Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2021 Jul 6.
Published in final edited form as: Biochem J. 2020 Jan 17;477(1):75–97. doi: 10.1042/BCJ20190540

Aspirin Inhibits TGFβ2-Induced Epithelial to Mesenchymal Transition of Lens Epithelial Cells: Selective acetylation of K56 and K122 in histone H3

Mi-Hyun Nam 1, Andrew JO Smith 2, Mina B Pantcheva 1, Ko Uoon Park 1, Joseph A Brzezinski 1, James J Galligan 4,5, Kristofer Fritz 3, I Michael Wormstone 2, Ram H Nagaraj 1,3,*
PMCID: PMC8259308  NIHMSID: NIHMS1698429  PMID: 31815277

Abstract

Posterior capsule opacification (PCO) is a complication after cataract surgery that can disrupt vision. The epithelial to mesenchymal transition (EMT) of lens epithelial cells (LECs) in response to transforming growth factor β2 (TGFβ2) has been considered an obligatory mechanism for PCO. In this study, we tested the efficacy of aspirin in inhibiting the TGFβ2-mediated EMT of human LECs, LECs in human lens capsular bags, and lensectomized mice. In human LECs, the levels of the EMT markers α-smooth muscle actin (α-SMA) and fibronectin were drastically reduced by treatment with 2 mM aspirin. Aspirin also halted the EMT response of TGFβ2 when introduced after EMT initiation. In human capsular bags, treatment with 2 mM aspirin significantly suppressed posterior capsule wrinkling and the expression α-SMA in capsule-adherent LECs. The inhibition of TGFβ2-mediated EMT in human LECs was not dependent on Smad phosphorylation or MAPK and AKT-mediated signaling. We found that aspirin significantly increased the acetylation of K56 and K122 in histone H3 of human LECs. Chromatin immunoprecipitation assays using acetyl-H3K56 or acetyl-H3K122 antibody revealed that aspirin blocked the TGFβ2-induced acetylation of H3K56 and H3K122 at the promoter regions of ACTA2 and COL1A. After lensectomy in mice, we observed an increase in the proliferation and α-SMA expression of the capsule-adherent LECs, which was ameliorated by aspirin administration through drinking water. Taken together, our results showed that aspirin inhibits TGFβ2-mediated EMT of LECs, possibly from epigenetic downregulation of EMT-related genes.

Keywords: aspirin, epithelial-mesenchymal transition, posterior capsule opacification, lens epithelial cells, histone acetylation

INTRODUCTION

During cataract surgery, a small portion of the anterior lens capsule is excised, and the cloudy lens is removed and replaced with an artificial intraocular lens (IOL). During this procedure, efforts are made to remove epithelial cells adhering to the anterior capsule, but some cells still remain. These remaining lens epithelial cells (LECs) can proliferate, migrate and undergo EMT and cause wrinkling of the posterior capsule, ultimately resulting in posterior capsule opacification (PCO) [1]. PCO is one of the most common post cataract surgery complications that can impede vision. It is reported to occur in 20% to 40% of patients 2 to 5 years after surgery [2]. PCO is even more prevalent in children younger than 4 years old who undergo cataract surgery; the rate can reach 100% within 2 years after surgery, probably due to the high proliferative and migratory abilities of LECs in this population [3]. Neodymium doped: yttrium-aluminum-garnet (Nd:YAG) laser capsulotomy is the treatment of choice for PCO [4]. However, Nd:YAG laser treatment can lead to macular edema, retinal tear, endophthalmitis, anterior uveitis and myopia [57]; therefore more effective methods to prevent PCO are needed.

The TGFβ signaling pathway is a common driver of EMT, which is characterized by the loss of epithelial cell properties and the acquisition of mesenchymal cell properties [8]. TGFβ-induced activation of the TGFβ receptor leads to the phosphorylation of the transcription factors Smad2 and Smad3. Phosphorylated Smad2 and Smad3 form a triad with Smad4 and translocate to the nucleus, where they associate and cooperate with DNA binding transcription factors to activate or repress target genes [9]. TGFβ2 is the predominant cytokine in the aqueous humor of the eye. Numerous studies support that TGFβ2 signaling plays a central role in the pathogenesis of PCO (reviewed in [10]).

Aspirin (acetylsalicylic acid) is one of the most widely used drugs to treat pain, fever, and inflammation [11]. Low doses of aspirin are widely used for the treatment of acute coronary diseases such as heart attacks, strokes, and thrombosis [12]. The antithrombotic effect of aspirin is due to inhibition of cyclooxygenases 1 and 2 (COX-1 and COX-2) via acetylation of serine residues 530 and 516 at the active site of the enzyme [13]. Aspirin also acetylates lysine residues in cellular and extracellular proteins [1417]. A recent comprehensive proteomic study identified more than 12,000 lysine acetylation sites in HeLa cells that were treated with 5 mM aspirin for 6 h [18]. In addition, aspirin has been shown to acetylate and modify histones. For example, Guo et al. [19] suggested that aspirin protects against experimentally induced colon cancer via acetylation of histone H3 at lysine (K) residue 27. In another study, aspirin was found to cooperate with p300 to promote histone H3 K9 acetylation [20], and this property was implicated in the induction of apoptosis in cultured colorectal stem cells. Histone deacetylases (HDACs) reverse the aspirin-mediated lysine acetylation [14], and HDAC inhibitors cause cytotoxic effects from aspirin-mediated hyperacetylation of proteins [21, 22]. Whether the beneficial effects of aspirin intake are due to its acetylation of proteins is an active topic of investigation. With regard to its effect in the eye, regular intake of aspirin was found to be associated with an increased risk of incident neovascular AMD [23], but an earlier Physicians’ Health Study-I showed a slightly better outcome for AMD [24]. Aspirin intake did not alter the progression of retinopathy [25] or open-angle glaucoma [26]. Aspirin has been shown to inhibit experimental cataracts through acetylation of lens proteins [27, 28]. In human trials, some studies have shown protective effects against cataracts [29, 30], while others did not [31]. Whether aspirin has any effect on PCO has not been investigated. It is known that histone acetylation at arginine or lysine residues is associated with the repression of EMT [32, 33]. Studies have shown that inhibitors of HDACs suppress EMT in epithelial cells, including LECs, by increasing the acetylation of histones and α-tubulin [3436]. It has also been shown that acetylated α-tubulin plays an important role in microtubule stabilization and cell morphology, and it is profoundly decreased during TGFβ-induced EMT [37].This suggests that deacetylation of α-tubulin is not just a marker for EMT but also plays a direct role in controlling EMT. However, the precise role of histone acetylation in the EMT of LECs, especially in the regulation of transcriptional factors, remains unclear. In this study we tested the hypothesis that the acetylation of proteins by aspirin is inhibitory against the TGFβ2-mediated EMT in LECs.

EXPERIMENTAL

Treatment of human LECs with TGFβ2

The fetal human lens epithelial cell line (FHL124) was kindly provided by Prof. Michael Wormstone (School of Biological Sciences, University of East Anglia, UK, originally from Prof. John Reddan, Oakland University, MI). FHL124 cells were cultured as previously described [38] and treated with aspirin (Sigma-Aldrich, St. Louis, MO, Cat# A5376) at 2 mM for 24 h and then cotreated with 10 ng/ml TGFβ2 (Peprotech, Inc., Rocky Hill, NJ, Cat# 100–35B,10 ng/ml) for the additional indicated times. The MTT assay was used to determine the cytotoxicity of aspirin or cell proliferation.

Measurement of aspirin in the culture medium

To determine the effective concentration of aspirin in the cell culture medium, 2 mM aspirin was incubated in MEM with or without 5% FBS. After 48 h, serum albumin-bound aspirin was removed using Amicon Ultra-0.5 ml centrifugal filters (10,000 NMWL, UFC501024, Millipore). The filtrate was incubated with 1 N NaOH at 50°C for 10 min, and the volume was made up to 200 μL with 0.02 M iron(III) chloride solution. The reaction product was measured spectrophotometrically at 530 nm using aspirin as the standard.

Western blotting

Total cell lysates were prepared using RIPA buffer (Thermo Fisher Scientific, Cat# 89900) containing a protease inhibitor (Sigma-Aldrich, Cat# P8465, 1:100 dilution) and/or phosphatase inhibitor cocktail (Sigma-Aldrich, Cat# P8340, 1:100 dilution). The cells were separated into cytoplasmic and nuclear fractions using a NucBusterTM protein extraction kit (Novagen, San Diego, CA, Cat# 711833) according to the manufacturer’s protocol. Total histones were extracted using a standard extraction kit (Abcam, Cambridge, MA, Cat# ab113476). Western blotting was carried out as previously described [39]. The primary antibodies (applied overnight at 4°C) for western blotting were as follows: α-SMA (1:5,000 dilution, Sigma-Aldrich, Cat# A5228), αB-crystallin (1:10,000 dilution, Developmental Studies Hybridoma Bank, University of Iowa, IA), fibronectin (FN, 1:200 dilution, Santa Cruz Biotechnology, Cat# sc-9068), acetyl histone H3K115 (1:500 dilution, Abcam, Cat# ab240888), acetyl histone H3K122 (1:1,000 dilution, Abcam, Cat# ab33309), histone H3 (1:1,000 dilution, Cat# 9715), acetyl-histone H3K9, K14, K18, K56 (acetyl-histone H3 antibody sampler kit, 1:1,000 dilution, Cat# 9927), Smad2 (1:1,000 dilution, Cat# 9339), p-Smad2 (1:1,000 dilution, Cat# 3101), Smad3 (1:1,000 dilution, Cat# 9523), p-Smad3 (1:1,000 dilution, Cat# 9520), Smad4 (1:500 dilution, Cat# 9515), ERK (1:2,000 dilution, Cat# 4695), p-ERK (1:1,000 dilution, Cat# 4370), P38 (1:2,000 dilution, Cat# 9212), p-P38 (1:1,000 dilution, Cat# 4511), AKT (1:2,000 dilution, Cat# 9272), p-AKT (1:1,000 dilution, Cat# 9271), acetyllysine (1:2,000 dilution, Cat# 9681), acetyl-α-tubulin (1:1,000 dilution, Cat# 5335), and β-actin (1:5,000 dilution, Cat# 4970). HRP-conjugated anti-rabbit IgG (1:5,000 dilution, Cat# 7074) or anti-mouse IgG (1:5,000 dilution, Cat# 7076) (Cell Signaling Technology, Inc., Beverly, MA) secondary antibodies were incubated at room temperature (RT) for 1 h and detected with the SuperSignal West Pico or Femto Kit (Pierce Chemicals, Rockford, IL). Band intensities were normalized to housekeeping genes using ImageJ software and presented as the fold change over controls.

