Skip to main content
Scientific Reports logoLink to Scientific Reports
. 2021 Mar 10;11:5537. doi: 10.1038/s41598-021-85147-z

Molecular characterization of Fe-acquisition genes causing decreased Fe uptake and photosynthetic inefficiency in Fe-deficient sunflower

Ahmad Humayan Kabir 1,, Sharaban Tahura 1, Mona M Elseehy 2, Ahmed M El-Shehawi 3
PMCID: PMC7947006  PMID: 33692433

Abstract

Iron (Fe) deficiency in plants hinders growth and yield. Thus, this study aims to elucidate the responses and molecular characterization of genes in Fe-deficient sunflower. The study was conducted on 14 days-old sunflower plants cultivated in hydroponic culture under Fe-sufficient and Fe-deficient conditions. The Fe-starved sunflower showed substantial decrease in plant biomass, SPAD score, quantum yield efficiency of PSII (Fv/Fm), photosynthetic performance index (Pi_ABS). Further, Fe shortage reduced Fe and Zn concentrations in roots and shoots, accompanied by a marked decrease of HaNramp1 and HaZIP1 expression in roots, suggesting the association of Zn status contributing to photosynthetic inefficiency in sunflower. The ferric chelate reductase (FCR) activity, along with HaFRO2 and HaIRT1 transcripts, were constitutively expressed, suggesting that sunflower plants can regulate FCR activity, although the lack of bioavailable Fe in the rhizosphere strongly corresponds to the limited Fe uptake in sunflower. The substantial increase of proton extrusion in roots and the localization of Fe-related genes in the plasma membrane are also evident in sunflower as common responses to Fe-deficiency by this Strategy I plant species. Analysis showed that three motifs of Fe-related proteins were linked to the ZIP zinc transporter. The interactome map revealed the close partnership of these Fe-related genes in addition to FRU gene encoding putative transcription factor linked to Fe uptake response. The cis-regulatory analysis of promoter suggested the involvement of auxin, salicylic acid, and methyl jasmonate-responsive elements in the regulatory process in response to Fe deficiency. These findings may be beneficial to develop Fe-efficient sunflower plants through breeding or genome editing approaches.

Subject terms: Plant physiology, Plant stress responses

Introduction

Iron (Fe) deficiency negatively affects the growth and yield of plants. Fe-deficiency causes a stunted root growth and poor maturation of fruits1,2. In alkaline soil, the problem most commonly occurs due to low Fe solubility at high pH1,3. In plants, photosynthesis, respiration, and protein formation are closely related to the Fe status4,5. In the photosynthesis process, photosystem II (PS-II), a Fe-containing protein complex, loses its activity because of low photosynthetic electron supply to Fe-starved plants6,7. Furthermore, the synthesis of Fe-S clusters and heme-containing proteins is severely affected in mitochondria of Fe deficient plants8. Thus, how Fe-deficiency affects Fe nutrition and growth is crucial for future genome editing strategies to improve plants.

A strategy-I plant acquires Fe by the reduction-based mechanism. In Strategy-I plants, ferric chelate reductase (FCR) is an enzyme that converts ferric ion to ferrous in roots to make existing Fe available9. This FCR activity and the upregulation of its candidate gene (FRO) have been mainly reported to confer Fe-deficiency tolerance in many dicot plants5,10. Also, the induction of acidification in the rhizosphere through proton (H+) extrusion enhances the mobilization of ferric Fe11,12. Although there have been few controversies on the role of phenolics increasing Fe availability in the rhizosphere, a few reports support that phenolics alter microbial community that in turn favors plant Fe uptake13.

Transporter genes are directly related to metal transport in plants. Further, the interactions of Fe with other mineral elements, such as zinc and sulfur, are often linked to the overall response of plants under Fe deficiency4. The most common Fe transporter is the IRT1 gene (Fe-regulated transporter protein) that is known to transport ferrous Fe in several plants, including tomato14, field peas15, Arabidopsis16, etc. In plants, Fe and Zn homeostasis are complements to each other. IRT gene families are expressed in epidermal cells to mediate Zn transport in Fe-deficient roots16,17. Further, Nramp1 (natural resistance-associated macrophage protein) also plays a role in Fe2+ transport in Fe-deprived plants17,18. Several ZIP proteins have been characterized in plants, usually showing modulation subjected to Fe/Zn deficiency19. The relation of Fe and S is of great importance in response to Fe deficiency as most active Fe in Fe-S protein clusters is tied to S in the chloroplast and cytochrome complex2023. The molecular characterization of genes and their interactions linked to Fe uptake is still limited. Many critical biological pathways and gene families related to Fe uptake and transport remain unexplored in sunflower.

Sunflower (Helianthus annuus L.) is an important crop for edible oil production affected due to Fe-deficiency. However, the responses of Fe-deficient sunflower are not yet studied. Therefore, we investigated how Fe deficiency lessens growth and development in sunflower plants. Along with the morphophysiological evidence, a broad range of cellular and molecular responses were studied that trigger deficiency symptoms in Fe depleted sunflower. We further performed in silico analysis of Fe-related genes of sunflower to interpret the motifs, regulatory networks, and association of genes linked to Fe-deficiency.

Materials and methods

Plant cultivation system

Seeds of sunflower were sterilized with 70% ethyl alcohol for 3 min, followed by distilled water washing. The seeds were then germinated at room temperature for 2 days on a tray before transferring to solution culture (pH 6.0) in a 5 L plastic pot as previously described24,25. Sunflower seedlings were supplemented with two different concentrations of ferric Fe-EDTA (ethylenediaminetetraacetic acid): 25 µM Fe-EDTA (+Fe) and 1.0 µM Fe-EDTA (−Fe). The seedlings were cultivated in the growth cabinet having a 14/10 h light/dark photoperiod (550–560 µmol s−1 per µA). Plants were harvested for analysis after 2 weeks.

Morphological and photosynthesis features

A digital caliper (Neiko 01407A Electronic Digital Caliper, United States) was used to measure the length of the roots and shoots. The dry weight of roots and shoots was taken after drying for 3 days at 80 °C in an electric oven. The leaf chlorophyll score was measured on a young leaf by a SPAD meter (Minolta, Japan). Furthermore, photosynthesis biophysics through chlorophyll fluorescence kinetic (OJIP), such as Fv/Fm (quantum efficiency of photosystem II), and Pi_ABS (photosynthesis performance index) were recorded on young leaves kept for 1 h in the dark using FP 100 PHOTON SYSTEM INSTRUMENT (CHECH REPUBLIC).

Analysis of Fe and Zn concentration in roots and shoots

Briefly, fresh roots were washed with Milli-Q water and subsequently incubated at 4 °C in the first (10 mM MES) solution and in the second (10 mM MES + 1 mM EDTA), followed by washing 2–3 times in Milli-Q water. After surface cleaning, roots and shoots were kept on a falcon tube, keeping the lid open to dry at 70 °C for 3 days. Dried samples were subsequently digested with HNO3/HClO4 (3:1 v/v) and made volume up to 10 ml. The solution was then used for elemental analysis based on standard curves by Atomic absorption spectroscopy (SHIMADZU, JAPAN).

