Skip to main content
The Journal of Biological Chemistry logoLink to The Journal of Biological Chemistry
. 2021 Sep 23;297(4):101209. doi: 10.1016/j.jbc.2021.101209

DNA-PKcs kinase activity stabilizes the transcription factor Egr1 in activated immune cells

Zachary J Waldrip 1,2, Lyle Burdine 1,3, David K Harrison 1,2, Ana Clara Azevedo-Pouly 1,2, Aaron J Storey 4, Olivia G Moffett 5, Samuel G Mackintosh 4, Marie Schluterman Burdine 1,2,
PMCID: PMC8551498  PMID: 34562454

Abstract

DNA-dependent protein kinase catalytic subunit (DNA-PKcs) is known primarily for its function in DNA double-stranded break repair and nonhomologous end joining (NHEJ). However, DNA-PKcs also has a critical yet undefined role in immunity impacting both myeloid and lymphoid cell lineages spurring interest in targeting DNA-PKcs for therapeutic strategies in immune-related diseases. To gain insight into the function of DNA-PKcs within immune cells, we performed a quantitative phosphoproteomic screen in T cells to identify phosphorylation targets of DNA-PKcs. Our results indicate that DNA-PKcs phosphorylates the transcription factor Egr1 (early growth response protein 1) at serine 301. Expression of Egr1 is induced early upon T cell activation and dictates T cell response by modulating expression of cytokines and key costimulatory molecules such as IL (interleukin) 2, IL6, IFNγ, and NFκB. Inhibition of DNA-PKcs by treatment with a DNA-PKcs specific inhibitor NU7441 or shRNA knockdown increased proteasomal degradation of Egr1. Mutation of serine 301 to alanine via CRISPR-Cas9 reduced EGR1 protein expression and decreased Egr1-dependent transcription of IL2 in activated T cells. Our findings identify DNA-PKcs as a critical intermediary link between T cell activation and T cell fate and a novel phosphosite involved in regulating Egr1 activity.

Keywords: DNA-dependent protein kinase catalytic subunit (DNA-PKcs), early growth response protein 1 (EGR1), immediate early response gene (IEG), phosphoproteomics, transcription factor, IL2, T cells, enzyme inhibitor, phorbol ester

Abbreviations: CK II, casein kinase II; DNA-PKcs, DNA-dependent protein kinase catalytic subunit; DSB, double-strand break; Egr1, early growth response protein 1; IEG, immediate early response gene; IFN, interferon; IL, interleukin; KO, knockout; NHEJ, nonhomologous end joining; TCR, T cell receptor; TMT, tandem mass tag; WT, wild-type


The canonical function for DNA-dependent protein kinase catalytic subunit or DNA-PKcs is in the sensing and repair of DNA double-strand breaks (DSB) through nonhomologous end joining (NHEJ). However, all vertebrates harboring kinase loss of function mutations in DNA-PKcs present with a severe immunodeficient phenotype with defects in antibody production and impaired B and T cell maturation (1, 2, 3, 4). These defects have been primarily attributed to the function of DNA-PKcs in V(D)J recombination, which is required for antibody and receptor diversity in adaptive immune cells (5). Interestingly, this enzyme is robustly expressed in mature lymphocytes and consistently activated by various lymphocyte stimulants (6, 7). This emphasizes a function for DNA-PKcs in the mature immune system that is yet to be clearly defined.

T cells are a key component of the adaptive immune response providing long-term protection against evading pathogens. Uncontrolled or defective T cell activity, however, can have deleterious effects including transplant graft rejection, graft versus host disease, and a plethora of autoimmune diseases (8, 9). Therefore, understanding molecular mechanisms that regulate T cell activity is critical for the development of novel therapeutics to prevent/treat T cell-mediated disorders. T cell receptor (TCR) activation induces signaling cascades that regulate T cell proliferation, survival, and differentiation. The end result is widely dependent on the activation of transcription factors that promote expression of cytokines and chemokines that, depending on the level and combination, can have varying effects on T cell response. For instance, graded expression of the T-box transcription factor T-bet in naïve CD4+ T cells coordinates helper (Th) 1 or T follicular helper (Tfh) cell differentiation with higher levels driving a Th1 cell fate (10). It is becoming clear that DNA-PKcs strongly influences T cell activity, as well as other immune cells, through regulation of transcription factor expression. In CD4+ T cells, following TCR activation, DNA-PKcs regulates expression of both T-bet and Gata3 highlighting it as a master regulator of Th1 and Th2 differentiation (7, 11). Our laboratory recently reported that DNA-PKcs also controls expression of the p65 subunit of NF-κB in activated T cells, and loss of DNA-PKcs activity significantly reduces expression of NF-κB target genes including Interleukin (IL)-6 (12). Ferguson et al. determined that following viral DNA detection, DNA-PKcs drives activation of the innate immune response by directly binding the transcription factor interferon (IFN) regulator factor-3 (Irf-3), and promoting its translocation into the nucleus to induce cytokine gene expression (13). Similarly, our studies indicate that DNA-PKcs plays a pivotal role in the calcineurin-mediated translocation of NFAT to the nucleus. Inhibition of DNA-PKcs blocked calcineurin activity, thereby preventing the translocation of NFAT to the nucleus and expression of cytokine IL2 (6). Herein, we report that DNA-PKcs also regulates expression of the immediate early response gene (IEG) Egr1 (early growth response 1), a transcription factor critical for cytokine production (14, 15, 16). IEG genes such as Egr1 are transcribed within minutes of TCR stimulation to rapidly turn on transcription of genes needed for immune cell function (17, 18). This includes genes such as NFKB, ELK, and NFAT, which can be activated quickly through degradation of inhibitors or through posttranslational modifications via MAP kinase cascades (19, 20, 21). IEGs, therefore, are responsible for coaxing T cells down specific response pathways predetermined by the type of immunogenic stimulus encountered. We identified Egr1 to be a phosphorylation target of DNA-PKcs. Inhibition of DNA-PKcs or mutation of serine 301 of Egr1 resulted in significant downregulation of Egr1 protein leading to reduced secretion of IL2. Regulation of early signaling effectors such as Egr1 suggests that DNA-PKcs functions as a critical link between TCR stimulation and subsequent gene transcription capable of guiding T cell signaling toward specific outcomes.

