSH/ACTH can be synthesized by the skin; thus, skin pigmentation is likely controlled by α-MSH/ACTH produced from the pituitary (e.g., POMCa1) and skin (POMCb) in teleosts [48].
In this study, we found that MC4R is expressed in tilapia gonads, including the testes and ovaries. Moreover, tilapia AgRP, POMCa1, and MRAP2b were found to be expressed in the testes and AgRP and POMCa2 were found to be expressed in the ovaries (Figure 9). This concurs with previous findings in other fish, such as the expression of MC4R, MRAP2b, AgRP, and POMCb in medaka gonads [6], and MC4R in the testes and/or ovaries of barfin flounder [50], sea bass [51], and goldfish [30]. Taken together, these findings support that MC4R and their ligands (either derived locally or from the pituitary) play important roles in gonadal development and functions in teleosts, such as the stimulation of testosterone production in the testes, as previously reported in mice [52]. In addition, we found a weak expression of MC4R and AgRP in the eyes, and POMCa1, POMCa2, and POMCb in the kidneys. The question of whether MC4R signaling plays a role in these tissues remains to be clarified.
Apart from the expression of MC4R in adult tilapia tissues, MC4R, MRAP2b, and POMCa1 are expressed in whole embryos (Figure 9). Similarly, MC4R and MRAP2 are expressed at the late neurula stage and early stage of brain development, and POMCa1 is expressed two days later than MC4R in medaka embryos. Moreover, gene knockout of MC4R delays hatching [6]. These findings hint that MC4R signaling plays important roles in the embryonic development of teleosts (e.g., brain development), even in the absence of its ligands. Future study on this topic would provide more clues on this issue.
In summary, we cloned six genes of the MC4R signaling system in a representative teleost species, Nile tilapia. Functional study proved that MC4R can interact with MRAP2b and mediate the actions of α-MSH, ACTH, and AgRP in vitro. Moreover, we demonstrated that MRAP2b cannot only inhibit the basal constitutive activity of MC4R, but also increase its sensitivity and selectivity for ACTH, thus becoming an ACTH-preferring receptor. These findings, together with evidence showing the co-expression of MC4R, POMCs, AgRP, and MRAP2b in the hypothalamus, strongly suggest that the MC4R signaling system plays a conserved role in the regulation of food intake and growth in Nile tilapia (Figure 11). Considering that Nile tilapia is a freshwater fish of economic importance worldwide, our data provides a theoretical basis to improve the economic traits of tilapia, such as promoting the appetite and growth via modifying MC4R signaling (e.g., gene-editing MC4R system) in aquaculture.
4. Materials and Methods
4.1. Chemicals, Primers, Peptides, and Antibodies
All chemicals were purchased from Sigma-Aldrich, and restriction enzymes were obtained from TaKaRa. Plasmid vector pTA2 used for the T/A cloning of PCR products was purchased from TOYOBO Company. The eukaryotic expression vector is pcDNA3.1 (+) purchased from Invitrogen (Carlsbad, CA, USA). Tilapia (ti-) ACTH1-40, α-MSH (acetyl-α-MSH with an amidated C-terminus), and β-MSH were synthesized by GL Biochem Ltd. (Shanghai, China). The purity of synthesized peptides is more than 95% (analyzed by HPLC), and their structures were verified by mass spectrometry. Recombinant human AgRP protein (Cat no. 704-AG) was purchased from R&D Systems. RNAzol was purchased from the Molecular Research Center (Cincinnati, Ohio, USA). Anti-Flag Affinity Gel beads were purchased from Bimake (Bimake, Houston, TX, USA). Rabbit anti-MRAP2 antibody (612249) and mouse anti-Myc-tag antibody (R950-25) were obtained from Chengdu Zhengneng Company (Zhengneng, Chengdu, China) and Thermo Scientific (Asheville, NC, USA), respectively. All the primers used in this study were synthesized by Chengdu Qingke and listed in Table S1.
4.2. Animals, Tissues, and Ethical Statement
Tilapia (GIFT, Genetic Improvement of Farmed Tilapia, Oreochromis niloticus, ♂) were purchased from the Chongqing Freshwater Aquaculture Farm (Chongqing, China). Tilapia (weight 35–50 g) were cultured in the experimental culture system of the College of Life Sciences, Sichuan University. Fish were anesthetized with buffered MS-222 (Sigma-Aldrich, St. Louis, MO, USA) and then dissected. The tissues (hypothalamus and pituitary) were collected, quickly frozen in liquid nitrogen, and stored at −80 °C until use. All animal experimental protocols used in this study were approved by the Animal Ethics Committee of College of Life Sciences, Sichuan University, and the assurance number is 20200902001 (2 September 2020).