Analysis of stress indicators

The standard curve for bovine serum albumin (BSA) was generated to estimate the total soluble protein, according to the Bradford assay26. Briefly, protein extraction was carried out by grinding the tissue samples with tris–HCL-buffer (50 mM, pH 7.5), 0.04% (v/v) β-mercaptoethanol, and 2 mM EDTA. The crude samples were centrifuged for 10 min at 12,000 rpm. The transparent fluid part was then mixed with 1 ml of Coomassie Brilliant Blue (CBB) before measuring the absorbance at 595 nm (60S UV–Visible Spectrophotometer, THERMO SCIENTIFIC, UNITED STATES). The concentration of unknown samples was then calculated based on the standard curve of different concentrations of BSA.

The electrolyte leakage demonstrating the loss of the cell membrane integrity were analyzed by a conductivity meter (HI98303, HANNA, UNITED STATES)27,28. Surface components of roots and shoots were dispensed frequently with deionized water. Thereafter, the freshly harvested samples were transferred into a beaker filled with 20 ml deionized water and kept at 25 °C for 2 h. Later, the solution’s electrical conductivity (EC1) was calculated. Afterward, the samples were heated in a water bath for 20 min at 95 °C then soothed at 25 °C before recording the final electrical conductivity (EC2). The electrolyte leakage was then determined as follows: = (EC1/EC2) × 100 (%).

The cell death percentage was estimated using Evans blue (SIGMA-ALRICH, UNITED STATES)29,30. The freshly harvested root and shoot were washed with MilliQ water. The tissue samples were then incubated in 2 ml Evan's blue mixture for 15 min at room temperature. Afterward, 1 ml of the 80% ethanol was added to the mixture and incubated for 10 min at room temperature. The tubes with solutions were then incubated for 15 min at 50 °C in a water bath and then centrifuged for 10 min at 12,000 rpm. The absorbance of the supernatant was recorded at 600 nm. Finally, the percentage of cell death in the root or shoot tissue was evaluated based on sample fresh weight.

Fe chelate reductase activity

Fe (III)-FCR activity was determined in roots by ferrozine testing5. Briefly, the roots were washed once with 0.2 mM CaSO4 and 2–3 times with Milli-Q water to eliminate the surface contaminants. The root samples were then homogenized with 1 ml of assay mixture (100 mM Fe(III) EDTA, 0.10 mmol MES-NaOH (pH 5.5), 300 mM ferrozine). The samples and blank tubes (without assay mixture) were incubated in the dark for 20 min at 25 °C. Finally, aliquots were read at 562 nm. The FCR activity was determined by using the ferrozine molar extinction coefficient (1.50 × 103 M−1 cm−1).

Estimation of rhizosphere acidification

The secretions of H+ from roots is known as proton extrusion. Briefly, the pH of the cultivation medium was maintained by 0.1 M HCl or 0.1 M KOH by a digital pH meter. The H+ efflux was measured by calculating the titrated quantity of acid or base to return pH to its starting point as follows: (amount of acid × concentration of acid) ÷ (fresh weight × time)15.

Estimation of total phenolics

The total phenolics concentration in roots was measured as previously described29,30. In short, the root extracts were mixed with 80% of Folin-Ciocalteu reagent and the solution of 20% of Na2CO3. The optical density of the solution was read at 765 nm. The unknown samples were calculated on the basis of the gallic acid calibration curve.

The qRT-PCR analysis

The total RNA was isolated from the fresh roots as described by SV total RNA isolation system (Promega, USA). The quantified RNA was then converted to cDNA using the cDNA synthesis kit (Promega, USA) before performing real-time PCR analysis in an Eco real-time PCR system (ILLUMINA, UNITED STATES) using gene-specific primers (Supplementary Table S1). The PCR reactions were set as follows: 95 °C for 3 min, followed by 40 cycles at 95 °C for 10 s, 56 °C for 30 s. The relative expression of candidate genes was calculated considered Actin as an internal control by the dd −∆Ct method31.

Bioinformatics analysis

NCBI Blast program was run to retrieve the mRNA and protein sequences of HaIRT1, HaNramp1, HaZIP1, and HaFRO2. The CELLO (http://cello.life.nctu.edu.tw) server predicted the subcellular localization of proteins27,28. The MEGA (V. 6.0) developed the phylogenetic tree with the maximum likelihood (ML) method for 100 bootstraps using 11 HMA3 homologs from 11 plant species32. Furthermore, the ten conserved protein motifs of the proteins were characterized by MEME Suite 5.1.1 (http://meme-suite.org/tools/meme) with default parameters, but five maximum numbers of motifs to find33. The interactome network of HMA3 protein was generated using the STRING server (http://string-db.org) visualized in Cytoscape34. The PlantCare was used for scanning of cis-elements present in promoter regions of these genes35.

Statistical analysis

At least three independent biological replications were considered for each sample in a randomized block design. The significance between +Fe and –Fe conditions was tested by t-test in Microsoft Excel 2007. In preparing graphic figures, GraphPad Prism 6 was used.

Ethical approval and permission

Formal ethical approval is not required for this experimental work as the sunflower line used in this work is a cultivated genotype. In addition, the seeds were collected from the local market; hence, permissions and/or licences for collection of seed specimens are not required complying with relevant institutional, national, and international guidelines and legislation.

Results

Plant growth, photosynthetic efficiency and elemental concentration

Along with the visual evidence, root and shoot morphological features (dry weight and length) significantly decreased owing to Fe-deficiency in the hydroponic solution compared to Fe-sufficient sunflower plants (Fig. 1a–e). In addition, the parameters associated with photosynthesis, such as SPAD score, Fv/Fm ratio, and Pi_ABS in young leaves, significantly declined due to Fe depletion relative to Fe-sufficient sunflower plants (Fig. 1f–h). Results showed that Fe and Zn concentration significantly reduced in roots and shoots under Fe-deficiency compared to Fe-sufficient controls (Table 1).

Figure 1.

Figure 1

Plant phenotype (a), root length (b), root dry weight (c) shoot height (d), shoot dry weight (e), SPAD (f), Fv/Fm (g) and Pi_ABS (h) in sunflower cultivated under Fe-sufficient and Fe-deficient conditions. Different letters in each column indicate significant differences between means ± SD of treatments (n = 3) at a P < 0.05 significance level.

Table 1.

Determination of Fe and Zn concentrations (µg g−1 DW) in roots and shoots of sunflower cultivated under Fe-sufficient and Fe-deficient conditions.

Nutrients Roots Shoots
+Fe −Fe Fold change +Fe −Fe Fold change
Fe 116.8 ± 13.4a 70.5 ± 16.6b 1.6 fold 54.9 ± 10.1a 38.4 ± 9.2b 1.4 fold
Zn 132.5 ± 14.1a 63.7 ± 15.4b 2.0 fold 63.2 ± 4.7a 30.7 ± 4.6b 2.0 fold

Data represent means ± SD of three independent biological samples. Different letters indicate significant difference at P < 0.05 level.

Changes in stress indicators

Fe-deficiency is known to induce stress in plants. In this study, the total soluble protein concentration in roots significantly reduced, although it remained unchanged in shoots due to Fe-deprivation compared to Fe-sufficient controls (Fig. 2a). Fe-depletion demonstrated a significant enhancement in electrolyte leakage and cell death (%) in both roots and shoots relative to controls (Fig. 2b,c).

Figure 2.