Quantitative real‐time PCR

Quantitative real‐time PCR was performed as previously described [39]. RNA was isolated using the RNeasy Plus Micro Kit (Qiagen, Valencia, CA). Two micrograms of RNA was reverse-transcribed to synthesize cDNA using the QuantiTect Reverse Transcription Kit (Qiagen). Quantitative real‐time PCR was performed with SsoAdvanced™ Universal SYBR® Green Supermix (Bio-Rad, Richmond, CA, USA) using an iCycler iQ5 Real-Time PCR Detection System (Bio-Rad). The primers used are listed in Table 1. The mRNA levels were normalized to GAPDH.

Table 1.

Primer sequences for qRT-PCR

Gene Primer Sequence Experiment
α-SMA
(ACTA2)
Forward 5′-TTCAATGTCCCAGCCATGTA-3′ qRT-PCR
Reverse 5′-GAAGGAATAGCCACGCTCAG-3′

αB-Crystallin
(CRYAB)
Forward 5′-CTTTGACCAGTTCTTCGGAG-3′ qRT-PCR
Reverse 5′-CCTCAATCACATCTCCCAAC-3′

Fibronectin
(FN1)
Forward 5′-TTCGAGATCAGTGCATTGTTGAT-3′ qRT-PCR
Reverse 5′-TCATGACGCTTGTGGAATGTG-3′

GAPDH Forward 5′-GTCAGTGGTGGACCTGACCT-3′ qRT-PCR
Reverse 5′-TGCTGTAGCCAAATTCGTTG-3′

ACTA2 Forward 5’ CGGTAAACAAGCCTCCAGAAGC 3’ ChIP
Reverse 5’ CAGCACCGAAGCAGTGGTTAAG 3’

COL1A1 Forward 5’ AGGACAGTATAAAAGGGGCCCG 3’ ChIP
Reverse 5’ TGTAGACTCTTTGTGGCTGGGG 3’

F-actin staining

FHL124 cells were stained with Texas Red-X phalloidin (1:40 dilution, Life Technologies) for 45 min at 37°C for visualization of the F-actin cytoskeleton. The preparations were washed three times with 5% normal goat serum in PBS and mounted with Vectashield mounting medium with DAPI (H‐1200, Vector Laboratories Inc., Burlingame, CA). Images were viewed using a confocal microscope (Zeiss confocal laser scanning microscope LSM 510).

Cell migration

FHL124 cells were scraped in a straight line with a 200 μl pipet tip, debris was washed out twice with PBS, and cells were photographed for the initial time point under a phase-contrast microscope (Day 0). After images were acquired, cells were treated with either serum-free medium or serum-free medium containing 2 mM aspirin for 24 h. On Day 1, TGFβ2 was added for an additional 24 h. After the incubation, cells were imaged in the same region (Day 2), and the rate of cell migration was analyzed by quantifying the total distance the cells moved from the edge of the scratch toward the center.

Human capsular bag model to study the effect of aspirin on the EMT of LECs

Simulated cataract operations were performed to create capsular bags from human donor lenses [40] that were obtained with informed consent and used in accordance with the tenets of the Declaration of Helsinki. Approval for the study and experimental protocols (04/Q0102/57) was granted by a National Research Ethics Committee (UK). A small capsulorhexis, approximately 5 mm in diameter, was created in the anterior lens capsule, thus allowing access to the lens fiber mass, which was removed by hydroexpression. Residual lens fibers were removed by joint irrigation and aspiration. The product of this procedure was termed a capsular bag, which was then removed from the eye by dissecting it from the zonular fibers. The capsular bag was then secured onto a sterile 35-mm polymethylmethacrylate petri dish using eight entomological pins (Anglian Lepidopterist Supplies, Norfolk, UK) inserted at the edge of the capsule to ensure that the capsular bag maintained its shape. The capsular bags were maintained in either serum-free or 5% FCS-supplemented Eagle’s minimum essential medium (EMEM) (Sigma-Aldrich, Dorset, UK) as standard control medium. Match-paired experiments were performed using capsular bags prepared from the same donor. The four match-paired combinations tested were: SF EMEM ± 2 mM aspirin; SF EMEM supplemented with 10 ng/ml TGFβ ± 2 mM aspirin; 5% FCS EMEM ± 2 mM aspirin; 5% FCS EMEM supplemented with 10 ng/ml TGFβ ± 2 mM aspirin. In all cases, 50 μg/ml gentamicin (Sigma-Aldrich) was present, and preparations were incubated at 35°C in a 5% CO2 atmosphere. The medium was replaced every 2–4 days, and ongoing observations of cell growth were performed using a Nikon phase-contrast microscope (Nikon, Tokyo, Japan) and a digital camera (Nikon) to capture images. At the experimental end point, the culture medium was removed from the petri dishes, and the capsular bags were fixed in 4% formaldehyde (Sigma-Aldrich) for 30 min. Quantification of cell growth across the posterior lens capsule was performed using image analysis software (ImageJ, 1.48v). Capsular wrinkling/matrix contraction was assessed at the experimental endpoint by analyzing modified dark-field images of the central posterior capsule. Images were subjected to the find edges function on ImageJ. Edges associated with wrinkles appear bright against a dark background. The image is then subjected to thresholding, which allows quantification.

Immunofluorescence

Fixed capsular bags were rinsed three times with PBS, followed by three washes in a solution containing 0.02% w/v BSA and 0.05% v/v IGEPAL (Sigma-Aldrich) in PBS. The preparations were permeabilized with PBS containing 0.5% v/v Triton X-100 (Sigma-Aldrich) for 30 min. Three additional washes with 0.02% w/v BSA and 0.05% v/v IGEPAL in PBS were performed before nonspecific binding sites were blocked for 1 h with normal goat serum (Sigma-Aldrich) diluted 1:50 in 1% w/v BSA in PBS. Primary anti-α-SMA mouse monoclonal antibody (Sigma-Aldrich, Cat# A2547) was diluted 1:100 with 1% w/v BSA in PBS and applied for 1 h at 37°C. Three washes with 0.02% w/v BSA and 0.05% v/v IGEPAL in PBS were subsequently performed, and α-SMA was visualized using an Alexa Fluor 488-conjugated goat anti-mouse secondary antibody (Invitrogen, Paisley, UK, Cat# 10256302) diluted 1:100 with 1% w/v BSA in PBS for 1 h at 37°C. Samples were then counterstained with 4’,6-diamidino-2-phenylindole (DAPI; Sigma-Aldrich) to visualize the nuclei. The preparations were washed a final three times with 0.02% w/v BSA and 0.05% v/v IGEPAL solution, floated onto glass microscope slides and placed in Hydromount mounting medium (National Diagnostics, Hull, UK). Images were viewed using a Zeiss epifluorescence microscope and Zeiss software (Axiovision). To quantify transdifferentiation through α-SMA expression, captured fluorescence micrographs were analyzed following transformation into binary images by defined thresholding techniques using Adobe Photoshop to identify fluorescence. These images were then transferred to ImageJ, and the black area within the image was calculated.

Effect of aspirin on HDAC activity

HDAC activity was measured using a colorimetric assay kit (Biovision, Cat# K331). Briefly, the HDAC colorimetric substrate Ac-Lys(Ac)-pNA was incubated with either nuclear or cytoplasmic extracts of cells for 1 h. Treatment with the lysine developer produces a chromophore, which was measured by reading the absorbance in a microplate reader at 405 nm.

Proteomic characterization of histone adducts in aspirin-treated cells

Chromatin (5 µg) was separated on a 15% SDS-PAGE gel and stained with SimplyBlue SafeStain (Invitrogen, Carlsbad, CA). Histone H3 was excised corresponding to the molecular weight of the protein and digested as previously described [41]. Histone H3 was digested with trypsin, and peptides were extracted as previously described [41]. The peptide mixtures were loaded onto a capillary reverse-phase analytical column (360 μm o.d. x 100 μm i.d.) using an Eksigent NanoLC Ultra HPLC and auto sampler. The analytical column was packed with 20 cm of C18 reverse-phase material (Jupiter, 3 μm beads, 300 Å or Aqua C18, 3 μm beads, Phenomenex) directly into a laser-pulled emitter tip. Peptides were gradient eluted at a flow rate of 500 nl/min, and the mobile phases consisted of water containing 0.1% formic acid (solvent A) and acetonitrile containing 0.1% formic acid (solvent B). A 90-min gradient was performed, consisting of the following: 0−15 min, 2% B (during sample loading); 15−60 min, 2−40% B; 60−70 min, 40−90% B; 70–73 min, 90% B; 73–76 min, 90−2% B; and 76−90 min, 2% B (column re-equilibration). For select LC-MS/MS analyses, LC conditions were modified such that peptides were loaded at 0% B, and after sample loading, the peptide elution portion of the gradient consisted of 0–40% B from 15–60 min. Upon gradient elution, the peptides were mass analyzed on an LTQ Orbitrap Velos mass spectrometer (Thermo Scientific) equipped with a nanoelectrospray ionization source. The instrument was operated using a data-dependent method with dynamic exclusion enabled. Full-scan (m/z 300−2000) spectra were acquired with the Orbitrap (resolution 60,000), and the top 16 most abundant ions in each MS scan were selected for fragmentation in the LTQ. An isolation width of 2 m/z, activation time of 10 ms, and 35% normalized collision energy were used to generate the MS2 spectra. Dynamic exclusion settings allowed for a repeat count of 2 within a repeat duration of 10 s, and the exclusion duration time was set to 15 s. For identification of H3 peptides, tandem mass spectra were searched with Sequest (Thermo Fisher Scientific) against a human subset database created from the UniProtKB protein database (www.UniProt.org). Database searches were performed using the following variable modifications: +57.0214 (carbamidomethylation) on Cys; +15.9949 (oxidation) on Met; and +14.0157 (methylation), +28.0313 (dimethylation), and +42.0106 (acetylation) on Lys. The search results were assembled using Scaffold 3.0 (Proteome Software), and spectra of interest were inspected using Xcalibur 2.1 Qual Browser software (Thermo Scientific).