4.3. Total RNA Extraction and Reverse Transcription (RT)
Total RNA was extracted from tilapia tissues using RNAzol and dissolved in DEPC-treated H2O. These RNA samples were reversely transcribed by Moloney murine leukemia virus (MMLV) reverse transcriptase (Takara) and were used for the PCR amplification of target genes as described in our recent study [53].
4.4. Cloning of Tilapia MC4R, MRAP2, POMCs, and AgRPs
With reference to the cDNAs of human and zebrafish MC4R, MRAP2, POMCs, and AgRP, we searched the tilapia genome (http://www.ensembl.org/Oreochromis_niloticus) and identified the DNA fragments of the above genes. Then, the primers were designed based on this information. The cDNAs from tilapia brain tissue were used as a template for PCR amplification, and the PCR products were cloned into pTA2 vector (TOYOBO, Japan) and sequenced by the Beijing Genome Institute (BGI). Finally, the coding regions of tilapia MC4R, MRAP2 (named MRAP2b in this study), POMCs, and AgRPs were determined.
4.5. RNA-Seq Analysis of MC4R, MRAP2b, POMCs, and AgRPs in Tilapia Tissues
The RNA Seq data (BioProject: PRJNA78915) obtained by Brawand et al. were used to analyze the expression of the MC4R signaling system in adult tilapia [54]. RNA-Seq data were downloaded from the NCBI website (http://www.ncbi.nlm.nih.gov/sra). With reference to the Orenil 1.0 transcription group (Ensembl 94 edition), we quantified the gene expression level using the transcript quantitative analysis tool Salmon v0.10.2 and default parameters. The relative abundance of tilapia MC4R, MRAP2b, POMCa1, POMCa2, POMCb, AgRP, and AgRP2 transcripts are expressed as the transcripts per million (TPM) of each million reads.
The transcriptome of the hypothalamus and pituitary of growing tilapia (≈40 g body weight) available in our lab was also studied using the same approach as above.
4.6. Quantitative Real-Time RT-PCR Assay (qRT-PCR)
To determine whether fasting can alter hypothalamic AgRP expression, 80 tilapia (♂) of uniform bodyweight (37–38 g) at the growing stage were divided into four groups: two control groups and two fasting groups. After fasting for 3 days and 6 days, the hypothalamus of tilapias were collected for total RNA extraction and subjected to quantitative real-time RT-PCR assay of AgRP expression, as described in our recent study [5,53].
4.7. Functional Analysis of tiMC4R and tiMRAP2b
Based on the cloned cDNAs of tilapia MC4R and MRAP2b, the coding regions of these genes were amplified by PCR with high-fidelity Taq DNA polymerase and cloned into pcDNA3.1 (+) vector. According to our established method, tilapia MC4R transiently expressed in CHO cells was treated by synthetic tilapia ACTH/α-MSH/β-MSH (10−10 to 10−9 M, 6 h), and then, the receptor-activated cAMP signaling pathway was monitored by a pGL3-CRE-Luciferase reporter system, which is capable of monitoring the receptor-mediated cAMP level [28,55]. To test whether tilapia MRAP2b could alter the pharmacological property of tilapia MC4R, CHO cells co-transfected with MRAP2 and receptor expression plasmids were treated by tilapia ACTH, α-MSH, and β-MSH, and the relative potencies of the three peptides in activating MC4R were evaluated by the mentioned reporter system [28,55].
4.8. Co-Immunoprecipitation (Co-IP) Assay
To investigate the interaction of tilapia MC4R with MRAP2, we first prepared the pcDNA3.1 (+) expression plasmids encoding an N-terminally Myc-tagged MRAP2b (pcDNA3.1-Myc-MRAP2b) and N-terminally Flag-tagged MC4R (pcDNA3.1-3XFlag-MC4R) [5]. The Co-IP assay was carried out as described in our previous study [5]. Then, Western blot was performed with mouse anti-Myc-tag antibody (1:2000) and rabbit anti-MRAP2 antibody (1:1000).