Figure 2

Total soluble protein (a), electrolyte leakage (b), cell death % (c), root FCR activity (d), root H+ extrusion (e) and root total phenol (f) in sunflower cultivated under Fe-sufficient and Fe-deficient conditions. Different letters in each column indicate significant differences between means ± SD of treatments (n = 3) at a P < 0.05 significance level.

Changes in strategy I responses in roots

Fe-depletion caused no significant changes in root FCR activity in comparison with Fe-sufficient plants (Fig. 2d). In contrast, the proton extrusion activity in roots was significantly induced owing to Fe-shortage in comparison with Fe-sufficient plants (Fig. 2e). On the other hand, total phenolics secretion in roots remained unchanged between Fe-sufficient and Fe-deficiency controls (Fig. 2f).

Changes in the expression of Fe transporter and Strategy I genes

The expression of the HaIRT1 gene remained unchanged under Fe-depletion relative to Fe-sufficient controls (Fig. 3a). However, HaNramp1 and HaZIP1 were significantly downregulated in roots owing to Fe-deprivation in comparison with Fe-sufficient plants (Fig. 3a). However, the expression of HaFRO2 showed no substantial changes between Fe-sufficient and Fe-deficient conditions (Fig. 3a). The CELLO localization predictor showed that corresponding proteins of these genes are localized in the plasma membrane of roots (Fig. 3b). According to the phylogenetic tree, HaIRT1 and HaZIP1 are clustered together, while HaNramp1 and HaFRO2 are placed within-cluster, although all these genes are originated from the same ancestor (Fig. 3c).

Figure 3.

Figure 3

Quantitative expression (a), CELLO subcellular localization prediction (b) and phylogenetic tree of Fe-related genes (c) in roots of sunflower cultivated under Fe-sufficient and Fe-deficient conditions. Different letters in each column indicate significant differences between means ± SD of treatments (n = 3) at a P < 0.05 significance level. Trees were constructed by MEGA 6 software with the maximum likelihood (ML) method for 100 bootstrap values.

In silico analysis of Fe-related genes/proteins

MEME motif analysis tool searched for the most conserved motifs identified in HaIRT1, HaNramp1, HaZIP1, and HaFRO2. Most of these ten motifs are located at site two and contain 6–50 residues (Fig. 4). Four out of ten motifs matched to particular domains are as follows: motif 1 (NPDNDJFFLIKAFAAGVILGTGFIHILPDAFDCLASKCLPEKPWGKFPF), motif 2 (HQFFEGIGLGGCILQADYERKAKAIMVFFFSLTTPFGIAJGIGJSKIYRE), motif 3 (YMALVDLLAADFMGPKLQNDLKLQLGANFALJLGAGCMSFLAIWA), and motif 4 (QLRRHRIIAQVLELGIIVHSVIIGLSLGASDNICTIK). Motif 1, 2 and 3 correspond to ZIP zinc transporter, while motif 4 attaches PTS_EIIC type-4 domain profile (Fig. 4). Other motifs show no information (Fig. 4).

Figure 4.

Figure 4

Schematic representation of the 10 conserved motifs in Fe-related proteins (HaIRT1, HaNramp1, HaZIP1, and HaFRO2). Scale bar corresponds to 0.1 amino acid substitution per residue. Different motifs, numbered 1–10, are displayed in different colored boxes.

Interactome analysis was performed on the STRING server. The HaIRT1 shows functional partnership with FRO2 (ferric reduction oxidase 2) and FRU (a putative transcription factor) that regulates Fe uptake responses belonging to CL:28,152 local network cluster associated with siderophore-dependent Fe import into the cell (Fig. 5a). Functional enrichment of the network links to several biological functions, including cellular response to nitric acid, response to bronchodilator, Fe ion transport, cellular response to Fe ion, and Fe ion homeostasis. The HaNramp1 links to IRT1 (Fe-regulated transporter 1) and FRO2 (ferric reductase oxidase 2) partners under two local network clusters (siderophore-dependent Fe import into the cell and transition metal ion transmembrane transporter). The HaFRO2′s partners are IRT1 and FRU that regulated Fe uptake responses connected to CL:28,152 cluster (siderophore-dependent Fe import into the cell), having the same partner linked to the same biological processes observed for HaIRT1 (Fig. 5d). This gene cluster is related to several biological processes, which include Fe ion transmembrane transport, Fe ion transport, Fe ion homeostasis, divalent metal ion transport, and response to a bacterium (Fig. 5b). Further, the functional partners of HaZIP1 are RCK (ATP binding; ATP-dependent helicases; DNA helicases, etc.) and MSH4 (DNA mismatch repair protein MSH4) under CL:7350 local cluster involved in chiasma assembly and meiosis protein (SPO22/ZIP4 like) linked to the chiasma assembly biological process (Fig. 5c).

Figure 5.

Figure 5

Gene interaction partners and gene network analysis of HaIRT1 (a), HaNramp1 (b), HaZIP1 (c) and HaFRO2 (d). Interactome was generated using Cytoscape for STRING data.

Versatile cis-regulatory elements correlated with studied genes were found through PlantCare tool. (Table 2). The HaIRT1 promoter showed 1 ABRE (involved in the abscisic acid responsiveness), 1 ARE (essential for the anaerobic induction), 1 AuxRR-core (involved in auxin responsiveness), 8 CAAT-box (common elements in promoter and enhancer regions), 2 G-Box (involved in light responsiveness), 1 LTR (involved in low-temperature responsiveness), 1 MBS (MYB binding site involved in drought-inducibility), 1 RY-element (involved in seed-specific regulation), 2 TATA-box (core promoter element around − 30 of transcription start) and 1 TATC-box (involved in gibberellin-responsiveness). However, HaNramp1 promoter showed 5 CAAT-box (element in promoter and enhancer regions), 6 TATC-box (involved in gibberellin-responsiveness), 1 CAT-box (related to meristem expression), 1 GATA-motif (part of a light-responsive element), and 1 HD-Zip 1 (involved in differentiation of the palisade mesophyll cells). The HaZIP1 promoter revealed 1 ABRE (involved in the abscisic acid responsiveness), 1 ARE (essential for the anaerobic induction), 6 CAAT-box (promoter and enhancer regions), 23 TATA-box (core promoter element around − 30 of transcription start), 1 TATC-box (involved in gibberellin-responsiveness), 1 GATA-motif (part of a light-responsive element), 1 ATCT-motif (part of a conserved DNA module involved in light responsiveness), 4 Box 4 (part of a conserved DNA module involved in light responsiveness), 1 CGTCA-motif (involved in the MeJA-responsiveness), 1 O2-site (involved in zein metabolism regulation), 1 SARE (involved in salicylic acid responsiveness), 2 TCA-element (involved in salicylic acid responsiveness), 1 TGA-element (auxin-responsive element), 1 TGACG-motif (involved in the MeJA-responsiveness) and 1 chs-CMA2b (part of a light-responsive element). The HaFRO2 promoter showed numerous cis-acting elements which include 1 ABRE (involved in the abscisic acid responsiveness), 6 ARE (essential for the anaerobic induction), 15 CAAT-box (promoter and enhancer regions), 2 G-Box (involved in light responsiveness), 1 LTR (involved in low-temperature responsiveness), 24 TATA-box (core promoter element around − 30 of transcription start), 2 TATC-box (involved in gibberellin-responsiveness), 1 CAT-box (related to meristem expression), 1 GATA-motif (part of a light responsive element), 1 HD-Zip 1 (involved in differentiation of the palisade mesophyll cells), 1 CGTCA-motif (involved in the MeJA-responsiveness), 1 O2-site (involved in zein metabolism regulation), 1 TGA-element (auxin-responsive element), 1 TGACG-motif (involved in the MeJA-responsiveness), 1 AACA_motif (involved in endosperm-specific negative expression), 1 AE-box (part of a module for light response), 1 AuxRR-core (involved in auxin responsiveness), 1 Box II (part of a light responsive element), 1 CCAAT-box (MYBHv1 binding site), 3 GT1-motif (light responsive element), 2 I-box (part of a light responsive element), 1 LAMP-element (part of a light responsive element), 3 P-box (gibberellin-responsive element), 2 TCT-motif (part of a light responsive element) and 1 circadian (involved in circadian control). CAAT-box (promoter and enhancer regions) and TATA-box (core promoter element around − 30 of transcription start) are shared among the four Fe-related genes of sunflower (Table 2).