Chromatin immunoprecipitation (ChIP) assay

ChIP was carried out according to the manufacturer’s (Invitrogen) instructions. Briefly, 5 X 106 cells were crosslinked with 0.75% formaldehyde for 7 min and quenched with 1.25 M glycine for 5 min. Cells were washed and suspended in NP40 lysis buffer containing protease inhibitors and the HDAC inhibitor sodium butyrate and then subjected to sonication (Diagenode Bioruptor, Diagenode Inc., Denville, NJ) for 30 min to shear chromatin to between 150–500 bp. Chromatin was immunoprecipitated with 2 μg of antibody (against acetylated H3K56, acetylated H3K122, or rabbit IgG) bound to magnetic beads (Dynabeads™ Protein A, Cat# 10001D, Invitrogen/Dynal, Oslo, Norway) at 4°C. The antibody and histone complex along with the magnetic beads were washed with RIPA buffer, the crosslinking was reversed by protease treatment, and the DNA was purified. Quantitative PCR was carried out for the promoter regions of α-SMA (ACTA2) and collagen type I (COL1A1). The primer pairs are listed in Table 1. The relative levels of DNA amplification were normalized to an input sample. To verify whether the Smad2/3/4 complex is associated with acetyl-H3K56 or H3K122, cell lysates were treated with a microbead-conjugated antibody to acetyl-H3K56 or H3K122 overnight at 40C. The bound proteins were rinsed with RIPA buffer 3 times, mixed with 1X loading dye, boiled for 5 min and then subjected to western blotting for Smad4.

Effect of aspirin on the EMT of LECs in lensectomized mice

All animal experiments were performed in accordance with the ARVO statement for the Use of Animals in Ophthalmic and Vision Research and the University of Colorado IACUC guidelines. Lensectomy in mice was performed as previously described [42]. In the case of mice (strain 129/Sv, 12-week-old males) receiving aspirin, the animals were orally administered 1 mg/ml aspirin or 0.89 mg/ml sodium salicylic acid (SA, molar equivalent to aspirin) in 25 mM sodium phosphate-buffered (SPB, pH 7.4) drinking water for 5 days prior to the lensectomy and for 5 days after the procedure. The control group received 25 mM SPB alone. Mice consumed 3.5 to 4 ml of drinking water per day. To test whether aspirin reached the lens, one lens was homogenized, and the homogenate was subjected to western blotting and another lens was fixed, sectioned and immunostained for acetyllysine. Mice were anaesthetized with ketamine/xylazine solution and the eyes were prepped with betadine and 1% proparacaine hydrochloride. The pupils were dilated using 1% tropicamide and 1% ophthalmic phenylephrine eye drops (1:4 ratio). A horizontal incision was made in the cornea and the anterior capsule with an ophthalmic knife. The lens fiber mass was gently hydrodissected with Hank’s balanced salt solution (BSS) and squeezed out of the eye through the corneal opening, leaving behind the lens capsule. The lens capsule was flushed with BSS, which was followed by injection of sodium hyaluronate viscoelastic material (Alcon Labs; 0.1 ml) into the empty capsular bag to prevent collapse of the bag. The corneal incision was sutured using 10–0 nylon suture. Antibiotic ointment was applied immediately after surgery and once daily until visible wound healing occurred. Lensectomy was carried out on day 5, and the animals were sacrificed on day 10. The animals received aspirin or SA at the same concentration for 5 days after lensectomy. The eyes were fixed for 2 h in Davidson’s fixative solution and then changed to 4% paraformaldehyde overnight. The eyes were then paraffin embedded, sectioned and subjected to immunofluorescence detection of α-SMA (1:100 dilution) and collagen type IV (1:100 dilution, Sigma, Cat# 9272), as previously described [43].

Statistical analysis

GraphPad Prism software version 7 (GraphPad Prism Software, Inc., San Diego, CA) was used for all statistical analyses. The data are expressed as the mean ± standard deviation (SD) of at least three independent experiments. We used Tukey’s multiple comparison test for significant differences among treatment groups. A p value of < 0.05 was considered to be statistically significant.

RESULTS

Effect of aspirin on the cell viability, proliferation, and acetylation of cellular proteins

We first determined the highest aspirin concentration that could be used with minimal toxicity to lens epithelial cells. FHL124 cells were treated with increasing concentrations of aspirin (0–5 mM) for 48 h. The results showed that aspirin up to 2.5 mM for 48 h did not affect cell viability (Fig. 1A). We then determined whether aspirin inhibits cell proliferation. Cells were treated with aspirin (0–5 mM) for 24 h in the presence of 5% serum, followed by 10 ng/ml TGFβ2 treatment along with 0–5 mM aspirin for an additional 24 h. The results showed that aspirin up to 2.5 mM did not alter cell proliferation, even in the presence of TGFβ2 (Fig. 1B). We measured the concentration of aspirin in the cell culture medium (MEM) after 48 h of incubation to determine whether aspirin binds to serum albumin in the medium and reduces its effective concentration. Our results showed that after 48 h of incubation, there was no change in the aspirin concentration (Supplementary Fig. 1). Based on these results, 2 mM aspirin was used for all subsequent experiments. When tested at a 2 mM concentration, aspirin did not affect BrdU-incorporation into cells (Supplementary Fig. 2). We tested the reversibility of protein acetylation in cells treated with 2 mM aspirin alone for 24 h. Cells were treated with aspirin for 24 h, and the medium was then changed to remove the aspirin, after which the cells were incubated for an additional 24 h. The cells exposed to aspirin continuously for 48 h showed higher levels of acetylated proteins than that of the cells exposed to aspirin for 24 h (Fig. 1C). The removal of aspirin after 24 h led to a substantial reversal of protein acetylation. We treated cells with 2 mM aspirin for 24 h and then changed the medium and added TGFβ2 (10 ng/ml, with or without aspirin) and incubated for an additional 24 h. As shown in Fig. 1D, during the 24-h post incubation without aspirin, overall protein acetylation levels decreased, which were unaffected by the TGFβ2 treatment.

Figure 1. Effect of aspirin on the cell viability, proliferation, and acetylation of cellular proteins.

Figure 1.

Cell viability and proliferation were measured by the MTT assay. (A) FHL124 cells were treated with varying concentrations of aspirin for 48 h in serum-free media and then incubated with MTT reagent for 4 h. (B) Cells were treated with varying concentrations of aspirin for 24 h in 5% FBS-containing media, followed by TGFβ2 treatment at 10 ng/ml for an additional 24 h. The reversibility of acetylation was assessed by western blotting using acetyllysine antibody. (C) FHL124 cells were treated with 2 mM aspirin for 24 h or 48 h or treated with aspirin for 24 h and then incubated in serum-free medium for an additional 24 h. Lane 1, control; lane 2, aspirin-24 h; lane 3, aspirin-48 h; and lane 4, aspirin-24 h + serum-free medium for 24 h. (D) FHL124 cells were treated with 2 mM aspirin for 24 h and then incubated in 10 ng/ml TGFβ2 for an additional 24 h in the presence or absence of aspirin. Lane 1, control; lane 2, TGFβ2–24 h; lane 3, aspirin-48 h; and lane 4, aspirin-24 h + TGFβ2–24 h. The data represent the mean ± SD of three independent experiments. **p<0.01, ***p<0.001, ****p<0.0001 compared to control cells (without any treatment). M=molecular weight markers (kDa).

Effect of aspirin on TGFβ2-induced EMT

To determine the effect of aspirin on the TGFβ2-induced EMT of FHL124 cells, the cells were treated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment along with 2 mM aspirin for an additional 24 h. The treatment of TGFβ2 for 24 h increased the expression of α-SMA and FN (EMT makers in LECs) and αB-crystallin protein levels by 1.3-, 2.1- and 2.8-fold, respectively, compared to the control (no TGFβ2) (Fig. 2A). Treatment with aspirin significantly inhibited the TGFβ2-induced increases in α-SMA, FN and αB-crystallin. In cells that were treated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment along with aspirin (2 mM) for another 6 h, aspirin reduced the mRNA levels for α-SMA, FN and αB-crystallin that were induced by TGFβ2 (Fig. 2B), suggesting that the inhibition of EMT occurred at the transcriptional level. Immunofluorescence for α-SMA showed that aspirin suppressed TGFβ2-induced α-SMA expression (Fig. 2C).

Figure 2. Effect of aspirin on TGFβ2-induced EMT, stress fiber formation and cell migration in FHL124 cells.

Figure 2.

(A) Cells were treated with 2 mM aspirin for 24 h, followed by TGFβ2 treatment at 10 ng/ml for an additional 24 h. Total cell lysates were probed for α-SMA, fibronectin (FN) and αB-crystallin by western blotting to measure protein levels. (B) Cells were treated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment along with aspirin (2 mM) for another 6 h. qRT-PCR was performed to determine the mRNA levels of α-SMA, FN and αB-crystallin. (C) Cells were fixed and immunostained for α-SMA (counterstained with DAPI). (D) F-actin was visualized using Texas Red-conjugated phalloidin. (E) Scratch assay images were captured at 4X magnification after a 24-h incubation with TGFβ2 with or without aspirin. (F) The migrated area was quantified as the total distance that the cells moved from the edge of the scratch toward the center of the scratch. The values are normalized to control cells. The bars represent the mean ± SD of three independent experiments. ns= not significant, *p<0.05, **p<0.01. Scale bar, 50 μm.

