Skip to main content
Scientific Reports logoLink to Scientific Reports
. 2020 Dec 8;10:21471. doi: 10.1038/s41598-020-78319-w

AnOxPePred: using deep learning for the prediction of antioxidative properties of peptides

Tobias Hegelund Olsen 1, Betül Yesiltas 2, Frederikke Isa Marin 1, Margarita Pertseva 1, Pedro J García-Moreno 2, Simon Gregersen 3, Michael Toft Overgaard 3, Charlotte Jacobsen 2, Ole Lund 2, Egon Bech Hansen 2, Paolo Marcatili 1,
PMCID: PMC7722737  PMID: 33293615

Abstract

Dietary antioxidants are an important preservative in food and have been suggested to help in disease prevention. With consumer demands for less synthetic and safer additives in food products, the food industry is searching for antioxidants that can be marketed as natural. Peptides derived from natural proteins show promise, as they are generally regarded as safe and potentially contain other beneficial bioactivities. Antioxidative peptides are usually obtained by testing various peptides derived from hydrolysis of proteins by a selection of proteases. This slow and cumbersome trial-and-error approach to identify antioxidative peptides has increased interest in developing computational approaches for prediction of antioxidant activity and thereby reduce laboratory work. A few antioxidant predictors exist, however, no tool predicting the antioxidative properties of peptides is, to the best of our knowledge, currently available as a web-server. We here present the AnOxPePred tool and web-server (http://services.bioinformatics.dtu.dk/service.php?AnOxPePred-1.0) that uses deep learning to predict the antioxidant properties of peptides. Our model was trained on a curated dataset consisting of experimentally-tested antioxidant and non-antioxidant peptides. For a variety of metrics our method displays a prediction performance better than a k-NN sequence identity-based approach. Furthermore, the developed tool will be a good benchmark for future predictors of antioxidant peptides.

Subject terms: Machine learning, Protein function predictions

Introduction

Oxidation is a vital chemical reaction and as such is present in numerous processes both biological and non-biological. One effect from oxidation is the generation of free radicals, a group of molecules containing an unpaired electron, which are often highly reactive and unstable. These molecules can act as oxidants or reductants, by either donating the free electron or pairing it by accepting an electron from another molecule1,2. Free radicals, in low concentrations, are essential for several cellular processes, such as protein phosphorylation, activation of transcriptional factors, apoptosis, immunity, and differentiation3.

However, high concentrations of free radicals can damage the biological functionality of cells, leading to various diseases by reacting with vital cellular components, such as lipids, carbohydrates, proteins and DNA3. The damage incurred by excessive concentration of free radicals is termed oxidative stress13. Similar complications are seen in food, where spontaneous oxidization of fats, oils, flavouring substances, vitamins and colours can occur when exposed to air in the presence of heat, light, trace metals or already existing free radicals. As a result, undesirable odours, flavours and texture changes, as well as production of unhealthy compounds can occur4,5.

Antioxidants are a versatile group of molecules that either directly or indirectly counter the chain reaction initiated by the unpaired free radical electron, thereby reducing oxidative stress. Thus, the addition of antioxidants to food is a powerful approach to diminish food quality deterioration caused from oxidative stress4. Antioxidants can be categorized by their mode of action, although individual antioxidants can have more than one5.

Antioxidant groups include; (i) free radical scavengers (FRS), molecules that, in low concentrations, inhibit or quench free radicals, thereby delaying or hindering the damage from the free radicals6, (ii) chelators, which delay oxidation by forming complexes with metal ions, preventing them from initiating the formation of free radicals6, (iii) oxygen scavengers, that likewise delay oxidation by removing oxygen, minimizing deterioration reactions caused by oxygen7, and (iv) antioxidant regenerators, that reconstitute antioxidants after they quench free radicals8. In this paper we will focus on FRS and chelating peptides, as there is more experimental data available for those groups.

Currently, commercialized antioxidants comprises mainly synthetic molecules9. Primarily because synthetic antioxidants are cost-effective and efficient10. The disadvantage is their possible toxic and hazardous effects10. An increasing tendency among the public to prefer natural rather than synthetic antioxidants has resulted in extensive research to discover such compunds11. A potential solution to this is peptides1113. Peptides derived from natural proteins show promise. They are generally regarded as safe and can potentially contain additional bioactive properties (e.g., hypocholesterolemic or antimicrobial)11.

The standard approach for discovering antioxidant peptides has been by hydrolysing proteins of interest with a selection of available proteolytic enzymes1215. The resulting hydrolysates are measured for their antioxidant properties, primarily FRS activity, then further purified and analysed by mass spectrometry, to identify the individual peptides containing the antioxidant properties12. This trial-and-error approach is , however, both time- and cost-demanding13. Insights introduced by computational prediction of peptide antioxidant properties could greatly reduce laboratory work and are therefore highly desirable to develop.

A variety of predictive patterns for antioxidant activity of peptides have been identified in both the sequence order (hydrophobic amino acids such as leucine or valine in the N‐terminal regions of peptides), the individual amino acids [e.g.; sulphur‐containing amino acid residues (cystine and methionine), aromatic amino acid residues (phenylalanine, tryptophan, and tyrosine) and the imidazole ring‐containing histidine] and the secondary structure. Nevertheless, a full understanding of antioxidant properties of peptides is still lacking6,13,16. The lack of a defined set of rules makes a theoretical prediction approach difficult. Fortunately, machine learning can be used to circumvent our incomplete knowledge, as a machine learning algorithm can be trained to learn complex underlying patterns from a given dataset and utilize them to predict antioxidant activities17.