Table 2.

Cis-regulatory element analysis of HaIRT1, HaNramp1, HaZIP1 and HaFRO2 promoters.

Genes ABRE ARE AuxRR-core CAAT-box G-Box LTR MBS RY-element TATA-box TATC-box CAT-box GATA-motif HD-Zip 1 ATCT-motif Box 4 CGTCA-motif
HaIRT1 1 1 1 8 2 1 1 1 2 1
HaNramp1 5 6 1 1 1
HaZIP1 1 1 6 23 1 1 1 4 1
HaFRO2 1 6 15 2 1 24 2 1 1 1 1
Genes O2-site SARE TCA-element TGA-element TGACG-motif chs-CMA2b AACA_motif AE-box AuxRR-core Box II CCAAT-box GT1-motif I-box LAMP-element P-box TCT-motif Circadian
HaIRT1
HaNramp1
HaZIP1 1 1 2 1 1 1
HaFRO2 1 1 1 1 1 1 1 1 3 2 1 3 2 1

ABRE (involved in the abscisic acid responsiveness), ARE (essential for the anaerobic induction), AuxRR-core (involved in auxin responsiveness), CAAT-box (located in promoter and enhancer regions), G-Box (involved in light responsiveness), LTR (involved in low-temperature responsiveness), MBS (MYB binding site involved in drought-inducibility), RY-element (involved in seed-specific regulation), TATA-box (core promoter element around − 30 of transcription start), TATC-box (gibberellin-responsiveness), CAT-box (related to meristem expression), GATA-motif (part of a light responsive element), HD-Zip 1 (involved in differentiation of the palisade mesophyll cells), ATCT-motif (part of a conserved DNA module involved in light responsiveness), Box 4 (part of a conserved DNA module involved in light responsiveness), CGTCA-motif (involved in the MeJA-responsiveness), O2-site (involved in zein metabolism regulation), SARE (involved in salicylic acid responsiveness), TCA-element (involved in salicylic acid responsiveness), TGA-element (auxin-responsive element), TGACG-motif (involved in the MeJA-responsiveness), chs-CMA2b (part of a light responsive element), AACA_motif (involved in endosperm-specific negative expression), AE-box (part of a module for light response), Box II (part of a light responsive element), CCAAT-box (MYBHv1 binding site), GT1-motif (light responsive element), I-box (part of a light responsive element), LAMP-element (part of a light responsive element), P-box (gibberellin-responsive element), TCT-motif (part of a light responsive element), circadian (involved in circadian control).

Discussion

Plant growth and photosynthesis under Fe deficiency

Although Fe-deficiency causes damages in plants, a clear understanding of this nutritional stress in sunflower was hazy. In this study, Fe deficiency caused a severe reduction in length and biomass of roots and shoots in sunflower. In addition, the SPAD score dramatically dropped due to Fe starvation, suggesting that chlorophyll degradation in sunflower leaves are associated with the damages in photosynthetic apparatus due to Fe-deficiency. This was further supported by the decrease in the efficiency of photosystem II and photosynthesis performance index in Fe-starved leaves of sunflower. The reduction in the quantum yield of photosystem II is often associated with the Fe-deficient leaves36. Several studies also documented that a chlorotic leaf is closely correlated with photosystem II efficacy in plants under Fe deficiency37,38. A study demonstrated that the redox state of photosystem II acceptors was negatively affected due to Fe deficiency in sugar beet39. Moreover, proteins linked to the reaction center and light-harvesting antenna usually decline in Fe-starved leaves40. It implies that Fe-deficiency appears to inhibit the uptake of Fe but is also closely linked to photosynthetic inefficiency in sunflower. Furthermore, the changes in photosystem II parameters due to Fe-deficiency may be linked to damage in the reaction center or various elements of the energy transfer path in the photosystem II system in Fe-deficient sunflower plants. This message can be useful to strengthen the knowledge to avoid damage to the photosynthetic machinery in sunflower.

Changes in Fe concentration and transporter genes

In this study, the HaIRT1 showed no changes in roots owing to Fe-deficiency, suggesting that this transporter is possibly not involved in Fe-deficiency tolerance in sunflower. In plants, a dual pattern of IRT1 expression was reported in Fe-depleted Arabidopsis41. Thus, it may be possible that the expression is highly dependent on the genotypic background of the cultivar/species and the duration of stress exposed to plants. In contradiction to the expression studies on Fe transporters, studies showed that the expression of IRT1 was induced in Fe-starved tomato42. Another study showed the role of Nramp1 in Fe mobilizing42, but it also cooperates with IRT1 to take up Fe in response to Fe-deficient conditions in Arabidopsis43. In this study, the HaNramp1 significantly downregulated in roots due to Fe-deprivation, suggesting that HaNramp1 is directly associated with the decreased Fe uptake along with its long-distance transport of Fe that eventually resulted in severe growth reduction and photosynthesis damages in sunflower. Also, ZIP proteins are involved in the uptake and transport of Fe and Zn in plants14,16. This is very much consistent with the decrease in Zn concentration and HaZIP1 expression in Fe-deficient sunflower roots. In general, the expression of ZIP genes is induced when plants get deficient in Zn, which facilitates cell Zn influx and Zn movement between organisms and also when plants become deficient in Fe or Mn44,45. Our results imply that HaZIP1 is also involved, at least in part, with Fe acquisition or fully dedicated to Zn uptake in sunflower plants or highly interacting with the Fe status of the sunflower plants. Furthermore, Fe-deficiency is also occurred due to excessive manganese in plants, inhibiting photosynthesis46. Consequently, photoinhibition of PSII may be the ultimate consequence of Mn exposure47. We, therefore, suggest that Fe-deficiency-induced reduction of Fe is tightly linked with the status of other essential elements, leading to the overall sensitivity to stress in sunflower plants. Moreover, the decreased Fe uptake and subsequent translocation largely attributed to the downregulation of several transporters (HaNramp1 and HaZIP1) involved in the uptake of Fe and Zn in roots, which agree with the severe chlorosis and photosynthesis damage in Fe-depleted sunflower.