4.9. Detection of the Inverse Agonistic and Antagonistic Actions of AgRP
To evaluate whether AgRP could act as an inverse agonist to inhibit the basal constitutive activity of MC4R, or act as an antagonist to block the action of α-MSH/ACTH on MC4R activation, CHO cells transfected with tilapia MC4R expression plasmid, or co-transfected with MC4R and MRAP2 expression plasmid, were treated by recombinant human AgRP (1 nM and 10 nM) alone, or by both human AgRP (1nM and 10 nM) and tilapia α-MSH/ACTH(10 nM). Then, the receptor-mediated cAMP production was monitored by the pGL3-CRE-luciferase reporter system, as described in our recent study [5].
4.10. Data Analysis
The relative mRNA levels of hypothalamic AgRP were first normalized by β-actin and then expressed as a fold difference compared with their respective controls. The reporter assay data were analyzed by one-way ANOVA followed by Dunnett’s test. The dose–response curves were constructed using nonlinear regression models, and the corresponding half-maximal effective concentration (EC50) values were evaluated with Graphpad Prism 7 (GraphPad Software, San Diego, CA, USA). All experiments were repeated at least twice to validate our results.
Supplementary Materials
The following are available online at https://www.mdpi.com/1422-0067/21/19/7036/s1.
Author Contributions
Conceptualization, J.Z and Y.W.; methodology, J.Z. and J.L. (Juan Li); software, J.Z.; validation, Y.D., Z.Z. and B.C.; formal analysis, J.L. (Jing Li) and C.S.; investigation, Z.H. and J.L. (Jing Li); resources, T.L.; data curation, T.L., J.Z. and Y.D.; writing—original draft preparation, T.L., J.Z. and Y.W.; writing—review and editing, Y.W. and J.L. (Juan Li); visualization, J.Z.; supervision, J.L. (Juan Li) and Y.W. All authors have read and agreed to the published version of the manuscript.
Funding
This work was supported by grants from the National Natural Science Foundation of China (31572391, 31771375, 31772590), Sichuan Science and Technology Program (2019YJ0146, 2019YJ0017) and China Postdoctoral Science Foundation Funded Project (2019M653412).
Conflicts of Interest
The authors declare no conflict of interest. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results.
References
- 1.Cone R.D. Studies on the physiological functions of the melanocortin system. Endocr. Rev. 2006;27:736–749. doi: 10.1210/er.2006-0034. [DOI] [PubMed] [Google Scholar]
- 2.Asai M., Ramachandrappa S., Joachim M., Shen Y., Zhang R., Nuthalapati N., Ramanathan V., Strochlic D.E., Ferket P., Linhart K., et al. Loss of function of the melanocortin 2 receptor accessory protein 2 is associated with mammalian obesity. Science. 2013;341:275–278. doi: 10.1126/science.1233000. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Josep Agulleiro M., Cortes R., Fernandez-Duran B., Navarro S., Guillot R., Meimaridou E., Clark A.J., Cerda-Reverter J.M. Melanocortin 4 receptor becomes an ACTH receptor by coexpression of melanocortin receptor accessory protein 2. Mol. Endocrinol. 2013;27:1934–1945. doi: 10.1210/me.2013-1099. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Sebag J.A., Zhang C., Hinkle P.M., Bradshaw A.M., Cone R.D. Developmental control of the melanocortin-4 receptor by MRAP2 proteins in zebrafish. Science. 2013;341:278–281. doi: 10.1126/science.1232995. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Zhang J., Li X., Zhou Y., Cui L., Li J., Wu C., Wan Y., Li J., Wang Y. The interaction of MC3R and MC4R with MRAP2, ACTH, alpha-MSH and AgRP in chickens. J. Endocrinol. 2017;234:155–174. doi: 10.1530/JOE-17-0131. [DOI] [PubMed] [Google Scholar]