Previous papers have presented promising predictions for antioxidative properties of small molecules18, proteins1921 and peptides2224 using different machine learning algorithms (e.g. Multiple Linear Regression, Support Vector Machines and Random Forest). These models are, as mentioned in a recent review13 on the subject, still in their infancy and no current web-server exists for prediction of antioxidant peptides. One obstacle with these standard models is their inability to take amino acid sequences of different lengths as inputs, as their feature vector must be a fixed length25. This is usually circumvented by aligning the sequences26 or, in cases where aligning is impossible, with feature extraction, i.e. representing the sequences as a feature vector reflecting their properties2225,2729. Unfortunately, the resulting feature vectors are inherently biased by the method of feature extraction used30.

Recent papers3133 have shown the advantages of using deep convolutional neural networks34 (CNNs) to evade this bias. A CNN also requires inputs of identical dimension, but its ability to scan and detect patterns in the sequence input removes the need for alignment. For protein sequences of varying length a simple padding, i.e. adding gaps to the end of the shorter sequences until their length corresponds to that of the longest sequence, is sufficient to allow sequences of varying length as input35. This will avoid the bias created from subjective feature extraction, as the convolutional layer within a CNN functions as a self-learned feature extraction layer35.

Presently, databases with antioxidant peptides are sparse and lack negatives. These shortcomings are crucial as the performance of CNNs (as well as other machine learning algorithms) is linked to the quality and size of its training data. As expanding a dataset is not always possible, various techniques have been developed to mitigate effects from limited datasets. One of them is multi-task learning36 where multiple tasks are trained together to exploit their commonalities thereby requiring less data. Especially, the often-encountered problem of lacking negative data can cause problems. Selecting new negatives based on filters has seen some recent success37, but the filtering needs to only exclude positives, as the model otherwise learns the rules of the applied filters and not the general rules38. Randomly sampling negatives, preferably from a uniform population, is another approach39. This avoids any bias when selecting negatives, but has the disadvantage of introducing some mis-labelling39.

As peptides can be a valuable source of bioactive molecules, it is of high interest to create a good benchmark dataset of antioxidant peptides and develope a reliable and effective computational method for predicting antioxidant peptides based on their amino acid sequence.

In this work we developed AnOxPePred, a method for predicting both the FRS and chelating properties of peptides. The predicted antioxidant activity is based solely on the peptide amino acid sequence, which contains information about many of its inherent properties (e.g., size, local structure and charge). In the process of constructing this predictor, a curated benchmark dataset, of peptides and their FRS and chelating properties, was created and subsequently used to train a CNN classifier with two output neurons (for FRS and chelating properties respectively). Our tool displayed a better performance when compared to a k-Nearest Neighbours (k-NN) sequence-identity classification approach and is available as a web-server at http://services.bioinformatics.dtu.dk/service.php?AnOxPePred-1.0.

Methods

Benchmark dataset

The benchmark dataset (Supplementary Data S1) used in this work was established by extracting data on antioxidant peptides of length 2–30 amino acids both derived from different protein sources (e.g., fish40 and dairy41) and synthetic42, obtained from various published articles and from the BIOPEP-UWM43 database. Each peptide was binary labelled for the two classes, free radical scavenger (FRS) and chelator. The classes were labelled 1 (positive) if their source had measured/indicated an activity and otherwise 0 (negative). This extraction resulted in; 696 antioxidant peptides (685 FRS and 81 chelating, 70 of which have both activities) and 218 non-antioxidant experimentally-validated peptides, as seen in Table 1. Furthermore, to diminish homology bias while training, sequences were removed from both the positive and negative peptides so that no pair had more than 90% identity44. All sequence identities in this paper were calculated using the Needleman–Wunsch algorithm45 with the parameters; 1 for identical, 0 for dissimilar, − 10 for opening and extending gaps and 0 for end gaps.

Table 1.

Overview over the benchmark dataset.

FRS CheL FRS/CheL Non-AO Random Total
AOdb 615 11 70 218 500 1414
aodb < 90% 606 11 70 217 500 1404

FRS, CHEL, FRS/CHEL and NON-AO are all experimentally-validated peptides obtained from various papers. RANDOM consists of peptides derived from the UniProt46 database, with lengths between 2–30 amino acids. AODB < 90% is the number of peptides after removal of sequences, so no pair has more than 90% identity. FRS free radical scavenger, CHEL chelator, FRS/CHEL both FRS and chelator, NON-AO non-antioxidant.

Additionally, 500 random peptides with lengths between 2–30 amino acids, with the same length distribution as the positive dataset were extracted from random proteins derived from the UniProt46 database. It was ensured that none of these peptides were identical to any peptide in the positive dataset. This amounted to a final, balanced benchmark dataset of 1404 peptides, consisting of 687 FRS and chelators, 717 peptides termed non-antioxidant and a positive to negative ratio of 0.94 and 0.11 for FRS and chelators respectively.

To improve generalization and achieve a robust accuracy of our model’s predictions on unobserved cases, a fivefold nested cross-validation approach was used29. The fivefolds were created so that all folds contained similar number of positives and negatives, and FRS and chelators. Furthermore, a upper threshold for peptide identity was enforced, for any two peptides between different folds. Four partitions were made with a threshold of 60, 70, 80 or 90% identity between folds respectively.