Changes in Strategy I responses

In this study, we assessed the status of Strategy I responses in Fe-deprived sunflower plants. The FCR activity and its responsible HaFRO2 gene were consistently stable following Fe-starvation in the roots of sunflower. The constitutive expression or upregulation of the FRO1 in Fe-deficient plants, was reported in other plants48,49. However, the variations in FCR activity in response to Fe starvation were also reported in several Strategy I plants15,50. Studies also underscored the importance of FCR in Fe metabolism and photosynthetic efficiency in plants51. Not only that, the degradation of soluble proteins and the occurrence of the cell membrane damages in plants are often related to Fe-deficiency5, which was also evident in Fe depleted sunflower. Taken together, our findings confirm that the induction of FCR is a key factor in withstanding Fe-deficiency in sunflower. Thus, the expression HaFRO1 is one of the strategies that can be modulated to improve Fe-efficiency in sunflower.

Computational prediction suggests that HaIRT1, HaNramp1, HaZIP1, and HaFRO2 genes are localized in the plasma membrane. The Nramp and ZIP transporters are mainly distributed in the plasma membrane in mulberry52. Besides, IRT1 located in the plasma membrane has been established as one of the key plant model proteins for studying Fe acquisition and endomembrane trafficking53. We also constructed a phylogenetic tree in which HaIRT1 and HaZIP1 are clustered together while HaNramp1 and HaFRO2 are located in another cluster, but all these four genes are originated from the same evolutionary ancestor. The coordination of Fe and Zn transporters are widely known in Fe-deficient plants because of the similarities of these metal elements54.

Fe becomes unavailable to plants if the cultivation conditions have a pH higher than 8.015. As a result, plants release H+ in the rhizosphere to reduce the pH level5,51. This is a common Strategy I trait, enabling Fe acquisition that showed a substantial increase as evident from the proton extrusion activity in roots of sunflower. The proton extrusion involvement in Fe-depleted conditions was reported in other dicot plants15,55. Although the proton extrusion can contribute to Fe uptake of sunflower, this adaptive trait was a game-changer to maintain the overall Fe uptake system in Fe-deprived sunflower. Moreover, overcoming Fe-deficiency-induced is a complex process involving cumulative biochemical and molecular induction of Strategy I responses in sunflower plants. Further, the phenolic compounds released by roots responsible for Fe-chelating under Fe deficiency, as previously reported56,57, appear to be not involved with Fe homeostasis in sunflower plants.

In silico characterization of Fe-related genes

In recent years, in silico characterization of candidate genes before the wet-lab experiment is routinely performed to narrow down the target of studies. Conserved motifs are identical sequences of plant species that are maintained by natural selection. A highly conserved sequence has functional roles in plants and can be a useful start point for researching a particular topic of interest58. In this study, three motifs of HaIRT1 and HaZIP1 proteins are linked to ZIP zinc transporter. Several members of the Zn-regulated transporters and Fe-regulated transporter-like Protein (ZIP) gene family have shown to be involved in metal uptake and transport59. In maize, ZIP proteins are localized in cells playing important roles in the uptake of divalent ions60. Also, several ZIP genes are highly induced in roots and are involved in Zn uptake under Zn deficient conditions in barley61 and bean62. In the light of these findings, it suggests that sunflower ZIP transporter might play a role in Fe and Zn uptake and distribution under low Fe availability.

The interaction network of a specific gene provides information about associations that may affect the regulations in response to particular stress in plants. The interactome map analyzed in the String platform showed a close partnership of FRO2 and FRU genes with sunflower with HaIRT1, HaNramp1, HaZIP1, and HaFRO2 genes generally linked to Fe uptake system in plants. Mutant studies showed that plants overexpressing FRO2 grew at a much higher rate than wild-type during Fe-deficient conditions63. Besides, the FRU gene is a mediator in inducing iron mobilization responses, indicating that iron uptake regulation is preserved in dicot species64. Thus, the biological functions of these sunflower Fe-related genes are involved in Fe ion transport and Fe ion homeostasis. Overall, this interactome finding might provide essential background for functional genomics studies of Fe uptake and transport in sunflower and related plant species.

Besides, promoter analysis reveals the involvement of cis-acting elements in HaIRT1, HaNramp1, HaZIP1, and HaFRO2 commonly associated with cis-acting elements in promoter and enhancer regions (CAAT-box) along with core promoter element around − 30 of transcription start (TATA-box). Other than HaNramp1, the Fe-related genes of sunflower are predominantly linked to cis-acting elements involved in the abscisic acid responsiveness, gibberellin-responsiveness, GATA-motif (part of a light-responsive element) and anaerobic induction. Abscisic acid is known to contribute to the response to oxidative damage in Arabidopsis thaliana65. In this study, the HaIRT1 promoter is linked to auxin and salicylic acid elements, while HaZIP1 and HaFRO1 promoters are generally attached to methyl jasmonate-responsive elements in sunflower. Auxin signaling affects Fe signaling and the Fe deficiency response in plants66. A recent study revealed that auxin plays systemic action on the expression of FRO1 in tomato67. Further, Fe deficiency induces salicylic acid signaling, thereby activating Fe translocation via the bHLH38/39-mediated transcriptional regulation of downstream Fe genes68. Gibberellin signaling controls the expression of transcription factor regulation iron-uptake machinery genes69, while jasmonate signaling is involved in the expression of Fe-deficiency induced genes in plants70. Studies demonstrated that promoter is anaerobically induced in plant tissues resulted in the synthesis of a new set of polypeptides or anaerobic stress proteins, but its connection with Fe-deficiency still needs to be established plants71. Altogether, our analysis implies that some hormones can be targeted to improve Fe-efficiency in sunflower.

Conclusion

This study gives new insights into the mechanical basis for Fe-deficiency responses in sunflower. Fe deprivation caused severe physiological and photosynthetic damage in sunflower. Further Fe-deficiency in sunflower resulted in a simultaneous decrease in Fe and Zn status of the plants. This physiological evidence was further supported by the downregulation of HaNramp1 and HaZIP1 transcripts in Fe-starved sunflower roots. Fe-related genes (HaIRT1 and HaZIP1) are localized in the plasma membrane and are predominantly linked to motifs linked to ZIP zinc transporter. Interestingly, FRO2 and FRU partners showed a close association with HaIRT1, HaNramp1, HaZIP1, and HaFRO2 genes in sunflower in addition to the presence of cis-regulatory elements in promoters associated with auxin, salicylic acid, gibberellin, and methyl jasmonate-responsive elements. These results explore our understanding of Fe-starvation responses in the sunflower that can be further utilized in genome-editing or breeding programs to develop Fe-efficient genetic lines.

Supplementary Information

Acknowledgements

We would like to thank Invent Technologies Limited.

Author contributions

A.H.K. developed the idea, performed all experiments and prepared the draft manuscript. S.T. and M.M.E. improved the introduction and methods. A.M.E. provided valuable inputs in manuscript revision.

Funding

The current work was funded by Taif University Researchers Supporting Project number (TURSP-2020/75), Taif University, Taif, Saudi Arabia.

Competing interests

The authors declare no competing interests.

Footnotes

Publisher's note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Supplementary Information

The online version contains supplementary material available at 10.1038/s41598-021-85147-z.