- 6.Liu R., Kinoshita M., Adolfi M.C., Schartl M. Analysis of the Role of the Mc4r System in Development, Growth, and Puberty of Medaka. Front. Endocrinol. 2019;10:213. doi: 10.3389/fendo.2019.00213. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Dores R.M., Baron A.J. Evolution of POMC: Origin, phylogeny, posttranslational processing, and the melanocortins. Ann. N. Y. Acad. Sci. 2011;1220:34–48. doi: 10.1111/j.1749-6632.2010.05928.x. [DOI] [PubMed] [Google Scholar]
- 8.Kleinau G., Heyder N.A., Tao Y.-X., Scheerer P. Structural Complexity and Plasticity of Signaling Regulation at the Melanocortin-4 Receptor. Int. J. Mol. Sci. 2020;21:5728. doi: 10.3390/ijms21165728. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Sebag J.A., Hinkle P.M. Regions of melanocortin 2 (MC2) receptor accessory protein necessary for dual topology and MC2 receptor trafficking and signaling. J. Biol. Chem. 2009;284:610–618. doi: 10.1074/jbc.M804413200. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Huszar D., Lynch C.A., Fairchild-Huntress V., Dunmore J.H., Fang Q., Berkemeier L.R., Gu W., Kesterson R.A., Boston B.A., Cone R.D., et al. Targeted disruption of the melanocortin-4 receptor results in obesity in mice. Cell. 1997;88:131–141. doi: 10.1016/S0092-8674(00)81865-6. [DOI] [PubMed] [Google Scholar]
- 11.Ollmann M.M., Wilson B.D., Yang Y.K., Kerns J.A., Chen Y., Gantz I., Barsh G.S. Antagonism of central melanocortin receptors in vitro and in vivo by agouti-related protein. Science. 1997;278:135–138. doi: 10.1126/science.278.5335.135. [DOI] [PubMed] [Google Scholar]
- 12.Graham M., Shutter J.R., Sarmiento U., Sarosi I., Stark K.L. Overexpression of Agrt leads to obesity in transgenic mice. Nat. Genet. 1997;17:273–274. doi: 10.1038/ng1197-273. [DOI] [PubMed] [Google Scholar]
- 13.Vastermark A., Krishnan A., Houle M.E., Fredriksson R., Cerda-Reverter J.M., Schioth H.B. Identification of distant Agouti-like sequences and re-evaluation of the evolutionary history of the Agouti-related peptide (AgRP) PLoS ONE. 2012;7:e40982. doi: 10.1371/journal.pone.0040982. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Dores R.M. Hypothesis and Theory: Revisiting Views on the Co-evolution of the Melanocortin Receptors and the Accessory Proteins, MRAP1 and MRAP2. Front. Endocrinol. 2016;7:1–12. doi: 10.3389/fendo.2016.00079. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Rao Y.Z., Chen R., Zhang Y., Tao Y.X. Orange-spotted grouper melanocortin-4 receptor: Modulation of signaling by MRAP2. Gen. Comp. Endocrinol. 2019;284:113234. doi: 10.1016/j.ygcen.2019.113234. [DOI] [PubMed] [Google Scholar]
- 16.Volkoff H. The Neuroendocrine Regulation of Food Intake in Fish: A Review of Current Knowledge. Front. Neurosci. 2016;10:540. doi: 10.3389/fnins.2016.00540. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Song Y., Cone R.D. Creation of a genetic model of obesity in a teleost. FASEB J. 2007;21:2042–2049. doi: 10.1096/fj.06-7503com. [DOI] [PubMed] [Google Scholar]
- 18.Zhong C., Song Y., Wang Y., Zhang T., Duan M., Li Y., Liao L., Zhu Z., Hu W. Increased food intake in growth hormone-transgenic common carp (Cyprinus carpio L.) may be mediated by upregulating Agouti-related protein (AgRP) Gen. Comp. Endocrinol. 2013;192:81–88. doi: 10.1016/j.ygcen.2013.03.024. [DOI] [PubMed] [Google Scholar]
- 19.Cerda-Reverter J.M., Schioth H.B., Peter R.E. The central melanocortin system regulates food intake in goldfish. Regul. Pept. 2003;115:101–113. doi: 10.1016/S0167-0115(03)00144-7. [DOI] [PubMed] [Google Scholar]