Peptide representation

To enable the peptides as inputs to the model, their amino acids need to be converted into numerical values47. This was done using one-hot encoding, which represents each amino acid with a 20 × 1 vector with a single position (corresponding to the specific amino acid) set to one, and all 19 other positions set to zero48. Each peptide was therefore represented by a 2D array created by concatenating the 20 × 1 vectors of the amino acids it was composed of. Additionally, each peptide was padded with zero-only vectors of 20 × 1 until reaching the maximum sequence length (30 amino acids) resulting in a 30 × 20 array per peptide.

Deep neural network architecture

The model was implemented using TensorFlow 1.13 library. The model is composed of an input layer, a convolutional module (Conv1), a fully connected feed-forward module (Ff1) and an output layer. The input layer is the protein sequences in a 3D array (B × 30 × 20) with B depending on the mini-batch size during training and the number of sequences to predict on when testing. Conv1 consists of three parts; a 1D convolutional layer with 128 filters of size 3 × 1 and a stride of 1 followed by a 1D average pooling layer of size 3 × 1 and a stride of 3, and finally a dropout layer with a dropout probability of 10%. Ff1 consists of a fully connected layer with 256 nodes followed by a dropout layer with a dropout probability of 15%. The final output consists of 2 nodes for FRS and chelating activity respectively.

The modules were used to construct the model as following. The input layer enters Conv1 which extracts a set of features from the sequences. These features are then flattened (reduced to one dimension) before entering Ff1 and finally from there into the two output nodes as illustrated in Fig. 1. The purpose of Ff1 is to learn which features extracted by Conv1 decides whether a peptide is an antioxidant or not.

Figure 1.

Figure 1

Overview of AnOxPePred’s architecture. Input sequences (A) enters the Conv1 module (B) which extracts a set of features. The extracted features are then flattened before entering the Ff1 module (C). Here the features are used to predict the final output of FRS and chelating properties (D). FRS free radical scavenger.

The network was optimized with a focal loss49 (γ = 3, α = 0.25) and an Adam optimizer (learning rate = 0.00003, decay = 0.005). Exponential Linear Units (ELU)50 was used as the activation function for Conv1 and Ff1, and sigmoid on the final output. Dropout was used throughout training as a regularization technique51. For training a mini-batch size of 96 was used. All hyperparameters (i.e. nodes, filter sizes, dropout probability etc.) mentioned above were found empirically.

Early stopping was implemented within the fivefold nested cross-validation to reduce overfitting when evaluating the model52. The final model used in the web-server was trained on all data for 400 epochs.

k-Nearest neighbours sequence identity-based benchmark

To evaluate the prediction performance of our model, a sequence identity based k-Nearest Neighbours (k-NN) was designed under the assumption that similar peptides share similar properties. In the same fivefold cross-validation set-up as used for our model, peptides from one fold had their antioxidant activities predicted based on the average annotation of the 5 (k = 5) most similar peptides, in terms of sequence identity, within the four other folds.

Performance evaluation

To properly evaluate the prediction power for each of the two antioxidant properties (FRS and chelator), the prediction performances were evaluated individually. Area Under a Curve (AUC), F1 score (F1) and Matthew’s Correlation Coefficient (MCC) were calculated for the models (Supplementary Equations S1), as they are metrics commonly used to evaluate classifier performance. AUC values are in the interval of 0–1, with 1 being a perfect agreement, 0 a perfect disagreement and 0.5 implying a random prediction53. F1 can be interpreted as a weighted average of the precision and recall, where a score of 1 is the optimal and a score of 0 is the poorest54. MCC values are in the interval of − 1 to 1, with 1 being a perfect agreement, − 1 a perfect disagreement and 0 implying a random prediction55.

As the predictions from our model and k-NN are continuous values between 0 and 1, a threshold must be defined to change them into binary predictions (0 if below the threshold and 1 if above) thereby enabling the calculation of Recall, Precision, F1 and MCC. This threshold was decided by optimizing for the MCC scores. The final metrics for each model were then the average of the 20 metrics derived from the fivefold cross-validation.

Additionally, the Gini coefficient was used as a measure for how evenly the data was distributed into each fold. The Gini coefficient was derived by calculating the relative mean absolute difference on the number of positive FRS’ in each fold and subsequently dividing it by 256.

Experimental measurements for radical scavenging activity

Ten peptides were selected from 328.593 peptides derived from proteins studied in the PROVIDE project57. These are all proteins that are easily accessible by-products in large-scale industrial processes. The peptides were selected among the ones with the highest predicted FRS scores, with 4 peptides being the highest scoring peptides longer than 15 amino acids. For overlapping peptides, only a single one with the highest predicted score was included in the final set. The final set is reported in Table 2.

Table 2.

Overview over the 10 new experimentally tested peptide sequences, ranked according to the FRS score predicted by our model (from largest to smallest) and their IC50.