We tested whether the inhibition of EMT was due to the acetyl group or salicylic acid in aspirin. Aspirin significantly reduced the TGFβ2-induced expression of α-SMA (p<0.05), but at equimolar concentrations, sodium salicylate (SA) failed to produce a similar response (Supplementary Fig. 3). These data indicated that the acetyl moiety is likely responsible for the inhibitory effect of aspirin.

To determine whether aspirin inhibits stress fiber formation (through filamentous cytoskeletal actin assembly) during EMT, cells were stained with Texas Red-X phalloidin (Fig. 2D). Treatment with TGFβ2 strongly promoted stress fiber formation (F-actin staining) within 24 h, but aspirin robustly inhibited stress fiber formation. Since the filamentous cytoskeleton network regulates cell migration, we tested the effect of aspirin on cell migration. Forty-eight hours after a scratch was created, cells in the serum-free medium alone migrated to close the scratch by 15.7%. However, cells treated with TGFβ2 migrated by 60.9% within 24 h (p<0.05). Aspirin significantly inhibited TGFβ2-mediated cell migration (p<0.05, compared to TGFβ2, Fig. 2E and F).

To further test whether aspirin blocks the EMT effect already initiated by TGFβ2, FHL124 cells were first treated with 10 ng/ml TGFβ2 for 24 h. Aspirin was then added along with TGFβ2, and the cells were incubated for an additional 24 h. TGFβ2 increased the expression of α-SMA, FN αB-crystallin and by 1.8-, 2.4- and 2.9-fold, respectively (Fig. 3). The addition of aspirin at 24 h significantly inhibited the increase in α-SMA (by 1.2-fold, p<0.01) and αB-crystallin (by 2.2-fold, p<0.05). The increase in FN was inhibited (1.8-fold) but not significantly.

Figure 3. Halting effect of aspirin on TGFβ2-induced EMT.

Figure 3.

FHL124 cells were treated with 10 ng/ml TGFβ2 for 24 h, and then 2 mM aspirin was added in the presence of TGFβ2 for an additional 24 h. Total cell lysates were subjected to western blotting to analyze the expression of α-SMA, FN and αB-crystallin. The values are normalized to control cells. The bars represent the mean ± SD of three independent experiments. ns= not significant, *p<0.05, **p<0.01.

Effect of aspirin in human capsular bag cultures

The addition of TGFβ2 induces profound changes within human lens capsular bags, which include increased levels of transdifferentiation and matrix contraction [44]. We first assessed the effects of 2 mM aspirin on basal cell behavior following simulated cataract surgery. In the control preparations maintained in serum-free Eagle’s minimum essential medium (EMEM), cells recolonized the anterior capsule and steadily covered the previously cell-free posterior capsule that lies within the visual axis (Fig. 4A). Treatment with aspirin did not have a profound effect on the anterior lens epithelium, but it significantly reduced the coverage of the central posterior capsule. Treatment with 10 ng/ml TGFβ2 promoted contraction of the posterior capsule, and coverage was possibly impaired; these findings are in agreement with previous reports [40, 45]. Cotreatment with TGFβ2 and aspirin resulted in significantly less cell coverage of the posterior lens capsule and matrix contraction. End-point evaluation of transdifferentiation using α-SMA immunocytochemistry demonstrated expression in cells growing on the central posterior capsule maintained in serum-free conditions. Treatment with 2 mM aspirin significantly suppressed this signal either alone or in combination with TGFβ2 (Fig. 4B).

Figure 4. Effect of aspirin in the human capsular bag.

Figure 4.

Four series of match-paired experiments were performed. The first two series employed serum-free (SF) EMEM as the standard medium (A and B) while the final pair of match-paired comparisons utilized 5% FCS supplemented EMEM as the standard medium (C and D). Match-paired experiments compared capsular bags maintained in standard medium (SF EMEM or 5% FCS EMEM) ± 2 mM aspirin or involved the addition of 10 ng/ml TGFβ2 to each culture maintained in standard medium (SF EMEM or 5% FCS EMEM) ± 2 mM aspirin. (A) Low power modified dark field micrographs showing the coverage of the central posterior capsule (PC) i.e. within the rhexis margin, observed at the end-point (day 19). Preparations were maintained in serum-free EMEM as the standard culture medium. Higher magnification images show cells on the central PC. Quantitative data showing the percent coverage of the central PC under different culture treatments are also provided along with the quantitative assessment of matrix contraction in TGFβ2-treated preparations. (B) Representative fluorescence images captured at the end-point (day 19) showing the expression and distribution patterns of the EMT marker, α-SMA in cells growing on the central PC with serum-free EMEM as the standard medium. Nuclei were visualized using DAPI as a counterstain. Quantitative data showing the relative levels of α-SMA under different culture treatments are also provided. (C) Low power modified dark field micrographs showing coverage of the central PC, i.e., within the rhexis margin, observed at the end-point (day 19). Preparations were maintained in 5% FCS EMEM as the standard culture medium. Higher magnification images show cells on the central posterior capsule. Quantitative data showing the percent coverage of the central PC under different culture treatments are also provided along with the quantitative assessment of matrix contraction in TGFβ2-treated preparations. (D) Representative fluorescence images captured at the end-point (day 19) showing the expression and distribution patterns of the EMT marker α-SMA in cells growing on the central PC with 5% FCS EMEM as the standard medium. Nuclei were visualized using DAPI as a counterstain. Quantitative data showing the relative levels of α-SMA under different culture treatments are also provided. The bars represent the mean ± SD of three independent experiments. ns= not significant, *p<0.05, **p<0.01, ***p<0.001, ****p<0.0001.

While these data strongly point to an ability of aspirin to counter events in PCO, we accept that changes to the ocular environment following surgery will occur, such that blood proteins will be present along with increased growth factors produced or activated within the eye. We therefore elected to undertake further tests to evaluate the effects of aspirin in medium supplemented with 5% FCS (with or without TGFβ2). Supplementing the medium with 5% serum (5% FCS EMEM) accelerated the changes in the capsular bag, such that in 5% FCS EMEM alone, cell coverage of the posterior capsule was complete within 7 days. Treatment with aspirin significantly impaired the rate of coverage. However, aspirin failed to prevent the cell coverage of PC when cells were treated with TGFβ2 in serum-containing media. The addition of 10 ng/ml TGFβ2 to 5% FCS EMEM-cultured capsular bags resulted in marked matrix contraction and reduced α-SMA expression (Fig. 4C and D). Treatment with 2 mM aspirin did not halt matrix contraction, but the degree was significantly inhibited (Fig. 4C). A significant reduction in α-SMA was also observed both in the presence or absence of TGFβ2. These data suggest that aspirin inhibits not only TGFβ2-dependent but also basal formation of myofibroblasts (Fig. 4D). Together, these data further support the observations that aspirin inhibits the TGFβ2-mediated EMT of LECs.

Effect of aspirin on TGFβ2-mediated signaling pathways

To determine whether aspirin blocks TGFβ2-mediated signaling in cells, we evaluated the canonical and noncanonical signaling pathways. Cells were treated with 2 mM aspirin for 24 h prior to treatment with TGFβ2 + aspirin for 0.5 or 2 h. While both Smad2 and Smad3 were phosphorylated by TGFβ2, aspirin did not change the phosphorylation levels upon TGFβ2 treatment for 0.5 h (Fig. 5A). Cells were fractionated into cytoplasmic and nuclear fractions and phosphorylated (p) Smad levels were measured. We found that the p-Smad2 levels were significantly increased in both in the nuclear (p<0.001) and cytoplasmic (p<0.05) fractions upon TGFβ2 treatment for 2 h, and these increases were unaffected by aspirin (Fig. 5B).

Figure 5. Effect of aspirin on the TGFβ2 signaling pathway.

Figure 5.

Western blot images show the effect of aspirin on canonical (A and B) and noncanonical (C) TGFβ2 signaling in FHL124 cells. FHL124 cells were incubated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment for an additional 0.5 (A and C) or 2 h (B). Total cell lysates were subjected to western blotting to analyze the phosphorylation levels of each signaling pathway. The bars represent the mean ± SD of three independent experiments. ns= not significant, *p<0.05, ***p<0.001.

During EMT, activation of noncanonical TGFβ signaling through MAP kinases and PI3K/AKT can also regulate gene expression [4648]. Several previous studies have shown that the inhibition of the noncanonical TGFβ pathway prevents the EMT response in LECs [39, 49]. Treatment with TGFβ2 for 0.5 h increased p-p38 MAPK or p-AKT (but not p-ERK) but aspirin had no effect on such phosphorylation (Fig. 5C). Together, these data suggest that aspirin does not block the canonical or noncanonical TGFβ2 signaling pathways during EMT in FHL124 cells. This led to the determination of whether the inhibition of EMT by aspirin occurred through the acetylation of histones.

Effect of aspirin on HDAC activity and acetylation of α-tubulin

Previous studies have shown that HDAC inhibitors block EMT [35, 50, 51]. To explore whether aspirin inhibits the enzyme activities of HDACs, we performed an assay that measured the activities of HDACs (class I and II) in the cytoplasmic and nuclear fractions. FHL124 cells were first treated with 2 mM aspirin for 24 h and then with 10 ng/ml TGFβ2 for 24 h along with aspirin. The HDAC activity was reduced by 56% upon treatment with 20 µM trichostatin A (TSA, positive control). However, HDAC activity was not affected by aspirin in either the nuclear or cytoplasmic fractions (Fig. 6A).

Figure 6. Effect of aspirin on HDAC activity (A) and the acetylation of α-tubulin (B).

Figure 6.

FHL124 cells were incubated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment for an additional 24 h. HDAC activity levels were determined in the nuclear and cytoplasmic fractions using a colorimetric assay kit. Protein levels of Ac-α-tubulin and β-actin were quantified by western blot analysis. The bars represent the mean ± SD of three independent experiments. ns= not significant, ***p<0.001.