- 20.White S.L., Volkoff H., Devlin R.H. Regulation of feeding behavior and food intake by appetite-regulating peptides in wild-type and growth hormone-transgenic coho salmon. Horm. Behav. 2016;84:18–28. doi: 10.1016/j.yhbeh.2016.04.005. [DOI] [PubMed] [Google Scholar]
- 21.Zhang J., Li J., Wu C., Hu Z., An L., Wan Y., Fang C., Zhang X., Li J., Wang Y. The Asp298Asn polymorphism of melanocortin-4 receptor (MC4R) in pigs: Evidence for its potential effects on MC4R constitutive activity and cell surface expression. Anim. Genet. 2020;51:694–706. doi: 10.1111/age.12986. [DOI] [PubMed] [Google Scholar]
- 22.Takahashi A., Amano M., Itoh T., Yasuda A., Yamanome T., Amemiya Y., Sasaki K., Sakai M., Yamamori K., Kawauchi H. Nucleotide sequence and expression of three subtypes of proopiomelanocortin mRNA in barfin flounder. Gen. Comp. Endocrinol. 2005;141:291–303. doi: 10.1016/j.ygcen.2005.01.010. [DOI] [PubMed] [Google Scholar]
- 23.Harris R.M., Dijkstra P.D., Hofmann H.A. Complex structural and regulatory evolution of the pro-opiomelanocortin gene family. Gen. Comp. Endocrinol. 2014;195:107–115. doi: 10.1016/j.ygcen.2013.10.007. [DOI] [PubMed] [Google Scholar]
- 24.Song Y., Golling G., Thacker T.L., Cone R.D. Agouti-related protein (AGRP) is conserved and regulated by metabolic state in the zebrafish, Danio rerio. Endocrine. 2003;22:257–265. doi: 10.1385/ENDO:22:3:257. [DOI] [PubMed] [Google Scholar]
- 25.Zhang C., Song Y., Thompson D.A., Madonna M.A., Millhauser G.L., Toro S., Varga Z., Westerfield M., Gamse J., Chen W., et al. Pineal-specific agouti protein regulates teleost background adaptation. Proc. Natl. Acad. Sci. USA. 2010;107:20164–20171. doi: 10.1073/pnas.1014941107. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Webb T.R., Clark A.J. Minireview: The melanocortin 2 receptor accessory proteins. Mol. Endocrinol. 2010;24:475–484. doi: 10.1210/me.2009-0283. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Navarro S., Soletto L., Puchol S., Rotllant J., Soengas J.L., Cerda-Reverter J.M. 60 YEARS OF POMC: POMC: An evolutionary perspective. J. Mol. Endocrinol. 2016;56:T113–T118. doi: 10.1530/JME-15-0288. [DOI] [PubMed] [Google Scholar]
- 28.Wang Y., Li J., Wang C.Y., Kwok A.H., Leung F.C. Identification of the endogenous ligands for chicken growth hormone-releasing hormone (GHRH) receptor: Evidence for a separate gene encoding GHRH in submammalian vertebrates. Endocrinology. 2007;148:2405–2416. doi: 10.1210/en.2006-1013. [DOI] [PubMed] [Google Scholar]
- 29.Nijenhuis W.A., Oosterom J., Adan R.A. AgRP(83-132) acts as an inverse agonist on the human-melanocortin-4 receptor. Mol. Endocrinol. 2001;15:164–171. doi: 10.1210/mend.15.1.0578. [DOI] [PubMed] [Google Scholar]
- 30.Cerda-Reverter J.M., Ringholm A., Schioth H.B., Peter R.E. Molecular cloning, pharmacological characterization, and brain mapping of the melanocortin 4 receptor in the goldfish: Involvement in the control of food intake. Endocrinology. 2003;144:2336–2349. doi: 10.1210/en.2002-0213. [DOI] [PubMed] [Google Scholar]
- 31.Cerda-Reverter J.M., Peter R.E. Endogenous melanocortin antagonist in fish: Structure, brain mapping, and regulation by fasting of the goldfish agouti-related protein gene. Endocrinology. 2003;144:4552–4561. doi: 10.1210/en.2003-0453. [DOI] [PubMed] [Google Scholar]
- 32.Metz J.R., Peters J.J., Flik G. Molecular biology and physiology of the melanocortin system in fish: A review. Gen. Comp. Endocrinol. 2006;148:150–162. doi: 10.1016/j.ygcen.2006.03.001. [DOI] [PubMed] [Google Scholar]