Peptide sequence Predicted FRS score IC50 (mg/ml)
VPFYFEHGPHI 0.64 16.32 ± 1.72
HWYD 0.59 2.24 ± 0.11
VWYA 0.55 7.03 ± 1.25
MLWQYKPK 0.54 6.73 ± 2.42
EHHNSPGYYDG 0.53 90.83 ± 5.48
YWTMWK 0.53 14.13 ± 0.93
ENNRPFAAANEIVPFYFEHGPHIFNS 0.52 38.87 ± 6.53
LIYPTGCTTCCTGYKGCYYFGKNGKFVCEG 0.52 15.37 ± 5.15
QSDSDYSSSGPLGVPDPSDLL 0.51 37.00 ± 6.62
NNKWVPCLEFETEHGFVYREHH 0.50 5.47 ± 2.20
Sodium Casenate 9 ± 2.30

A low IC50 is evidence for high scavenging activity. Rows are coloured according to their experimental FRS activity (obtained as described in methods) compared to Sodium Caseinate, a known antioxidant. Peptides in bold have a higher activity than Sodium Caseinate, and underlined peptides have a similar (less than twice IC50) activity.

The radical scavenging activity of predicted antioxidant peptides was measured using 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging activity method of Yang et al.58 with some modifications. Peptides were dissolved in dimethyl sulfoxide (DMSO), obtaining peptide solutions in different concentrations (0.0002–0.05 M). Concisely, 100 µL of the peptide solution was mixed with 100 µL of 0.1 mM ethanolic DPPH solution. The mixture was kept in darkness at room temperature for 30 min and absorbance was read at 515 nm. Butylated HydroxyToluene (BHT) solution was included as positive control. Measurements were performed in triplicates. Scavenging effect was calculated as inhibition percentage as in the equation below, where As is the absorbance of DPPH after reaction with antioxidant peptide, A0: Absorbance of peptide solution and ethanol (control), and Ab is the absorbance of DMSO and DPPH (blind):

Inhibition(%)=1-As-A0Ab×100.

Results were calculated for 50% inhibition concentration (IC50) and presented in mg/mL.

As a baseline measure for scavenging activities, we also performed the experiment on sodium caseinate, a common food ingredient with antioxidant properties.

Results and discussion

Peptide dataset

The antioxidant peptide dataset, constructed as described in the methods section, consists of 687 antioxidant peptides (676 FRS and 81 chelating, 70 of which exhibit both properties) and 217 non-antioxidant experimentally-validated peptides. Peptides were defined as being 2–30 in length. As seen from the peptide length distribution in Fig. 2, a majority of the peptides are short (2–4 mers). A vital component of predicting the activity of underrepresented classes in the training dataset (longer peptides and chelators in this case) is the model’s ability to apply multi-task learning, i.e. exploiting commonalities between short and long and FRS and chelators to improve training where data is lacking.

Figure 2.

Figure 2

Overview of the properties and length of peptides in the benchmark dataset. FRS free radical scavenger.

Additionally, in order to create a more balanced dataset 500 random negatives following the length distribution of the positives were added, achieving a positive to negative ratio of 0.94 and 0.11 for FRS and chelators respectively. Random negatives selection was preferred over negatives retrieved from a filter as there is only a limited understanding of what constitutes an antioxidant, like the seemingly prevalence of certain residues. Random negatives will most likely result in some mis-labelled negatives and a reduced performance but also an unbiased one.

As mentioned, it is expected that certain residues are more prevalent in antioxidant peptides. As an attempt to capture such characteristics, the residue composition of our datasets FRS, chelator, non-antioxidant and randomly selected negative peptides were compared to a baseline composition based on the UniProtKB/Swiss-Prot data bank (Fig. 3), with no restriction to the taxonomic origin of the proteins. Differences in composition was determined by applying a one sample test of proportions59 for each amino acid, with an asterisk marking a significant difference (P value < 0.05).

Figure 3.

Figure 3

The difference in composition between the antioxidant dataset and a baseline (the average amino acid composition in the UniProtKB/Swiss-Prot data bank). Significant differences (P value < 0.05) was determined by applying a one sample test of proportions59 for each amino acid and was marked with an asterisk (*). FRS Free Radical Scavenger.

For randomly selected negative peptides no significant difference in amino acid prevalence from the baseline can be seen in Fig. 3, implying they contain no composition bias. Experimentally-tested non-antioxidant peptides have a slight difference in composition, notably a lower ratio of tyrosine, which appears to be connected to antioxidant activity. On the other hand, a more clear residue preference is seen between the composition of antioxidants and the baseline. From Fig. 3, it is evident that histidine is inherently more present in antioxidants, likewise is tryptophan and indeed tyrosine for FRS, supporting their potential relevance for a peptide’s activity. The high frequency of leucine and proline is less intuitive but could be related to the hydrophobic regions that have been observed in antioxidant peptides6. Histidine, tryptophan and tyrosine make up a large percentage of the composition in antioxidant peptides, resulting in a number of other residues showing a significant decrease.

Performance and comparison to benchmark

Generalization, i.e. the ability of a model to retain prediction performance on novel data, can be enhanced by partitioning the training sequences based on sequence identity. On the other hand, lowering the partitioning threshold too much eventually creates a reduced amount of clusters in which positives and negatives are intermixed, thus defeating the original purpose of homology partitioning and impairing the training process.

To identify the optimal similarity threshold, we analysed the number of clusters and the average Gini impurity index from co-clustered positives and negatives at different thresholds. This is displayed in Fig. 4 as a blue and orange line, respectively.

Figure 4.