References

  • 1.Kabir AH, Paltridge NG, Roessner U, Stangoulis JC. Mechanisms associated with Fe-deficiency tolerance and signaling in shoots of Pisum sativum. Physiol. Plant. 2013;147:381–395. doi: 10.1111/j.1399-3054.2012.01682.x. [DOI] [PubMed] [Google Scholar]
  • 2.Wang M-Y, Xia R-X, Hu L-M, Dong T, Wu Q-S. Arbuscular mycorrhizal fungi alleviate iron deficient chlorosis in Poncirus trifoliata L. Raf under calcium bicarbonate stress. J. Hortic. Sci. Biotechnol. 2007;82:776–780. doi: 10.1080/14620316.2007.11512304. [DOI] [Google Scholar]
  • 3.Alcantara E, Romera F, Canete M, De la Guardia M. Effects of bicarbonate and iron supply on Fe (III) reducing capacity of roots and leaf chlorosis of the susceptible peach rootstock “Nemaguard”. J. Plant Nutr. 2000;23:1607–1617. doi: 10.1080/01904160009382127. [DOI] [Google Scholar]
  • 4.Zhang X, Zhang D, Sun W, Wang T. The Adaptive mechanism of plants to iron deficiency via iron uptake, transport, and homeostasis. Int. J Mol. Sci. 2019;20:2424. doi: 10.3390/ijms20102424. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Kabir AH, Rahman MM, Haider SA, Paul NK. Mechanisms associated with differential tolerance to Fe deficiency in okra (Abelmoschus esculentus Moench) Environ. Exp. Bot. 2015;112:16–26. doi: 10.1016/j.envexpbot.2014.11.011. [DOI] [Google Scholar]
  • 6.Jiang C, Gao H, Zou Q, Shi L. Effects of iron deficiency on photosynthesis and photosystem II function in soybean leaf Zhi wu sheng li yu fen zi sheng wu xue xue bao. J. Plant Physiol. Mol. Biol. 2007;33:53–60. [PubMed] [Google Scholar]
  • 7.Bertamini M, Muthuchelian K, Nedunchezhian N. Iron deficiency induced changes on the donor side of PS II in field grown grapevine (Vitis vinifera L. cv. Pinot noir) leaves. Plant Sci. 2002;162:599–605. doi: 10.1016/S0168-9452(01)00604-5. [DOI] [Google Scholar]
  • 8.Vigani G, Zocchi G. The fate and the role of mitochondria in Fe-deficient roots of strategy I plants. Plant Signal. Behav. 2009;4(5):375–379. doi: 10.4161/psb.4.5.8344. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Walker EL, Connolly EL. Time to pump iron: Iron-deficiency-signaling mechanisms of higher plants. Curr. Opin. Plant Biol. 2008;11:530–535. doi: 10.1016/j.pbi.2008.06.013. [DOI] [PubMed] [Google Scholar]
  • 10.M’sehli W, Jellali N, Dell’Orto M, Abdelly C, Zocchi G, Gharsalli M. Responses of two lines of Medicago ciliaris to Fe deficiency under saline conditions. Plant Growth Regul. 2011;64:221–230. doi: 10.1007/s10725-010-9561-y. [DOI] [Google Scholar]
  • 11.Młodzińska E. Alteration of plasma membrane H+-ATPase in cucumber roots under different iron nutrition. Acta Physiol. Plant. 2012;34:2125–2133. doi: 10.1007/s11738-012-1013-z. [DOI] [Google Scholar]
  • 12.Colangelo EP, Guerinot ML. The essential basic helix–loop– helix protein FIT1 is required for the iron deficiency response. Plant Cell. 2004;16:3400–3412. doi: 10.1105/tpc.104.024315. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Jin CW, He YF, Tang CX, Wu P, Zheng SJ. Mechanisms of microbial enhanced iron uptake in red clover. Plant Cell Environ. 2006;29:888–897. doi: 10.1111/j.1365-3040.2005.01468.x. [DOI] [PubMed] [Google Scholar]
  • 14.Eckhardt U, Marques AM, Buckout TJ. Two iron-regulated cation transporters from tomato complement metal uptake-deficient yeast mutants. Plant Mol. Biol. 2001;45:437–448. doi: 10.1023/A:1010620012803. [DOI] [PubMed] [Google Scholar]
  • 15.Kabir AH, Paltridge NG, Able AJ, Paul JG, Stangoulis JC. Natural variation for Fe-efficiency is associated with upregulation of Strategy I mechanisms and enhanced citrate and ethylene synthesis in Pisum sativum L. Planta. 2012;235(6):1409–1419. doi: 10.1007/s00425-011-1583-9. [DOI] [PubMed] [Google Scholar]
  • 16.Vert G, Briat JF, Curie C. Arabidopsis IRT2 gene encodes a root-periphery transporter. Plant J. 2001;26:181–189. doi: 10.1046/j.1365-313x.2001.01018.x. [DOI] [PubMed] [Google Scholar]
  • 17.Korshunova YO, Eide D, Clark WG, Guerinot ML, Pakrasi HB. The IRT1 protein from Arabidopsis thaliana is a metal transporter with broad specificity. Plant Mol. Biol. 1999;40:37–44. doi: 10.1023/A:1026438615520. [DOI] [PubMed] [Google Scholar]
  • 18.Chen H, Wang Y, Yang H, Zeng Q, Liu Y. NRAMP1 promotes iron uptake at the late stage of iron deficiency in poplars. Tree Physiol. 2019;39(7):1235–1250. doi: 10.1093/treephys/tpz055. [DOI] [PubMed] [Google Scholar]
  • 19.Burleigh SH, Kristensen BK, Ellegaard BI. A plasma membrane zinc transporter from Medicago truncatula is up-regulated in roots by Zn fertilization, yet down-regulated by arbuscular mycorrhizal colonization. Plant Mol. Biol. 2003;52:1077–1088. doi: 10.1023/A:1025479701246. [DOI] [PubMed] [Google Scholar]
  • 20.Forieri I, Wirtz M, Hell R. Toward new perspectives on the interaction of iron and sulfur metabolism in plants. Front. Plant Sci. 2013;4:357. doi: 10.3389/fpls.2013.00357. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Cao M-J, Wang Z, Wirtz M, Hell R, Oliver DJ, Xiang C-B. SULTR3;1 is a chloroplast-localized sulfate transporter in Arabidopsis thaliana. Plant J. 2013;73:607–616. doi: 10.1111/tpj.12059. [DOI] [PubMed] [Google Scholar]
  • 22.Takahashi H, Kopriva S, Giordano M, Saito K, Hell R. Sulfur assimilation in photosynthetic organisms: Molecular functions and regulations of transporters and assimilatory enzymes. Annu. Rev. Plant Biol. 2011;62:157–184. doi: 10.1146/annurev-arplant-042110-103921. [DOI] [PubMed] [Google Scholar]
  • 23.Zuchi S, Watanabe M, Hubberten HM, Bromke M, Osorio S, Fernie AR, Celletti S, Paolacci AR, Catarcione G, Ciaffi M, Hoefgen R, Astolfi S. The interplay between sulfur and iron nutrition in tomato. Plant Physiol. 2015;169(4):2624–2639. doi: 10.1104/pp.15.00995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Kabir AH, Begum MC, Haque A, Amin R, Swaraz AM, Haider SA, Paul NK, Hossain MM. Genetic variation in Fe toxicity tolerance is associated with the regulation of translocation and chelation of iron along with antioxidant defence in shoots of rice. Funct. Plant Biol. 2016;43:1070–1081. doi: 10.1071/FP16068. [DOI] [PubMed] [Google Scholar]
  • 25.Hoagland, D.R. & Arnon, D.I. The water-culture method for growing plants without soil. Circ. Calif. Agric. Exp. Stat. 347 (1950).