HDAC6 regulates the acetylation of α-tubulin (Ac-α-tubulin). Its inhibition promotes the acetylation of α-tubulin and inhibits TGFβ-induced EMT [37]. To explore whether aspirin increases the acetylation of α-tubulin, FHL124 cells were treated with aspirin for 24 h and then treated with TGFβ2 (10 ng/ml) along with aspirin for an additional 24 h. We found that aspirin did not induce the acetylation of α-tubulin (Fig. 6B), thus precluding α-tubulin’s acetylation as a possible cause for the inhibition of EMT.

Effect of aspirin and TGFβ2 on the acetylation of proteins

Based on the above results, we postulated that aspirin’s EMT inhibitory property could be due to the acetylation of cellular proteins. Cells treated with TGFβ2 (10 ng/ml for 24 h) in the presence or absence of aspirin were subjected to western blotting for acetyllysine-bearing proteins. Supplementary Fig. 4A demonstrates that treatment with aspirin resulted in the acetylation of lysine residues in a concentration-dependent manner. However, cotreatment with TGFβ2 did not further alter these levels. We treated cells with 2 mM aspirin in the presence or absence of TGFβ2 (10 ng/ml) for 24 h and fractionated the cells into nuclear and cytoplasmic fractions, followed by western blotting for acetyllysine-bearing proteins. Aspirin acetylated both cytoplasmic and nuclear proteins (Supplementary Fig. 4B), but TGFβ2 had no effect on acetylation.

Effect of aspirin on histone acetylation

Posttranslational modification of histones regulates gene expression by altering the chromatin structure [52, 53]. Histone acetylation regulates many cellular processes, including chromatin dynamics and transcription, gene silencing, cell cycle progression, apoptosis, differentiation, DNA replication, DNA repair, nuclear import, and neuronal repression [54]. We observed that aspirin did not affect either TGFβ2 signaling or HDAC activity. This led us to hypothesize that aspirin acetylates histones, leading to alterations in EMT-related genes. To test this hypothesis, we analyzed histones from cells treated with aspirin via LC-MS/MS. The data shown in Table 2 reveal acetylation of K9, K14, K27, K79, and K115 of histone H3 in control cells. In TGFβ2-treated cells, we observed acetylation in all of the above lysine residues except for K115. Aspirin treatment (in the presence or absence of TGFβ2) showed acetylation of all the above lysine residues in addition to K56 and K122.

Table 2. Mass spectrometric identification of acetylation on histone H3 extracts.

FHL124 cells were treated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment for an additional 24 h. Total histones were fractionated by gel electrophoresis, and the level of acetylation on histone H3 was determined by LC-MS/MS.

Peptide index Sequence Acetylation Site Modifications identified by spectrum
9 to 17 KSTGGKAPR K9 Acetyl (+42), Delta:H(4)C(2) (+28)
27 to 36 KSTGGKAPR K14 Oxidation (+16), Carbamidomethyl (+57), Acetyl (+42)
27 to 40 KSAPATGGVK K27 Acetyl (+42), Delta:H(4)C(2) (+28)
54 to 63 YQKSTELLIR K56 Acetyl (+42)
73 to 83 EIAQDFKTDLR K79 Acetyl (+42)
84 to 115 FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK K115 Oxidation (+16), Carbamidomethyl (+57), Acetyl (+42)
117 to 128 VTIMPKDIQLAR K122 Oxidation (+16), Acetyl (+42)
K9 K14 K27 K56 K79 K115 K122
Control
Aspirin
TGFβ2
Aspirin + TGFβ2

To further confirm the mass spectrometric results, we performed western blotting. Cells were treated with aspirin (2 mM) for 24 h and then with aspirin (2 mM) with or without TGFβ2 (10 ng/ml) for an additional 6 h, and histones were extracted. While the levels of histones were unaltered by either aspirin or aspirin + TGFβ2 treatment (Fig. 7A, left panel), the western blotting results showed that histones H3/H2A were predominantly acetylated by aspirin, but TGFβ2 did not have an effect on its acetylation (Fig. 7A, right panel). We next sought to evaluate the site-specific acetylation marks on histone H3. The western blotting results showed that treatment with TGFβ2 alone does not affect the acetylation levels of any of the lysine residues tested. However, treatment with aspirin strongly increased the acetylation of K56 and K122 (in the presence or absence of TGFβ2), but not other lysine residues (Fig. 7B). These data suggest that aspirin acetylates discrete lysine residues on histone H3, which may play an underlying role in the inhibition of EMT in FHL124 cells.

Figure 7. Effect of aspirin on histone acetylation.

Figure 7.

Cells were treated with aspirin (2 mM) for 24 h and then with aspirin (2 mM) with or without TGFβ2 (10 ng/ml) for an additional 6 h, and histones were extracted. (A) Total histones were fractionated by gel electrophoresis and stained with Coomassie blue (left), and the level of acetylation was determined by western blot analysis with anti-acetyllysine (right). (B) Acetylated histone H3 lysine residues were determined by western blot analysis. Bars represent the mean ± SD of three independent experiments. ns= not significant, *p<0.05, **p<0.01. M= molecular weight markers (kDa).

Aspirin-mediated acetylation of H3K56 and H3K122 at the promoter region of EMT-associated genes

To determine whether aspirin-mediated acetylation of K56 and K122 is associated with EMT gene regulation, we performed ChIP assays. The ChIP assay results showed that there were significantly elevated levels of acetylation of H3K56 and H3K122 at the promoter regions of ACTA2 and COL1A in TGFβ2-treated cells compared to controls (Fig. 8A and B). Interestingly, even though aspirin globally enhanced acetylation at H3K56 and H3K122, it significantly (p<0.001) reduced the TGFβ2-mediated enhancement of acetylation at the promoter regions of ACTA2 and COL1A1. This decreased acetylation is consistent with the decreased EMT gene expression we observed in aspirin-treated cells (Fig. 2B). In control experiments in which naive rabbit IgG was used, there was very low amplification for ACTA2 and no amplification for COL1A1. These results led us to hypothesize that aspirin reduces the binding of transcription factors such as Smads to the promoter region of EMT-related genes and consequently inhibits EMT of LECs.

Figure 8. Aspirin-induced histone acetylation regulates EMT-related gene transcription.

Figure 8.

FHL124 cells were incubated with 2 mM aspirin for 24 h, followed by 10 ng/ml TGFβ2 treatment for an additional 2 h in the presence of aspirin. ChIP assays were performed using specific antibodies against acH3K56 and acH3K122 or with normal rabbit IgG. Quantitative PCR was performed using specific primers for the promoter regions of ACTA2 (A) and COL1A1 (B). In control experiments in which naive rabbit IgG was used, there was very low amplification for ACTA2 and no amplification for COL1A1 (right panels in A and B). The relative DNA levels were normalized to the input chromatin. (C-D) After immunoprecipitation, total cell lysates were subjected to western blotting for Smad4. The bars represent the mean ± SD of three independent experiments. ns= not significant, *p<0.05, **p<0.01.

Coimmunoprecipitations were performed to confirm that the Smad2/3/4 complex is associated with acetylated H3K56 and H3K122. Co-IPs indicated that the Smad complex could be pulled down by antibodies against either acH3K56 or acH3K122 (Fig. 8C). In both acH3K56 and acH3K122 immunoprecipitated samples, Smad4 levels were significantly (p<0.01) higher in the TGFβ2-treated cells compared to those in untreated or aspirin-treated control cells. The Smad4 levels were significantly (p<0.01) reduced in samples immunoprecipitated with anti-acH3K122 antibody in TGFβ2 + aspirin-treated cells. Such an inhibition was not observed in samples immunoprecipitated with anti-acH3K56 antibody, although the trend was similar to that of acH3K122 (Fig. 8D). These results suggested that aspirin inhibits TGFβ2-mediated EMT of LECs by blocking Smad4 binding to the promoter region of EMT genes.

Effect of aspirin on the EMT of LECs in lensectomized mice

We evaluated the effect of aspirin on the EMT of capsule-adherent LECs in lensectomized mice. Oral administration of aspirin to mice increased the acetylation of proteins of the lens and LECs (Fig. 9A and B). Mice were pretreated with aspirin for 5 days, followed by lensectomy. After 5 days, mice were sacrificed, and the eyes were fixed and immunostained for α-SMA and collagen IV (a marker of the lens capsule). The immunohistochemical images indicated that LECs in lensectomized mice proliferated and expressed α-SMA, whereas aspirin treatment prevented both α-SMA expression and cell proliferation (Fig. 9C). We next determined whether the observed effects were due to salicylate, a product of aspirin. Both buffer (control) and SA-treated mouse LECs had higher α-SMA levels and LEC proliferation compared to aspirin-treated controls. These data indicated that aspirin treatment strongly inhibits the EMT response in LECs after lensectomy through the acetylation of proteins

Figure 9. Effect of aspirin on EMT in lensectomized mice.

Figure 9.

Mice were administered either 0.5 mg/ml (n=3) or 1 mg/ml (n=4) of aspirin in drinking water for 5 days. Control mice were treated with 25 mM sodium phosphate buffer in drinking water. (n=3). (A) The level of acetylation in lens proteins was determined by western blot analysis with acetyllysine antibody. (B) Control and 1 mg/ml aspirin-treated mouse lenses were immunostained with acetyllysine antibody. The insert was enlarged and is shown in the right panel. The arrowhead denotes the mouse LECs. (C) The expression of α-SMA (red) on postoperative day 5. Mice were treated with aspirin or sodium salicylic acid (SA) for 5 days prior to the lensectomy and for 5 days thereafter. Collagen type IV (green) was used for the lens capsule marker. Nuclei were stained with DAPI (blue). The dashed line traces the lens capsule. The arrowhead denotes the anterior capsule, and the arrows denote the posterior capsule. N=3. Scale bar= 50 μm.

DISCUSSION

In this study, we evaluated whether aspirin can block the TGFβ2-mediated EMT response in LECs. This was based on the ability of HDAC inhibitors to prevent histone deacetylation and blockade of TGFβ2-mediated EMT of LECs [35, 51]. The major finding of our study is that aspirin inhibits TGFβ2-mediated EMT of LECs in vitro, ex vivo, and in lensectomized mice, possibly through acetylation of histone H3 K56 and K122.