- 33.Lee J., Danielson P., Sollars C., Alrubaian J., Balm P., Dores R.M. Cloning of a neoteleost (Oreochromis mossambicus) pro-opiomelanocortin (POMC) cDNA reveals a deletion of the gamma-melanotropin region and most of the joining peptide region: Implications for POMC processing. Peptides. 1999;20:1391–1399. doi: 10.1016/S0196-9781(99)00148-5. [DOI] [PubMed] [Google Scholar]
- 34.Cardoso J.C., Laiz-Carrion R., Louro B., Silva N., Canario A.V., Mancera J.M., Power D.M. Divergence of duplicate POMC genes in gilthead sea bream Sparus auratus. Gen. Comp. Endocrinol. 2011;173:396–404. doi: 10.1016/j.ygcen.2010.12.001. [DOI] [PubMed] [Google Scholar]
- 35.Kang D.Y., Kim H.C. Functional relevance of three proopiomelanocortin (POMC) genes in darkening camouflage, blind-side hypermelanosis, and appetite of Paralichthys olivaceus. Comp. Biochem. Physiol. B Biochem. Mol. Biol. 2015;179:44–56. doi: 10.1016/j.cbpb.2014.09.002. [DOI] [PubMed] [Google Scholar]
- 36.Dores R.M., Sollars C., Danielson P., Lee J., Alrubaian J., Joss J.M. Cloning of a proopiomelanocortin cDNA from the pituitary of the Australian lungfish, Neoceratodus forsteri: Analyzing trends in the organization of this prohormone precursor. Gen. Comp. Endocrinol. 1999;116:433–444. doi: 10.1006/gcen.1999.7382. [DOI] [PubMed] [Google Scholar]
- 37.Lee J., Lecaude S., Danielson P., Sollars C., Alrubaian J., Propper C.R., Lihrmann I., Vaudry H., Dores R.M. Cloning of proopiomelanocortin from the brain of the african lungfish, Protopterus annectens, and the brain of the western spadefoot toad, Spea multiplicatus. Neuroendocrinology. 1999;70:43–54. doi: 10.1159/000054458. [DOI] [PubMed] [Google Scholar]
- 38.Danielson P.B., Alrubaian J., Muller M., Redding J.M., Dores R.M. Duplication of the POMC gene in the paddlefish (Polyodon spathula): Analysis of gamma-MSH, ACTH, and beta-endorphin regions of ray-finned fish POMC. Gen. Comp. Endocrinol. 1999;116:164–177. doi: 10.1006/gcen.1999.7353. [DOI] [PubMed] [Google Scholar]
- 39.Alrubaian J., Danielson P., Fitzpatrick M., Schreck C., Dores R.M. Cloning of a second proopiomelanocortin cDNA from the pituitary of the sturgeon, Acipenser transmontanus. Peptides. 1999;20:431–436. doi: 10.1016/S0196-9781(99)00021-2. [DOI] [PubMed] [Google Scholar]
- 40.Bu G., Cui L., Lv C., Lin D., Huang L., Li Z., Li J., Zeng X., Wang Y. Opioid Peptides and Their Receptors in Chickens: Structure, Functionality, and Tissue Distribution. Peptides. 2020;128:170307. doi: 10.1016/j.peptides.2020.170307. [DOI] [PubMed] [Google Scholar]
- 41.Wang M., Chen Y., Zhu M., Xu B., Guo W., Lyu Y., Zhang C. Pharmacological modulation of melanocortin-4 receptor by melanocortin receptor accessory protein 2 in Nile tilapia. Gen. Comp. Endocrinol. 2019;282:113219. doi: 10.1016/j.ygcen.2019.113219. [DOI] [PubMed] [Google Scholar]
- 42.Tao M., Ji R.-L., Huang L., Fan S.-Y., Liu T., Liu S.-J., Tao Y.-X. Regulation of melanocortin-4 receptor pharmacology by two isoforms of melanocortin receptor accessory protein 2 in topmouth culter (Culter alburnus) Front. Endocrinol. 2020;11:538. doi: 10.3389/fendo.2020.00538. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Soletto L., Hernandez-Balfago S., Rocha A., Scheerer P., Kleinau G., Cerda-Reverter J.M. Melanocortin Receptor Accessory Protein 2-Induced Adrenocorticotropic Hormone Response of Human Melanocortin 4 Receptor. J. Endocr. Soc. 2019;3:314–323. doi: 10.1210/js.2018-00370. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Agulleiro M.J., Cortes R., Leal E., Rios D., Sanchez E., Cerda-Reverter J.M. Characterization, tissue distribution and regulation by fasting of the agouti family of peptides in the sea bass (Dicentrarchus labrax) Gen. Comp. Endocrinol. 2014;205:251–259. doi: 10.1016/j.ygcen.2014.02.009. [DOI] [PubMed] [Google Scholar]