Figure 4

Overview of the effects of partitioning the data with different thresholds. Plotted is the performance of AnOxPePred and k-NN represented by the MCC of FRS, number of clusters (i.e. the number of groups of peptides based on the specified threshold) and the Gini coefficient based on the distribution of FRS peptides in each fold. MCC Matthew’s correlation coefficient, FRS free radical scavenger.

Additionally, the performance of k-NN and our model (represented by the MCC for FRS) are displayed as in green and red, respectively.

As seen in Fig. 4, the performance of k-NN decreases with a lower threshold, which is to be expected as it relies on sequence similarity. Meanwhile the performance of AnOxPePred is steady until 70%, and only decreases at 60% threshold. This implies that unlike the k-NN algorithm, AnOxPePred learns more general rules for predicting antioxidant activity than simple sequence similarity.

Additionally, a steep increase in Gini impurity and decrease in number of clusters occurs when going from a 70% to a 60% threshold. The latter is most likely caused by the high number of 3′mers which beneath 66% identity all ends up in one cluster prohibiting the creation of 5 even partitions.

As the 70% threshold gives the partition with the lowest threshold while also retaining even partitioning, it was selected for evaluating and comparing the performances of the AnOxPePred and k-NN models. The models were trained and evaluated as described in methods. The resulting performances are compared in Fig. 5.

Figure 5.

Figure 5

Performance comparison of AnOxPePred and k-NN for both FRS and chelating properties using the metrics AUC, F1 score and MCC. AUC area under the curve, MCC Matthew’s correlation coefficient, FRS free radical scavenger.

The performance of AnOxPePred is seen to outcompete the k-NN model in all metrics for FRS activity. For chelating activity AnOxPePred shows a better MCC and F1 score, but a lower AUC than k-NN. Additionally, it can be argued that AnOxPePred’s predictions are based on more general rules and not only the sequence similarity as the k-NN and thereby offer a more trustworthy prediction on a wider range of peptides. The better prediction performances for FRS, compared to chelating, are most likely caused by FRS data being more prevalent in the benchmark dataset. The exact metric values are shown in Supplementary Table S2.

Experimental validation

In order to test the accuracy of our model on new peptides, and to understand the limits of our models, we measured the scavenging activity of 10 peptides with high predicted FRS scores from Patatin and Kunitz-Type proteinase inhibitors, which are proteins from potatoes that are abundant in byproducts of starch production. It is important to notice that two additional peptides that were initially selected could not be tested since they were not soluble in the reported experimental conditions. The results of the tests for all are reported in Table 2.

We can see that four peptides have scavenging activity as good or better than sodium caseinate, three have a comparable activity (an IC50 lower than twice the IC50 of sodium caseinate), and 3 have little scavenging activity. As most studies only isolate 1–10 antioxidant peptides from their protein sources, the high success rate of seven peptides out of ten with good scavenging activity demonstrates the accuracy and usefulness of the prediction12,14,40,41. On the other hand it is evident that especially for longer peptides, the tool in some cases fails, even if the peptide has a sequence composition similar to scavenging peptides in our benchmark set. Nonetheless, even a suboptimal prediction of larger peptides can be useful in the selection of possible antioxidants, as seen by our identification of a 22-residue antioxidant.

Perspective

There is still plenty of room for further improvement of antioxidant peptide predictors, with the most pressing issue being the modest size of the benchmark dataset. Multi-task learning was used to draw information from small to long peptides and from FRS to chelating activity thereby improving their predictions. However, as larger peptides can form secondary structures, some crucial antioxidant information might not be obtained from short unstructured peptides. Further expansion of the current dataset to include a larger variety of peptides is therefore an important step for improvement of antioxidant peptide predictions, especially on peptides currently underrepresented in the dataset. Additionally, as our model relies on other features than the sequence, it is likely its performance would benefit more with an increased dataset than k-NN’s.

From the experimental validation we could see that, especially for the longer peptides tested, the prediction task is probably affected by more complex behaviours, such as local structure, that was not taken into account in the current algorithm. Additionally, some of the peptides we tested were not soluble. We believe that including peptide structure and solubility into the model can drastically improve its accuracy and usefulness.

Nonetheless, the results presented in this paper demonstrates the proof of concept of predicting antioxidant peptides based solely on their sequence, and that good predictions can be achieved. This indicates that AnOxPePred has the potential of becoming a useful tool by reducing the experimental work required when searching for new antioxidant peptides.

AnOxPePred web-server

For the convenience of experimental scientists, the free web server, AnOxPePred (http://services.bioinformatics.dtu.dk/service.php?AnOxPePred-1.0), was developed. AnOxPePred is based on the model presented in this paper and will allow the user to predict the FRS and chelating properties of single peptides. In addition, another feature of AnOxPePred, is the ability to predict the activity of peptides within a protein. Here, the user can choose to predict the activity of all possible peptides, of length 2–30 amino acids, within the protein or the peptides that would be derived from hydrolysing the protein with a selection of conventional proteases. The input is given in a FASTA format and the output is a file with each peptide and their predicted antioxidant properties.

In summary, we introduce a deep convolutional neural network (CNN) classifier for predicting antioxidant activity of peptides, which illustrated a good performance and an ability to outperform a k-NN sequence identity-based approach, when predicting the free radical scavenging (FRS) and chelating properties of peptides.