We found that treatment with aspirin resulted in the acetylation of a number of cellular proteins in LECs. Interestingly, as we increased the aspirin concentration from 0 to 2 mM for cell treatment, the extent of acetylation increased in the same proteins but not in new proteins. This suggests that aspirin targets specific proteins in cells that are incrementally acetylated with increasing concentrations of aspirin. Similar observations have been made in other cells [55, 56]. Why aspirin-mediated acetylation is specific to some proteins requires further investigation.

A previous study reported that the aberrant induction of cyclooxygenase-2 (COX-2) plays a role in TGFβ/Smad3-mediated EMT in human breast cancer cells [57]. It has also been reported that the upregulation of COX-2 and PI3K/AKT phosphorylation promotes EMT in hepatocellular carcinoma cells [58]. Based on these reports, we considered the possibility that aspirin inactivated COX-2 in LECs, resulting in the inhibition of TGFβ2-mediated EMT. A previous study has shown that COX-2 is present in canine lens epithelial cells and that treatment with COX-2 inhibitors can block LEC proliferation [59], and another study showed decreased PCO in dogs upon treatment with COX-2 inhibitors, which was ascribed to induction of apoptosis in LECs [60]. Thus, it was possible that aspirin inhibited EMT in LECs through inhibition of cell migration and blockade of COX-2. However, it is unlikely under these conditions because aspirin at 2 mM (used in most experiments) did not inhibit proliferation or reduce the viability of LECs. Nonetheless, we cannot rule out COX-2-mediated effects of aspirin on the observed inhibition of lens epithelial cell proliferation in lensectomized mice. Whether aspirin affects other signaling mechanisms related to cell proliferation and fiber cell differentiation needs to be investigated in future studies.

The fact that SA was unable to exhibit similar effects as aspirin clearly implicates acetylation by aspirin as the cause for EMT inhibition. The aspirin concentration we used to obtain the inhibitory effect was 2 mM. At concentrations below 2 mM, aspirin failed to show inhibitory effects. The fact that aspirin acetylates the same proteins but to a higher extent when used in increasing concentrations suggests that there could be an acetylation threshold for the inhibition of EMT. What is striking is that aspirin’s uninterrupted presence is required for protein acetylation. When removed for 24 h, the majority of acetylated proteins lost their acetylation, suggesting the presence of robust deacetylation mechanisms in FHL124 cells. In fact, we have previously observed that FHL124 cells contain SIRT3 and SIRT5, which could deacetylate proteins [61]. Surprisingly, when aspirin was removed from cells during TGFβ2 treatment, there was no further increase in α-SMA expression, suggesting that the EMT inhibitory response persisted after the removal of aspirin for at least 24 h.

One possibility for the inhibition of TGFβ2-mediated EMT by aspirin could be that aspirin reacted directly with TGFβ2 and inactivated it. Aspirin spontaneously acetylates proteins upon incubation with proteins [55]. Therefore, it was reasonable to assume that TGFβ2 was acetylated by aspirin in the culture medium. However, we found that at the concentration of aspirin (2 mM) and TGFβ2 (10 ng/ml) used, the TGFβ2-mediated signal transduction was similar in the presence or absence of aspirin. Thus, the observed inhibitory effects of aspirin were not due to a direct reaction of aspirin with TGFβ2. We also considered the possibility that inhibition of EMT by aspirin could be due to acetylation of Smads. However, several previous studies have shown that acetylation of Smads promotes their nuclear translocation and transcriptional activity [6264]. These observations suggest that the acetylation of Smads may not have contributed to the inhibition of TGFβ2-mediated EMT by aspirin. The downregulation of αB-crystallin by aspirin could have also contributed to the inhibition of EMT, as we have previously shown that αB-crystallin binds to Smads and Snail and translocates to the nucleus during the TGFβ2-mediated EMT of LECs [42]. Such binding could have stabilized the transcription factors and allowed them to bind to DNA and promote EMT.

Several studies have shown that HDAC-mediated epigenetic mechanisms are involved in the EMT response in renal epithelial cells [50] and hepatocytes [65]. In particular, trichostatin A (TSA), a class I and II HDAC inhibitor, inhibited the TGFβ2-induced EMT of LECs [34, 35, 51]. However, the epigenetic mechanism by which HDAC inhibitors block the TGFβ2-mediated EMT of LECs is unclear. We reasoned that aspirin could inactivate HDACs and thereby inhibit TGFβ2-mediated EMT of LECs, similar to HDAC inhibitors. However, we found that aspirin did not inactivate HDACs in LECs. Further, previous studies have shown that TGFβ1-induced EMT is regulated by HDAC6-dependent deacetylation of α-tubulin in immortalized mammary epithelial cells [37] and human lung adenocarcinoma cells [36]. However, TGFβ2 did not deacetylate α-tubulin, and aspirin did not increase the acetylation of tubulin in LECs. Together, these observations ruled out a role for HDACs in aspirin’s inhibition of EMT of LECs.

One major finding in our study is that aspirin increased the acetylation of K56 and K122 on histone H3 in the presence or absence of TGFβ2. Past studies on histone modification have focused mainly on the acetylation of histone tails. However, we found aspirin-mediated acetylation at K56 and K122, which are in the globular domain of H3. The modification of histones can affect two of their properties: the DNA binding affinity and the recruitment of nonhistone proteins [66, 67]. The lateral side of histones regulates transcriptional activity [68]. Interestingly, aspirin-mediated acetylated K56 and K122 are on the lateral surface of histone H3. This modification of histones is important for RNA transcription, but the exact mechanisms are unclear. A study showed that acetylation of the lateral surface of histone H3 reduces the free energy of histone octamer binding and directly influences the positioning of nucleosomes, which increases DNA unwrapping from the octamer [69]. Further, acetylation of K56 on histone H3 has been found to play important roles in transcriptional activation; deacetylation of K56 drives chromatin toward the assembled state and represses transcription [70]. In addition, acetylation of K122 activates transcription, and the lack of it significantly impairs gene induction [71]. These observations point to the possibility that aspirin promotes acetylation at K56 and K122 globally, but at the EMT loci, it inhibits acetylation of the two lysine residues, thereby inhibiting the binding of transcription factors and repressing EMT genes. The reduced mRNA levels for α-SMA, αB-crystallin and FN in TGFβ2- and aspirin-treated cells when compared to levels with treatment with TGFβ2 alone support this view. A previous study showed that TSA suppresses the TGFβ1-mediated EMT of human kidney tubular epithelial cells by acetylation of histone H3 and H4 without exerting effects on the phosphorylation of Smad2 and Smad3 [50]. This is somewhat similar to our finding in this study that aspirin did not alter the TGFβ2-mediated phosphorylation of Smad2 and Smad3 but decreased acetylated histone H3 levels during inhibition of EMT of LECs. Further, aspirin could modulate the levels/activities of Smad transcriptional corepressors, such as TG-interacting factor (TGIF), Sloan-Kettering Institute (Ski), Ski-related novel gene (SnoN), or antagonists of TGFβ signaling, such as bone morphologic protein (BMP)-7, Smad6 or Smad7, during the inhibition of EMT, which needs to be investigated.

Further evidence for the ability of aspirin to inhibit TGFβ2-mediated EMT came from our work on human lens capsular bags. Treatment with aspirin at a 2 mM concentration inhibited capsule wrinkling and α-SMA expression during the 28-day period of incubation, suggesting that chronic exposure to aspirin can block changes in the capsule that are integral to PCO. Our mouse experiments further validated the human capsule results. Initially, we administered 1 mg (10 mg/ml, 100 μl) of aspirin through oral gavage once a day for 5 days and found that it had no effect on the acetylation of lens proteins (Supplementary Fig. 5). We then administered aspirin through drinking water and found that acetylation was occurring on lens proteins both in LECs and lens fiber cells. These results further reiterated the notion that chronic exposure to aspirin is required to acetylate lens proteins and inhibit EMT of LECs.

Lensectomy in mice has been used as a model for human PCO [72]. Epithelial cells on the capsule synthesize α-SMA in response to the wound created during lensectomy [42]. Although an IOL cannot be implanted in the mouse lens capsule bag, the capsular bag was filled with a viscoelastic material that prevented, to some extent, the collapse of the anterior and posterior capsules. Aspirin administration for 5 days prior to lensectomy and for 5 days post lensectomy inhibited α-SMA production in the LECs, a clear indication that aspirin can block EMT in lensectomized mice.

Taken together, these results suggest that aspirin may block the EMT of LECs during PCO in humans. However, the concentration needed to realize the effect, at least in cell culture and mouse experiments, was 2 mM and 1 mg/ml in drinking water daily, respectively. Whether one can achieve such concentrations in the lens after cataract surgery remains to be determined. Many patients with cardiovascular complications or individuals intending to prophylactically prevent cardiovascular diseases take aspirin at 75 to 100 mg/day quantities [73]. It has been shown that 40 min after ingesting 100 mg of aspirin, the plasma concentration was 2.2 ± 1.6 μg/ml, and with 1500 mg, it was 21.1± 8.9 μg/ml [74]. What portion of the ingested aspirin makes its way to the lens in humans is unclear. If sufficient aspirin reaches the LECs after cataract surgery, it could inhibit PCO development. It will be interesting to determine in a retrospective study whether the incidence of PCO or the need for YAG laser treatment is lower in chronic users of aspirin compared to those of nonusers and whether the effects, if any, correlate with the dosage of aspirin.

Supplementary Material

Sup.mat

Acknowledgments

We thank Drs. Johanna Rankenberg, Rooban Nahomi, Sandip Nandi and Niklaus Mueller for critical reading of the manuscript.

Funding information

This work was supported by the National Institutes of Health Grants EY022061 and EY028836 and a challenge grant by Research to Prevent Blindness, NY to the Department of Ophthalmology, University of Colorado School of Medicine, and The University of Colorado School of Medicine Translational Award: Consortium for Fibrosis Research and Translation (CFReT) postdoctoral fellowship award.