  • 26.Guy C, Haskell D, Neven L, Klein P, Smelser C. Hydration-state-responsive protein link cold and drought stress in spinach. Planta. 1992;188:265–270. doi: 10.1007/BF00216823. [DOI] [PubMed] [Google Scholar]
  • 27.Lutts S, Kinet JM, Bouharmont J. NaCl-induced senescence in leaves of rice (Oryza sativa L.) cultivar differing in salinity resistance. Ann. Bot. 1996;78:389–398. doi: 10.1006/anbo.1996.0134. [DOI] [Google Scholar]
  • 28.Yu CS, Chen YC, Lu CH, Hwang JK. Prediction of protein subcellular localization. Proteins. 2006;64:643–651. doi: 10.1002/prot.21018. [DOI] [PubMed] [Google Scholar]
  • 29.Kogure K, Yamauchi I, Tokumura A. Novel antioxidants isolated from plants of the genera Ferula, Inula, Prangos and Rheum collected in Uzbekistan. Phytomedicine. 2004;11:645–651. doi: 10.1016/j.phymed.2003.09.004. [DOI] [PubMed] [Google Scholar]
  • 30.Zhao J, Fujita K, Sakai K. Oxidative stress in plant cell culture: A role in production of β-thujaplicin by Cupressus lusitanica cell cultures. Biotechnol. Bioeng. 2005;90:621–631. doi: 10.1002/bit.20465. [DOI] [PubMed] [Google Scholar]
  • 31.Livak KJ, Schmittgen TD. Analysis of relative gene expression data using real-time quantitative PCR and the 2−ΔΔCT method. Methods. 2001;25:402–408. doi: 10.1006/meth.2001.1262. [DOI] [PubMed] [Google Scholar]
  • 32.Tamura K, Stecher G, Peterson D, Filipski A, Kumar S. MEGA6: Molecular evolutionary genetics analysis version 6.0. Mol. Biol. Evol. 2013;30(12):2725–2729. doi: 10.1093/molbev/mst197. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Timothy LB, Mikael B, Fabian AB, Martin F, Charles EG, Luca C, Jingyuan R, Wilfred WL, William S. MEME SUITE: Tools for motif discovery and searching. Nucleic Acids Res. 2009;37:W202–W208. doi: 10.1093/nar/gkp335. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Szklarczyk D, Gable AL, Lyon D, Junge A, Wyder S, Huerta-Cepas J, Simonovic M, Doncheva NT, Morris JH, Bork P, Jensen LJ, von Mering C. STRING v11: Protein–protein association networks with increased coverage, supporting functional discovery in genome-wide experimental datasets. Nucleic Acids Res. 2019;47:D607–613. doi: 10.1093/nar/gky1131. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Lescot M, Déhais P, Thijs G, Marchal K, Moreau Y, Peer YV, Rouze P, Rombauts S. Plant CARE, a data base of plant cis-acting regulatory elements and a portal to tools for in silico analysis of promoter sequences. Nucleic Acids Res. 2002;30:325–327. doi: 10.1093/nar/30.1.325. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Abadía J, Morales F, Abadia A. Photosystem II efficiency in low chlorophyll, iron-deficient leaves. Rec. Prog. Plant Nutr. 1999;215(2):183–192. [Google Scholar]
  • 37.Gogorcena Y, Molias N, Larbi A, Abadía J, Abadía A. Characterization of the responses of cork oak (Quercus suber) to iron deficiency. Tree Physiol. 2001;21:1335–1340. doi: 10.1093/treephys/21.18.1335. [DOI] [PubMed] [Google Scholar]
  • 38.Donnini S, Castagna A, Guidi L, Zoechi G, Ranieri A. Leaf responses to reduced iron availability in two tomato genotypes: T3238FER (iron efficient) and T3238fer (iron inefficient) J. Plant Nutr. 2003;26:2137–2148. doi: 10.1081/PLN-120024270. [DOI] [Google Scholar]
  • 39.Belkhodja R, Morales F, Quilez R, Lopez-Millan AF, Abadia A, Abadia J. Iron deficiency causes changes in chlorophyll fluorescence due to the reduction in the dark of the Photosystem II acceptor side. Photosynth. Res. 1998;56:265–276. doi: 10.1023/A:1006039917599. [DOI] [Google Scholar]
  • 40.Devadasu ER, Madireddi SK, Nama S, Subramanyam R. Iron deficiency cause changes in photochemistry, thylakoid organization, and accumulation of photosystem II proteins in Chlamydomonas reinhardtii. Photosynth. Res. 2016;130(1–3):469–478. doi: 10.1007/s11120-016-0284-4. [DOI] [PubMed] [Google Scholar]
  • 41.Connolly EL, Fett JP, Guerinot ML. Expression of the IRT1 metal transporter is controlled by metals at the levels of transcript and protein accumulation. Plant Cell. 2002;14:1347–1357. doi: 10.1105/tpc.001263. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Bereczky Z, Wang HY, Schubert V, Ganal M, Bauer P. Differential regulation of nramp and irt metal transporter genes in wild type and iron uptake mutants of tomato. J. Biol. Chem. 2003;278(27):24697–24704. doi: 10.1074/jbc.M301365200. [DOI] [PubMed] [Google Scholar]
  • 43.Castaings L, Caquot A, Loubet S, Curie L. The high-affinity metal transporters NRAMP1 and IRT1 team up to take up iron under sufficient metal provision. Sci. Rep. 2016;6:37222. doi: 10.1038/srep37222. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Ramesh SA, Shin R, Eide DJ, Schachtman DP. Differential metal selectivity and gene expression of two zinc transporters from rice. Plant Physiol. 2003;133:126–134. doi: 10.1104/pp.103.026815. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Vert G, Grotz N, Dédaldéchamp F, Gaymard F, Guerinot ML, Briat JF, Curie C. IRT1, an Arabidopsis transporter essential for iron uptake from the soil and for plant growth. Plant Cell. 2002;14:1223–1233. doi: 10.1105/tpc.001388. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Blamey FPC, Hernandez-Soriano M, Cheng M, Tang C, Paterson D, Lombi E, et al. Synchrotron-based techniques shed light on mechanisms of plant sensitivity and tolerance to high manganese in the root environment. Plant Physiol. 2015;169:2006–2020. doi: 10.1104/pp.15.00726. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Alejandro S, Höller S, Meier B, Peiter E. Manganese in plants: From acquisition to subcellular allocation. Front. Plant Sci. 2020;11:300. doi: 10.3389/fpls.2020.00300. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Jelali N, Wissala M, Dell’orto M, Abdellya C, Gharsallia M, Zocchib G. Changes of metabolic responses to direct and induced Fe deficiency of two Pisum sativum cultivars. Environ. Exp. Bot. 2010;68:238–246. doi: 10.1016/j.envexpbot.2009.12.003. [DOI] [Google Scholar]
  • 49.Waters BM, Blevins DG, Eide DJ. Characterization of FRO1, a pea ferric-chelate reductase involved in root iron acquisition. Plant Physiol. 2002;129:85–94. doi: 10.1104/pp.010829. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Waters BM, Lucena C, Romera FJ, Jester GG, Wynn AN, Rojas CL, Alcantara E, Perez-Vicente R. Ethylene involvement in the regulation of the H+-ATPase CsHA1 gene and of the new isolated ferric reductase CsFRO1 and iron transporter CsIRT1 genes in cucumber plants. Plant Physiol. Biochem. 2007;45:293–301. doi: 10.1016/j.plaphy.2007.03.011. [DOI] [PubMed] [Google Scholar]