Currently, an exhaustive and high-cost trial and error approach is used to identify antioxidant peptides. AnOxPePred is therefore not only a good benchmark for future antioxidant peptide predictors, but additionally, a useful computational tool to assist in the search of antioxidant peptides, thereby reducing the laboratory workload. To aid researchers identifying antioxidant peptides, the publicly accessible web-server, AnOxPePred (http://services.bioinformatics.dtu.dk/service.php?AnOxPePred-1.0), has been developed. Additionally, the source code is freely available at: (https://github.com/TobiasHeOl/AnOxPePred.git).

Supplementary information

Acknowledgements

We are grateful for the financial support from Innovation Fund Denmark (Grant nr: 7045-00021B, PROVIDE project).

Author contributions

P.M. and E.H. conceived the concept of this study and supervised the study. T.O. designed and performed the computational work, implemented the webserver, drafted the manuscript and prepared Figs. 1, 2, 3, 4, 5. T.O., F.M., and P.M. wrote the manuscript and prepared B.Y., F.M., P.G., S.G., M.O., C.J. and E.H. provided critical revision on the tool and the manuscript. B.Y., P.M. and C.J conceived and performed the experimental validation. F.M, M.P., O.L. and P.M. provided critical revision of the computational parts of the manuscript. All authors read and approved the final manuscript.

Data availability

The dataset generated and used during this study is available at http://services.bioinformatics.dtu.dk/service.php?AnOxPePred-1.0 under the Dataset tab and included in this papers Supplementary Information files.

Competing interests

The authors declare no competing interests.

Footnotes

Publisher's note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Supplementary information

is available for this paper at 10.1038/s41598-020-78319-w.