Abbreviations:

LECs

lens epithelial cells

EMT

epithelial to mesenchymal transition

PCO

posterior capsule opacification

TGFβ

transforming growth factor-beta

α-SMA

α-smooth muscle actin

FN

fibronectin

HDAC

histone deacetylase

ChIP

chromatin immunoprecipitation

Footnotes

Declarations of interest

The authors declare no conflict of interest.

References

  • 1.Wormstone IM, Wang L and Liu CS (2009) Posterior capsule opacification. Exp Eye Res 88, 257–269 [DOI] [PubMed] [Google Scholar]
  • 2.Awasthi N, Guo S and Wagner BJ (2009) Posterior capsular opacification: a problem reduced but not yet eradicated. Arch Ophthalmol 127, 555–562 [DOI] [PubMed] [Google Scholar]
  • 3.Spierer A, Desatnik H and Blumenthal M (1999) Refractive status in children after long-term follow up of cataract surgery with intraocular lens implantation. J Pediatr Ophthalmol Strabismus 36, 25–29 [DOI] [PubMed] [Google Scholar]
  • 4.Karahan E, Er D and Kaynak S (2014) An Overview of Nd:YAG Laser Capsulotomy. Med Hypothesis Discov Innov Ophthalmol 3, 45–50 [PMC free article] [PubMed] [Google Scholar]
  • 5.Burq MA and Taqui AM (2008) Frequency of retinal detachment and other complications after neodymium:Yag laser capsulotomy. J Pak Med Assoc 58, 550–552 [PubMed] [Google Scholar]
  • 6.Koch DD, Liu JF, Gill EP and Parke DW (1989) Axial Myopia Increases the Risk of Retinal Complications after Neodymium-Yag Laser Posterior Capsulotomy. Arch Ophthalmol-Chic 107, 986–990 [DOI] [PubMed] [Google Scholar]
  • 7.Dardenne MU, Gerten GJ, Kokkas K and Kermani O (1989) Retrospective Study of Retinal-Detachment Following Neodymium - Yag Laser Posterior Capsulotomy. J Cataract Refr Surg 15, 676–680 [DOI] [PubMed] [Google Scholar]
  • 8.Lamouille S, Xu J and Derynck R (2014) Molecular mechanisms of epithelial-mesenchymal transition. Nat Rev Mol Cell Biol 15, 178–196 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Gonzalez DM and Medici D (2014) Signaling mechanisms of the epithelial-mesenchymal transition. Sci Signal 7, re8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Eldred JA, Dawes LJ and Wormstone IM (2011) The lens as a model for fibrotic disease. Philos Trans R Soc Lond B Biol Sci 366, 1301–1319 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Vane JR and Botting RM (2003) The mechanism of action of aspirin. Thromb Res 110, 255–258 [DOI] [PubMed] [Google Scholar]
  • 12.Mekaj YH, Daci FT and Mekaj AY (2015) New insights into the mechanisms of action of aspirin and its use in the prevention and treatment of arterial and venous thromboembolism. Ther Clin Risk Manag 11, 1449–1456 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Roth GJ and Majerus PW (1975) The mechanism of the effect of aspirin on human platelets. I. Acetylation of a particulate fraction protein. J Clin Invest 56, 624–632 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Jung SB, Kim CS, Naqvi A, Yamamori T, Mattagajasingh I, Hoffman TA, Cole MP, Kumar A, Dericco JS, Jeon BH and Irani K (2010) Histone deacetylase 3 antagonizes aspirin-stimulated endothelial nitric oxide production by reversing aspirin-induced lysine acetylation of endothelial nitric oxide synthase. Circ Res 107, 877–887 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Macdonald JM, Haas AL and London RE (2000) Novel mechanism of surface catalysis of protein adduct formation. NMR studies of the acetylation of ubiquitin. J Biol Chem 275, 31908–31913 [DOI] [PubMed] [Google Scholar]
  • 16.Liyasova MS, Schopfer LM and Lockridge O (2010) Reaction of human albumin with aspirin in vitro: mass spectrometric identification of acetylated lysines 199, 402, 519, and 545. Biochem Pharmacol 79, 784–791 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Alfonso LF, Srivenugopal KS and Bhat GJ (2009) Does aspirin acetylate multiple cellular proteins? (Review). Mol Med Rep 2, 533–537 [DOI] [PubMed] [Google Scholar]
  • 18.Tatham MH, Cole C, Scullion P, Wilkie R, Westwood NJ, Stark LA and Hay RT (2017) A Proteomic Approach to Analyze the Aspirin-mediated Lysine Acetylome. Mol Cell Proteomics 16, 310–326 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Guo Y, Liu Y, Zhang C, Su ZY, Li W, Huang MT and Kong AN (2016) The epigenetic effects of aspirin: the modification of histone H3 lysine 27 acetylation in the prevention of colon carcinogenesis in azoxymethane- and dextran sulfate sodium-treated CF-1 mice. Carcinogenesis 37, 616–624 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Chen Z, Li W, Qiu F, Huang Q, Jiang Z, Ye J, Cheng P, Low C, Guo Y, Yi X, Chen W, Yu Y, Han Y, Wu J, Jin S, Kong D and Huang J (2018) Aspirin cooperates with p300 to activate the acetylation of H3K9 and promote FasL-mediated apoptosis of cancer stem-like cells in colorectal cancer. Theranostics 8, 4447–4461 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Sonnemann J, Huls I, Sigler M, Palani CD, Hong le TT, Volker U, Kroemer HK and Beck JF (2008) Histone deacetylase inhibitors and aspirin interact synergistically to induce cell death in ovarian cancer cells. Oncol Rep 20, 219–224 [PubMed] [Google Scholar]
  • 22.Son DS, Wilson AJ, Parl AK and Khabele D (2010) The effects of the histone deacetylase inhibitor romidepsin (FK228) are enhanced by aspirin (ASA) in COX-1 positive ovarian cancer cells through augmentation of p21. Cancer Biol Ther 9, 928–935 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Liew G, Mitchell P, Wong TY, Rochtchina E and Wang JJ (2013) The association of aspirin use with age-related macular degeneration. JAMA Intern Med 173, 258–264 [DOI] [PubMed] [Google Scholar]
  • 24.Christen WG, Glynn RJ, Ajani UA, Schaumberg DA, Chew EY, Buring JE, Manson JE and Hennekens CH (2001) Age-related maculopathy in a randomized trial of low-dose aspirin among US physicians. Arch Ophthalmol 119, 1143–1149 [DOI] [PubMed] [Google Scholar]
  • 25.(1991) Effects of aspirin treatment on diabetic retinopathy. ETDRS report number 8. Early Treatment Diabetic Retinopathy Study Research Group. Ophthalmology 98, 757–765 [PubMed] [Google Scholar]
  • 26.De Castro DK, Punjabi OS, Bostrom AG, Stamper RL, Lietman TM, Ray K and Lin SC (2007) Effect of statin drugs and aspirin on progression in open-angle glaucoma suspects using confocal scanning laser ophthalmoscopy. Clin Exp Ophthalmol 35, 506–513 [DOI] [PubMed] [Google Scholar]
  • 27.Shastri GV, Thomas M, Victoria AJ, Selvakumar R, Kanagasabapathy AS, Thomas K and Lakshmi. (1998) Effect of aspirin and sodium salicylate on cataract development in diabetic rats. Indian J Exp Biol 36, 651–657 [PubMed] [Google Scholar]
  • 28.Shi Q, Yan H, Li MY and Harding JJ (2009) Effect of a combination of carnosine and aspirin eye drops on streptozotocin -- induced diabetic cataract in rats. Mol Vis 15, 2129–2138 [PMC free article] [PubMed] [Google Scholar]
  • 29.Seddon JM, Christen WG, Manson JE, Buring JE, Sperduto RD and Hennekens CH (1991) Low-dose aspirin and risks of cataract in a randomized trial of US physicians. Arch Ophthalmol 109, 252–255 [DOI] [PubMed] [Google Scholar]
  • 30.Harding JJ, Egerton M and Harding RS (1989) Protection against cataract by aspirin, paracetamol and ibuprofen. Acta Ophthalmol (Copenh) 67, 518–524 [DOI] [PubMed] [Google Scholar]
  • 31.Christen WG, Ajani UA, Schaumberg DA, Glynn RJ, Manson JE and Hennekens CH (2001) Aspirin use and risk of cataract in posttrial follow-up of Physicians’ Health Study I. Arch Ophthalmol 119, 405–412 [DOI] [PubMed] [Google Scholar]
  • 32.Bernstein BE, Meissner A and Lander ES (2007) The mammalian epigenome. Cell 128, 669–681 [DOI] [PubMed] [Google Scholar]
  • 33.Ganatra DA, Rajkumar S, Patel AR, Gajjar DU, Johar K, Arora AI, Kayastha FB and Vasavada AR (2015) Association of histone acetylation at the ACTA2 promoter region with epithelial mesenchymal transition of lens epithelial cells. Eye (Lond) 29, 828–838 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Chen X, Xiao W, Chen W, Luo L, Ye S and Liu Y (2013) The epigenetic modifier trichostatin A, a histone deacetylase inhibitor, suppresses proliferation and epithelial-mesenchymal transition of lens epithelial cells. Cell Death Dis 4, e884. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Xie L, Santhoshkumar P, Reneker LW and Sharma KK (2014) Histone deacetylase inhibitors trichostatin A and vorinostat inhibit TGFbeta2-induced lens epithelial-to-mesenchymal cell transition. Invest Ophthalmol Vis Sci 55, 4731–4740 [DOI] [PubMed] [Google Scholar]