  • 51.Jain A, Wilson GT, Connolly EL. The diverse roles of FRO family metalloreductases in iron and copper homeostasis. Front. Plant Sci. 2014;5:100. doi: 10.3389/fpls.2014.00100. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Fan W, Liu C, Cao B, Qin M, Long D, Xiang Z, Zhao A. Genome-wide identification and characterization of four gene families putatively involved in cadmium uptake, translocation and sequestration in mulberry. Front. Plant Sci. 2018;9:879. doi: 10.3389/fpls.2018.00879. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Khan I, Gratz R, Denezhkin P, Schott-Verdugo SN, Angrand K, Genders L, Basgaran RM, Fink-Straube C, Brumbarova T, Gohlke H, Bauer P, Ivanov R. Calcium-promoted interaction between the C2-domain protein EHB1 and metal transporter IRT1 inhibits Arabidopsis iron acquisition. Plant Physiol. 2019;180(3):1564–1581. doi: 10.1104/pp.19.00163. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Anuradha N, Satyavathi CT, Bharadwaj C, Nepolean T, Sankar SM, Singh SP, Meena MC, Singhal T, Srivastava RK. Deciphering genomic regions for high grain iron and zinc content using association mapping in pearl millet. Front. Plant Sci. 2017;8:412. doi: 10.3389/fpls.2017.00412. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Santi S, Schmidt W. Dissecting iron deficiency-induced proton extrusion in Arabidopsis roots. New Phytol. 2009;183:1072–1084. doi: 10.1111/j.1469-8137.2009.02908.x. [DOI] [PubMed] [Google Scholar]
  • 56.Curie C, Briat J. Iron transport and signalling in plants. Ann. Rev. Plant Biol. 2003;54:183–206. doi: 10.1146/annurev.arplant.54.031902.135018. [DOI] [PubMed] [Google Scholar]
  • 57.Blum U, Staman KL, Flint LJ, Shafer SR. Induction and/or selection of phenolic acid-utilizing bulk-soil and rhizosphere bacteria and their influence on phenolic acid phytotoxicity. J. Chem. Ecol. 2000;26(9):2059–2078. doi: 10.1023/A:1005560214222. [DOI] [Google Scholar]
  • 58.Wong A, Gehring C, Irving HR. Conserved functional motifs and homology modeling to predict hidden moonlighting functional sites. Front. Bioeng. Biotechnol. 2015;3:82. doi: 10.3389/fbioe.2015.00082. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Gainza-Cortés F, Pérez-Dïaz R, Pérez-Castro R, Tapia J, Casaretto JA, González S, Peña-Cortés H, Ruiz-Lara S, González E. Characterization of a putative grapevine Zn transporter, VvZIP3, suggests its involvement in early reproductive development in Vitis vinifera L. BMC Plant Biol. 2012;12:111. doi: 10.1186/1471-2229-12-111. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60.Li S, Zhou X, Huang Y, Zhu L, Zhang S, Zhao Y, Guo J, Chen J, Chen R. Identification and characterization of the zinc-regulated transporters, iron-regulated transporter-like protein (ZIP) gene family in maize. BMC Plant Biol. 2013;13:114. doi: 10.1186/1471-2229-13-114. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Pedas P, Schjoerring JK, Husted S. Identification and characterization of zinc-starvation-induced ZIP transporters from barley roots. Plant Physiol. Biochem. 2009;47:377–383. doi: 10.1016/j.plaphy.2009.01.006. [DOI] [PubMed] [Google Scholar]
  • 62.Astudillo C, Fernandez A, Blair MW, Cichy KA. The Phaseolus vulgaris ZIP gene family: Identification, characterization, mapping, and gene expression. Front. Plant Sci. 2013;4:286. doi: 10.3389/fpls.2013.00286. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Connolly EL, Campbell NH, Grotz N, Prichard CL, Guerinot ML. Overexpression of the FRO2 ferric chelate reductase confers tolerance to growth on low iron and uncovers posttranscriptional control. Plant Physiol. 2003;133(3):1102–1110. doi: 10.1104/pp.103.025122. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Jakoby M, Wang HY, Reidt W, Weisshaar B, Bauer P. FRU (BHLH029) is required for induction of iron mobilization genes in Arabidopsis thaliana. FEBS Lett. 2004;577(3):528–534. doi: 10.1016/j.febslet.2004.10.062. [DOI] [PubMed] [Google Scholar]
  • 65.Komarnytsky S, Borisjuk N. Functional analysis of promoter elements in plants. Genet. Eng. 2003;25:113–141. doi: 10.1007/978-1-4615-0073-5_6. [DOI] [PubMed] [Google Scholar]
  • 66.Shen C, Yue R, Sun T, Zhang L, Yang Y, Wang H. OsARF16, a transcription factor regulating auxin redistribution, is required for iron deficiency response in rice (Oryza sativa L.) Plant Sci. Int. J. Exp. Plant Biol. 2015;231:148–158. doi: 10.1016/j.plantsci.2014.12.003. [DOI] [PubMed] [Google Scholar]
  • 67.Celletti S, Pii Y, Valentinuzzi F, Tiziani R, Fontanella MC, Beone GM, Mimmo T, Cesco S, Astolfi S. Physiological responses to Fe deficiency in split-root tomato plants: Possible roles of auxin and ethylene? Agronomy. 2020;10:1000. doi: 10.3390/agronomy10071000. [DOI] [Google Scholar]
  • 68.Shen C, Yang Y, Liu K, Zhang L, Guo H, Sun T, Wang H. Involvement of endogenous salicylic acid in iron-deficiency responses in Arabidopsis. J. Exp. Bot. 2016;67(14):4179–4193. doi: 10.1093/jxb/erw196. [DOI] [PubMed] [Google Scholar]
  • 69.Wild M, Davière JM, Regnault T, Sakvarelidze-Achard L, Carrera E, Lopez Diaz I, Cayrel A, Dubeaux G, Vert G, Achard P. Tissue-specific regulation of gibberellin signaling fine-tunes Arabidopsis iron-deficiency responses. Dev. Cell. 2016;37(2):190–200. doi: 10.1016/j.devcel.2016.03.022. [DOI] [PubMed] [Google Scholar]
  • 70.Kobayashi T, Itai RN, Senoura T, Oikawa T, Ishimaru Y, Ueda M, Nakanishi H, Nishizawa NK. Jasmonate signaling is activated in the very early stages of iron deficiency responses in rice roots. Plant Mol. Biol. 2016;91(4–5):533–547. doi: 10.1007/s11103-016-0486-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Hansch R, Mendel RR, Cerff R, Hehl R. Light-dependent anaerobic induction of the maize glyceraldehyde-3-phosphate dehydrogenase 4 (GapC4) promoter in Arabidopsis thaliana and Nicotiana tabacum. Ann. Bot. 2003;91(2):149–154. doi: 10.1093/aob/mcf120. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials


Articles from Scientific Reports are provided here courtesy of Nature Publishing Group

RESOURCES