References

  • 1.Lobo V, Patil A, Phatak A, Chandra N. Free radicals, antioxidants and functional foods: Impact on human health. Pharmacogn. Rev. 2010;4:118–126. doi: 10.4103/0973-7847.70902. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Nimse SB, Pal D. Free radicals{,} natural antioxidants{,} and their reaction mechanisms. RSC Adv. 2015;5:27986–28006. doi: 10.1039/C4RA13315C. [DOI] [Google Scholar]
  • 3.Rajendran P, et al. Antioxidants and human diseases. Clin. Chim. Acta. 2014;436:332–347. doi: 10.1016/j.cca.2014.06.004. [DOI] [PubMed] [Google Scholar]
  • 4.Skibsted, L. H., Risbo, J. & Andersen, M. L. Chemical Deterioration and Physical Instability of Food and Beverages. (Woodhead Publishing Ltd, Cambridge, 2010).
  • 5.Santos-Sanchez NF, Salas-Coronado R, Valadez-Blanco R, Hernandez-Carlos B, Guadarrama-Mendoza PC. Natural antioxidant extracts as food preservatives. Acta Sci. Pol. Technol. Aliment. 2017;16:361–370. doi: 10.17306/J.AFS.0530. [DOI] [PubMed] [Google Scholar]
  • 6.Nwachukwu ID, Aluko RE. Structural and functional properties of food protein-derived antioxidant peptides. J. Food Biochem. 2019;43:e12761. doi: 10.1111/jfbc.12761. [DOI] [PubMed] [Google Scholar]
  • 7.López-Rubio A, et al. Overview of active polymer-based packaging technologies for food applications. Food Rev. Int. 2004;20:357–387. doi: 10.1081/FRI-200033462. [DOI] [Google Scholar]
  • 8.Nyanhongo GS, Sygmund C, Ludwig R, Prasetyo EN, Guebitz GM. An antioxidant regenerating system for continuous quenching of free radicals in chronic wounds. Eur. J. Pharm. Biopharm. 2013;83:396–404. doi: 10.1016/j.ejpb.2012.10.013. [DOI] [PubMed] [Google Scholar]
  • 9.Shahidi F. Antioxidants in food and food antioxidants. Nahrung. 2000;44:158–163. doi: 10.1002/1521-3803(20000501)44:3<158::AID-FOOD158>3.0.CO;2-L. [DOI] [PubMed] [Google Scholar]
  • 10.Ito N, Fukushima S, Tsuda H. Carcinogenicity and modification of the carcinogenic response by BHA, BHT, and other antioxidants. Crit. Rev. Toxicol. 1985;15:109–150. doi: 10.3109/10408448509029322. [DOI] [PubMed] [Google Scholar]
  • 11.Sarmadi BH, Ismail A. Antioxidative peptides from food proteins: A review. Peptides. 2010;31:1949–1956. doi: 10.1016/j.peptides.2010.06.020. [DOI] [PubMed] [Google Scholar]
  • 12.Sila A, Bougatef A. Antioxidant peptides from marine by-products: Isolation, identification and application in food systems. A review. J. Funct. Foods. 2016;21:10–26. doi: 10.1016/j.jff.2015.11.007. [DOI] [Google Scholar]
  • 13.Zou T-B, He T-P, Li H-B, Tang H-W, Xia E-Q. The structure-activity relationship of the antioxidant peptides from natural proteins. Molecules. 2016;21:72. doi: 10.3390/molecules21010072. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Lorenzo JM, et al. Bioactive peptides as natural antioxidants in food products—A review. Trends Food Sci. Technol. 2018;79:136–147. doi: 10.1016/j.tifs.2018.07.003. [DOI] [Google Scholar]
  • 15.Hwang J-Y, Shyu Y-S, Wang Y-T, Hsu C-K. Antioxidative properties of protein hydrolysate from defatted peanut kernels treated with esperase. LWT Food Sci. Technol. 2010;43:285–290. doi: 10.1016/j.lwt.2009.08.020. [DOI] [Google Scholar]
  • 16.Jia Z, Natarajan P, Forte TM, Bielicki JK. Thiol-bearing synthetic peptides retain the antioxidant activity of apolipoproteinA-IMilano. Biochem. Biophys. Res. Commun. 2002;297:206–213. doi: 10.1016/S0006-291X(02)02143-5. [DOI] [PubMed] [Google Scholar]
  • 17.Michalski RS, Chilausky RL. Knowledge acquisition by encoding expert rules versus computer induction from examples: A case study involving soybean pathology. Int. J. Man. Mach. Stud. 1980;12:63–87. doi: 10.1016/S0020-7373(80)80054-X. [DOI] [Google Scholar]
  • 18.Fatemi MH, Gholami Rostami E. Prediction of the radical scavenging activities of some antioxidant from their molecular structure. Ind. Eng. Chem. Res. 2013;52:9525–9531. doi: 10.1021/ie4001426. [DOI] [Google Scholar]
  • 19.Zhang L, Zhang C, Gao R, Yang R, Song Q. Sequence based prediction of antioxidant proteins using a classifier selection strategy. PLoS ONE. 2016;11:e0163274. doi: 10.1371/journal.pone.0163274. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Xu L, Liang G, Shi S, Liao C. SeqSVM: A sequence-based support vector machine method for identifying antioxidant proteins. Int. J. Mol. Sci. 2018;19:1773–191. doi: 10.3390/ijms19061773. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Feng P, Chen W, Lin H. Identifying antioxidant proteins by using optimal dipeptide compositions. Interdiscip. Sci. 2016;8:186–191. doi: 10.1007/s12539-015-0124-9. [DOI] [PubMed] [Google Scholar]
  • 22.Cheng Y, et al. DFT-based quantitative structure–activity relationship studies for antioxidant peptides. Struct. Chem. 2015;26:739–747. doi: 10.1007/s11224-014-0533-0. [DOI] [Google Scholar]
  • 23.Tian M, et al. Structure-activity relationship of a series of antioxidant tripeptides derived from β-Lactoglobulin using QSAR modeling. Dairy Sci. Technol. 2015;95:451–463. doi: 10.1007/s13594-015-0226-5. [DOI] [Google Scholar]
  • 24.Li Y-W, Li B. Characterization of structure-antioxidant activity relationship of peptides in free radical systems using QSAR models: Key sequence positions and their amino acid properties. J. Theor. Biol. 2013;318:29–43. doi: 10.1016/j.jtbi.2012.10.029. [DOI] [PubMed] [Google Scholar]
  • 25.Liu B. BioSeq-Analysis: A platform for DNA, RNA and protein sequence analysis based on machine learning approaches. Brief. Bioinform. 2017 doi: 10.1093/bib/bbx165. [DOI] [PubMed] [Google Scholar]
  • 26.Kemena C, Notredame C. Upcoming challenges for multiple sequence alignment methods in the high-throughput era. Bioinformatics. 2009;25:2455–2465. doi: 10.1093/bioinformatics/btp452. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Bharill N, Tiwari A, Rawat A. A novel technique of feature extraction with dual similarity measures for protein sequence classification. Proc. Comput. Sci. 2015;48:795–801. doi: 10.1016/j.procs.2015.04.217. [DOI] [Google Scholar]
  • 28.Wang JTL, Ma Q, Shasha D, Wu CH. New techniques for extracting features from protein sequences. IBM Syst. J. 2001;40:426–441. doi: 10.1147/sj.402.0426. [DOI] [Google Scholar]