- 45.Schjolden J., Schioth H.B., Larhammar D., Winberg S., Larson E.T. Melanocortin peptides affect the motivation to feed in rainbow trout (Oncorhynchus mykiss) Gen. Comp. Endocrinol. 2009;160:134–138. doi: 10.1016/j.ygcen.2008.11.003. [DOI] [PubMed] [Google Scholar]
- 46.Takahashi A., Amano M., Amiya N., Yamanome T., Yamamori K., Kawauchi H. Expression of three proopiomelanocortin subtype genes and mass spectrometric identification of POMC-derived peptides in pars distalis and pars intermedia of barfin flounder pituitary. Gen. Comp. Endocrinol. 2006;145:280–286. doi: 10.1016/j.ygcen.2005.09.005. [DOI] [PubMed] [Google Scholar]
- 47.Kobayashi Y., Chiba H., Amiya N., Yamanome T., Mizusawa K., Amano M., Takahashi A. Transcription elements and functional expression of proopiomelanocortin genes in the pituitary gland of the barfin flounder. Gen. Comp. Endocrinol. 2008;158:259–267. doi: 10.1016/j.ygcen.2008.07.015. [DOI] [PubMed] [Google Scholar]
- 48.Takahashi A., Kobayashi Y., Amano M., Yamanome T. Structural and functional diversity of proopiomelanocortin in fish with special reference to barfin flounder. Peptides. 2009;30:1374–1382. doi: 10.1016/j.peptides.2009.04.014. [DOI] [PubMed] [Google Scholar]
- 49.Masini M.A., Sturla M., Pestarino M., Facchinetti F., Gallinelli A., Uva B.M. Proopiomelanocortin (POMC) mRNA and POMC-derived peptides immunolocalization in the skin of Protopterus annectens, an African lungfish. Peptides. 1999;20:87–91. doi: 10.1016/S0196-9781(98)00145-4. [DOI] [PubMed] [Google Scholar]
- 50.Kobayashi Y., Tsuchiya K., Yamanome T., Schioth H.B., Kawauchi H., Takahashi A. Food deprivation increases the expression of melanocortin-4 receptor in the liver of barfin flounder, Verasper moseri. Gen. Comp. Endocrinol. 2008;155:280–287. doi: 10.1016/j.ygcen.2007.05.010. [DOI] [PubMed] [Google Scholar]
- 51.Sanchez E., Rubio V.C., Thompson D., Metz J., Flik G., Millhauser G.L., Cerda-Reverter J.M. Phosphodiesterase inhibitor-dependent inverse agonism of agouti-related protein on melanocortin 4 receptor in sea bass (Dicentrarchus labrax) Am. J. Physiol. Regul. Integr. Comp. Physiol. 2009;296:R1293–R1306. doi: 10.1152/ajpregu.90948.2008. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52.O’Shaughnessy P.J., Fleming L.M., Jackson G., Hochgeschwender U., Reed P., Baker P.J. Adrenocorticotropic hormone directly stimulates testosterone production by the fetal and neonatal mouse testis. Endocrinology. 2003;144:3279–3284. doi: 10.1210/en.2003-0277. [DOI] [PubMed] [Google Scholar]
- 53.Liu H., Luo Q., Zhang J., Mo C., Wang Y., Li J. Endothelins (EDN1, EDN2, EDN3) and their receptors (EDNRA, EDNRB, EDNRB2) in chickens: Functional analysis and tissue distribution. Gen. Comp. Endocrinol. 2019;283:113231. doi: 10.1016/j.ygcen.2019.113231. [DOI] [PubMed] [Google Scholar]
- 54.Brawand D., Wagner C.E., Li Y.I., Malinsky M., Keller I., Fan S., Simakov O., Ng A.Y., Lim Z.W., Bezault E. The genomic substrate for adaptive radiation in African cichlid fish. Nature. 2014;513:375–381. doi: 10.1038/nature13726. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 55.Mo C., Huang L., Cui L., Lv C., Lin D., Song L., Zhu G., Li J., Wang Y. Characterization of NMB, GRP and their receptors (BRS3, NMBR and GRPR) in chickens. J. Mol. Endocrinol. 2017;59:61–79. doi: 10.1530/JME-17-0020. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.