  • 36.Shan B, Yao TP, Nguyen HT, Zhuo Y, Levy DR, Klingsberg RC, Tao H, Palmer ML, Holder KN and Lasky JA (2008) Requirement of HDAC6 for transforming growth factor-beta1-induced epithelial-mesenchymal transition. J Biol Chem 283, 21065–21073 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Gu S, Liu Y, Zhu B, Ding K, Yao TP, Chen F, Zhan L, Xu P, Ehrlich M, Liang T, Lin X and Feng XH (2016) Loss of alpha-Tubulin Acetylation Is Associated with TGF-beta-induced Epithelial-Mesenchymal Transition. J Biol Chem 291, 5396–5405 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Raghavan CT and Nagaraj RH (2016) AGE-RAGE interaction in the TGFbeta2-mediated epithelial to mesenchymal transition of human lens epithelial cells. Glycoconj J 33, 631–643 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Nam MH and Nagaraj RH (2018) Matrix-bound AGEs enhance TGFbeta2-mediated mesenchymal transition of lens epithelial cells via the noncanonical pathway: implications for secondary cataract formation. Biochem J 475, 1427–1440 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Liu CS, Wormstone IM, Duncan G, Marcantonio JM, Webb SF and Davies PD (1996) A study of human lens cell growth in vitro. A model for posterior capsule opacification. Invest Ophthalmol Vis Sci 37, 906–914 [PubMed] [Google Scholar]
  • 41.Galligan JJ, Rose KL, Beavers WN, Hill S, Tallman KA, Tansey WP and Marnett LJ (2014) Stable Histone Adduction by 4-Oxo-2-nonenal: A Potential Link between Oxidative Stress and Epigenetics. J Am Chem Soc [DOI] [PMC free article] [PubMed]
  • 42.Nahomi RB, Pantcheva MB and Nagaraj RH (2016) alphaB-crystallin is essential for the TGF-beta2-mediated epithelial to mesenchymal transition of lens epithelial cells. Biochem J 473, 1455–1469 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Zukin LM, Pedler MG, Groman-Lupa S, Pantcheva M, Ammar DA and Petrash JM (2018) Aldose Reductase Inhibition Prevents Development of Posterior Capsular Opacification in an In Vivo Model of Cataract Surgery. Invest Ophthalmol Vis Sci 59, 3591–3598 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Wormstone IM, Tamiya S, Anderson I and Duncan G (2002) TGF-beta2-induced matrix modification and cell transdifferentiation in the human lens capsular bag. Invest Ophthalmol Vis Sci 43, 2301–2308 [PubMed] [Google Scholar]
  • 45.Cleary G, Spalton DJ, Zhang JJ and Marshall J (2010) In vitro lens capsule model for investigation of posterior capsule opacification. J Cataract Refract Surg 36, 1249–1252 [DOI] [PubMed] [Google Scholar]
  • 46.Bakin AV, Rinehart C, Tomlinson AK and Arteaga CL (2002) p38 mitogen-activated protein kinase is required for TGF beta-mediated fibroblastic transdifferentiation and cell migration. Journal of Cell Science 115, 3193–3206 [DOI] [PubMed] [Google Scholar]
  • 47.Bakin AV, Tomlinson AK, Bhowmick NA, Moses HL and Arteaga CL (2000) Phosphatidylinositol 3-kinase function is required for transforming growth factor beta-mediated epithelial to mesenchymal transition and cell migration. J Biol Chem 275, 36803–36810 [DOI] [PubMed] [Google Scholar]
  • 48.Wendt MK, Allington TM and Schiemann WP (2009) Mechanisms of the epithelial-mesenchymal transition by TGF-beta. Future Oncol 5, 1145–1168 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Chen X, Ye S, Xiao W, Wang W, Luo L and Liu Y (2014) ERK1/2 pathway mediates epithelial-mesenchymal transition by cross-interacting with TGFbeta/Smad and Jagged/Notch signaling pathways in lens epithelial cells. Int J Mol Med 33, 1664–1670 [DOI] [PubMed] [Google Scholar]
  • 50.Yoshikawa M, Hishikawa K, Marumo T and Fujita T (2007) Inhibition of histone deacetylase activity suppresses epithelial-to-mesenchymal transition induced by TGF-beta1 in human renal epithelial cells. J Am Soc Nephrol 18, 58–65 [DOI] [PubMed] [Google Scholar]
  • 51.Ganatra DA, Vasavada AR, Vidya NG, Gajjar DU and Rajkumar S (2018) Trichostatin A Restores Expression of Adherens and Tight Junction Proteins during Transforming Growth Factor beta-Mediated Epithelial-to-Mesenchymal Transition. J Ophthalmic Vis Res 13, 274–283 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Cosgrove MS (2007) Histone proteomics and the epigenetic regulation of nucleosome mobility. Expert Rev Proteomics 4, 465–478 [DOI] [PubMed] [Google Scholar]
  • 53.Li W, Nagaraja S, Delcuve GP, Hendzel MJ and Davie JR (1993) Effects of histone acetylation, ubiquitination and variants on nucleosome stability. Biochem J 296 (Pt 3), 737–744 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Zeng XQ, Wang J and Chen SY (2017) Methylation modification in gastric cancer and approaches to targeted epigenetic therapy (Review). Int J Oncol 50, 1921–1933 [DOI] [PubMed] [Google Scholar]
  • 55.Alfonso LF, Srivenugopal KS and Bhat GJ (2009) Does aspirin acetylate multiple cellular proteins? (Review). Molecular Medicine Reports 2, 533–537 [DOI] [PubMed] [Google Scholar]
  • 56.Marimuthu S, Chivukula RS, Alfonso LF, Moridani M, Hagen FK and Bhat GJ (2011) Aspirin acetylates multiple cellular proteins in HCT-116 colon cancer cells: Identification of novel targets. Int J Oncol 39, 1273–1283 [DOI] [PubMed] [Google Scholar]
  • 57.Tian J, Hachim MY, Hachim IY, Dai M, Lo C, Raffa FA, Ali S and Lebrun JJ (2017) Cyclooxygenase-2 regulates TGFbeta-induced cancer stemness in triple-negative breast cancer. Sci Rep 7, 40258. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Ogunwobi OO and Liu C (2011) Hepatocyte growth factor upregulation promotes carcinogenesis and epithelial-mesenchymal transition in hepatocellular carcinoma via Akt and COX-2 pathways. Clin Exp Metastasis 28, 721–731 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Chandler HL, Barden CA, Lu P, Kusewitt DF and Colitz CM (2007) Prevention of posterior capsular opacification through cyclooxygenase-2 inhibition. Mol Vis 13, 677–691 [PMC free article] [PubMed] [Google Scholar]
  • 60.Brookshire HL, English RV, Nadelstein B, Weigt AK, Gift BW and Gilger BC (2015) Efficacy of COX-2 inhibitors in controlling inflammation and capsular opacification after phacoemulsification cataract removal. Vet Ophthalmol 18, 175–185 [DOI] [PubMed] [Google Scholar]
  • 61.Nandi SK, Nahomi RB, Harris PS, Michel CR, Fritz KS and Nagaraj RH (2019) The absence of SIRT3 and SIRT5 promotes the acetylation of lens proteins and improves the chaperone activity of alpha-crystallin in mouse lenses. Exp Eye Res 182, 1–9 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Inoue Y, Itoh Y, Abe K, Okamoto T, Daitoku H, Fukamizu A, Onozaki K and Hayashi H (2007) Smad3 is acetylated by p300/CBP to regulate its transactivation activity. Oncogene 26, 500–508 [DOI] [PubMed] [Google Scholar]
  • 63.Tu AW and Luo K (2007) Acetylation of Smad2 by the co-activator p300 regulates activin and transforming growth factor beta response. J Biol Chem 282, 21187–21196 [DOI] [PubMed] [Google Scholar]
  • 64.Simonsson M, Kanduri M, Gronroos E, Heldin CH and Ericsson J (2006) The DNA binding activities of Smad2 and Smad3 are regulated by coactivator-mediated acetylation. J Biol Chem 281, 39870–39880 [DOI] [PubMed] [Google Scholar]
  • 65.Lei WW, Zhang KH, Pan XC, Hu Y, Wang DM, Yuan XW, Shu GW and Song JG (2010) Histone deacetylase 1 is required for transforming growth factor-beta 1-induced epithelial-mesenchymal transition. Int J Biochem Cell B 42, 1489–1497 [DOI] [PubMed] [Google Scholar]
  • 66.Rajagopalan M, Balasubramanian S, Ioshikhes I and Ramaswamy A (2017) Structural dynamics of nucleosome mediated by acetylations at H3K56 and H3K115,122. Eur Biophys J 46, 471–484 [DOI] [PubMed] [Google Scholar]
  • 67.Yun MY, Wu J, Workman JL and Li B (2011) Readers of histone modifications. Cell Research 21, 564–578 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.North JA, Shimko JC, Javaid S, Mooney AM, Shoffner MA, Rose SD, Bundschuh R, Fishel R, Ottesen JJ and Poirier MG (2012) Regulation of the nucleosome unwrapping rate controls DNA accessibility. Nucleic Acids Res 40, 10215–10227 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69.Manohar M, Mooney AM, North JA, Nakkula RJ, Picking JW, Edon A, Fishel R, Poirier MG and Ottesen JJ (2009) Acetylation of Histone H3 at the Nucleosome Dyad Alters DNA-Histone Binding. Journal of Biological Chemistry 284, 23312–23321 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Williams SK, Truong D and Tyler JK (2008) Acetylation in the globular core of histone H3 on lysine-56 promotes chromatin disassembly during transcriptional activation. Proc Natl Acad Sci U S A 105, 9000–9005 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Tropberger P, Pott S, Keller C, Kamieniarz-Gdula K, Caron M, Richter F, Li G, Mittler G, Liu ET, Buhler M, Margueron R and Schneider R (2013) Regulation of transcription through acetylation of H3K122 on the lateral surface of the histone octamer. Cell 152, 859–872 [DOI] [PubMed] [Google Scholar]
  • 72.Lois N, Taylor J, McKinnon AD and Forrester JV (2005) Posterior capsule opacification in mice. Arch Ophthalmol 123, 71–77 [DOI] [PubMed] [Google Scholar]
  • 73.Ittaman SV, VanWormer JJ and Rezkalla SH (2014) The role of aspirin in the prevention of cardiovascular disease. Clin Med Res 12, 147–154 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.Rosenkranz B and Frolich JC (1985) Plasma concentrations and anti-platelet effects after low dose acetylsalicylic acid. Prostaglandins Leukot Med 19, 289–300 [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Sup.mat

RESOURCES