  • 29.Krstajic D, Buturovic LJ, Leahy DE, Thomas S. Cross-validation pitfalls when selecting and assessing regression and classification models. J. Cheminform. 2014;6:10. doi: 10.1186/1758-2946-6-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Braytee, A., Liu, W. & Kennedy, P. A cost-sensitive learning strategy for feature extraction from imbalanced data BT—neural information processing. In (eds. Hirose, A. et al.) 78–86 (Springer International Publishing, New York, 2016).
  • 31.Alipanahi B, Delong A, Weirauch MT, Frey BJ. Predicting the sequence specificities of DNA- and RNA-binding proteins by deep learning. Nat. Biotechnol. 2015;33:831. doi: 10.1038/nbt.3300. [DOI] [PubMed] [Google Scholar]
  • 32.Kelley DR, Snoek J, Rinn JL. Basset: Learning the regulatory code of the accessible genome with deep convolutional neural networks. Genome Res. 2016;26:990–999. doi: 10.1101/gr.200535.115. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Zhou J, Troyanskaya OG. Predicting effects of noncoding variants with deep learning-based sequence model. Nat. Methods. 2015;12:931–934. doi: 10.1038/nmeth.3547. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Aloysius, N. & Geetha, M. A review on deep convolutional neural networks. In 2017 International Conference on Communication and Signal Processing (ICCSP) 588–592 (2017). 10.1109/ICCSP.2017.8286426.
  • 35.Seo S, Oh M, Park Y, Kim S. DeepFam: Deep learning based alignment-free method for protein family modeling and prediction. Bioinformatics. 2018;34:i254–i262. doi: 10.1093/bioinformatics/bty275. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Zhang, Y. & Yang, Q. A Survey on Multi-Task Learning. (2017).
  • 37.Cheng Z, et al. Selecting high-quality negative samples for effectively predicting protein-RNA interactions. BMC Syst. Biol. 2017;11:9. doi: 10.1186/s12918-017-0390-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Park Y, Marcotte EM. Revisiting the negative example sampling problem for predicting protein-protein interactions. Bioinformatics. 2011;27:3024–3028. doi: 10.1093/bioinformatics/btr514. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Ben-Hur A, Noble WS. Choosing negative examples for the prediction of protein-protein interactions. BMC Bioinform. 2006;7:S2. doi: 10.1186/1471-2105-7-S1-S2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Sampath Kumar NS, Nazeer RA, Jaiganesh R. Purification and biochemical characterization of antioxidant peptide from horse mackerel (Magalaspis cordyla) viscera protein. Peptides. 2011;32:1496–1501. doi: 10.1016/j.peptides.2011.05.020. [DOI] [PubMed] [Google Scholar]
  • 41.Suetsuna K, Ukeda H, Ochi H. Isolation and characterization of free radical scavenging activities peptides derived from casein. J. Nutr. Biochem. 2000;11:128–131. doi: 10.1016/S0955-2863(99)00083-2. [DOI] [PubMed] [Google Scholar]
  • 42.Saito K, et al. Antioxidative properties of tripeptide libraries prepared by the combinatorial chemistry. J. Agric. Food Chem. 2003;51:3668–3674. doi: 10.1021/jf021191n. [DOI] [PubMed] [Google Scholar]
  • 43.Minkiewicz P, Dziuba J, Iwaniak A, Dziuba M, Darewicz M. BIOPEP database and other programs for processing bioactive peptide sequences. J. AOAC Int. 2008;91:965–980. doi: 10.1093/jaoac/91.4.965. [DOI] [PubMed] [Google Scholar]
  • 44.Chou K-C. Some remarks on protein attribute prediction and pseudo amino acid composition. J. Theor. Biol. 2011;273:236–247. doi: 10.1016/j.jtbi.2010.12.024. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Needleman SB, Wunsch CD. A general method applicable to the search for similarities in the amino acid sequence of two proteins. J. Mol. Biol. 1970;48:443–453. doi: 10.1016/0022-2836(70)90057-4. [DOI] [PubMed] [Google Scholar]
  • 46.The UniProt Consortium UniProt: The universal protein knowledgebase. Nucleic Acids Res. 2017;45:D158–D169. doi: 10.1093/nar/gkw1099. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Luo H, et al. Machine learning methods for predicting HLA-peptide binding activity. Bioinform. Biol. Insights. 2015;9:21–29. doi: 10.4137/BBI.S29466. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Jurtz VI, et al. An introduction to deep learning on biological sequence data: Examples and solutions. Bioinformatics. 2017;33:3685–3690. doi: 10.1093/bioinformatics/btx531. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Lin, T.-Y., Goyal, P., Girshick, R. B., He, K. & Dollár, P. Focal Loss for Dense Object Detection. CoRRabs/1708.0 (2017). [DOI] [PubMed]
  • 50.Clevert, D.-A., Unterthiner, T. & Hochreiter, S. Fast and accurate deep network learning by exponential linear units (elus). arXiv Prepr. arXiv1511.07289 (2015).
  • 51.Srivastava, N., Hinton, G., Krizhevsky, A., Sutskever, I. & Salakhutdinov, R. Dropout: A simple way to prevent neural networks from overfitting. J. Mach. Learn. Res.15 (2014).
  • 52.Prechelt, L. Early stopping—but when? BT—neural networks: Tricks of the trade: Second Edition. In (eds. Montavon, G., Orr, G. B. & Müller, K.-R.) 53–67 (Springer, Berlin, 2012). 10.1007/978-3-642-35289-8_5.
  • 53.Bradley AP. The use of the area under the ROC curve in the evaluation of machine learning algorithms. Pattern Recognit. 1997;30:1145–1159. doi: 10.1016/S0031-3203(96)00142-2. [DOI] [Google Scholar]
  • 54.Bekkar, M., Djemaa, D. H. K. & Alitouche, D. T. A. Evaluation measures for models assessment over imbalanced data sets. (2013).
  • 55.Boughorbel S, Jarray F, El-Anbari M. Optimal classifier for imbalanced data using Matthews Correlation Coefficient metric. PLoS ONE. 2017;12:e0177678. doi: 10.1371/journal.pone.0177678. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56.Dorfman, R. A formula for the gini coefficient. In The Review of Economics and Statistics (1979).
  • 57.Hansen, E. B., Jacobsen, C., Lund, O., Marcatili, P. & García Moreno, P. J. PROVIDE a project aiming at protein valorization through informatics, hydrolysis, and separation. (2017).
  • 58.Yang J, Guo J, Yuan J. In vitro antioxidant properties of rutin. LWT Food Sci. Technol. 2008;41:1060–1066. doi: 10.1016/j.lwt.2007.06.010. [DOI] [Google Scholar]
  • 59.Altman DG. Practical Statistics for Medical Research. London: Chapman & Hall; 1991. [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Data Availability Statement

The dataset generated and used during this study is available at http://services.bioinformatics.dtu.dk/service.php?AnOxPePred-1.0 under the Dataset tab and included in this papers Supplementary Information files.


Articles from Scientific Reports are provided here courtesy of Nature Publishing Group

RESOURCES