Results

Egr1 is phosphorylated by DNA-PKcs following stimulation of T cells

Given the diversity of signaling events in which DNA-PKcs is involved, we sought to identify potential DNA-PKcs phosphorylation targets involved in T cell activation. To accomplish this goal, we performed a quantitative proteomic mass spectrometry screen for phosphoproteins utilizing TMT (tandem mass tag, Thermo) technology. This was accomplished using human T cells (Jurkat) stimulated with phorbol myristate acetate and phytohemagglutinin (PMA and PHA, respectively) and treated with or without NU7441, a specific small-molecule kinase inhibitor of DNA-PKcs (22, 23). A phospho-TMT analysis combines affinity enrichment of phosphorylated proteins/peptides with quantitative TMT isobaric reagents; thus, allowing for a highly quantitative and extensive analysis of phosphorylation events in a cell. We analyzed for differentially phosphorylated proteins between stimulated cells and stimulated cells pretreated with NU7441. Reporter ion intensities of identified phosphosites were normalized against reporter ion intensities of the corresponding protein to account for changes in overall protein abundance. Figure 1 contains a list of all phosphoproteins with a fold change of >10. We identified phosphorylation of DNA-PKcs to be downregulated providing validity to our screen given that DNA-PKcs is known to autophosphorylate itself at numerous sites (24). One of the more prominent phosphopeptides mapped to the IEG transcription factor Egr1. The phosphopeptide shown in Figure 1 was approximately 30-fold more prevalent in the noninhibitor-treated sample. Analysis of this phosphorylation site revealed that it falls within the DNA-PKcs kinase recognition motif, SQD/E (25). To further substantiate the potential biological significance of this site, a sequence alignment of this peptide in vertebrates revealed a very high degree of conservation from zebrafish to humans (Fig. 2 and Table 1). As far as we know, specific phosphorylation of this serine residue (S301) has not previously been described.

Figure 1.

Figure 1

Heatmap of differentially regulated phospho-proteins in T cells treated with or without DNA-PKcs inhibitor. T cells were activated with PHA/PMA and treated with (samples 1–3) or without (samples 4–6) NU7441 for 6 h and analyzed by mass spectrometry for comparison of differential abundance across groups. Heatmap contains all proteins with a fold change >10.

Figure 2.

Figure 2

Schematic of Egr1 protein highlighting the position of S301 and known domains. The S301 phosphorylation sites lies within the identified repressor domain of Egr1 (35).

Table 1.

Egr1 S301 phosphorylation site detected by mass spectrometry is highly conserved in vertebrate animals

Species Tryptic peptide
H. sapiens AFATQSGSQDLK
P. troglodytes AFATQSGSQDLK
M. mulatta AFATQSGSQDLK
C. lupus familiaris AFATQSGSQDLK
B. taurus AFATQSGSQDLK
M. musculus AFATQSGSQDLK
R. norvegicus AFATQSGSQDLK
G. gallus AFATQTGSQELK
X. tropicalis AFATQT- SQDLK
D. rerio AFATQTGSQDLK

To further confirm that DNA-PKcs phosphorylates Egr1, we performed an in vitro DNA-PKcs luminescent kinase assay using an Egr1 fragment containing the S301 amino acid. Significant kinase activity was detected when DNA-PKcs was incubated with the Egr1 fragment (Fig. 3). Additionally, we analyzed the phosphorylated Egr1 peptide by mass spectrometry following the in vitro kinase assay to verify DNA-PKcs phosphorylation of S301 within the Egr1 peptide. Figure S1 contains the annotated spectrum of the phosphorylated Egr1 peptide. Figure 4 highlights the MaxQuant intensity ratio of phosphorylated S301 to unphosphorylated S301 with or without DNA-PKcs. No phosphorylated S301 was detected in the absence of DNA-PKcs but was found highly phosphorylated in the presence of DNA-PKcs.

Figure 3.

Figure 3

DNA-PKcs phosphorylates Egr1 in vitro. A luminescent in vitro kinase assay was performed to measure DNA-PKcs activity. A significant increase in kinase activity was detected when recombinant DNA-PKcs was incubated with an Egr1 peptide. Error bars = s.d. of the mean of technical replicates. ∗p < 0.001 no substrate vs. Egr1 substrate.

Figure 4.

Figure 4

Serine 301 of Egr1 is phosphorylated by DNA-PKcs in vitro. Phosphorylation of the Egr1 peptide following an in vitro kinase assay was analyzed by mass spectrometry. Intensities are presented as a ratio of phosphorylated S301/unphosphorylated S301. pS301 was not detected in the absence of DNA-PKcs. Error bars = S.D. p < 0.05.

Inhibition of DNA-PKcs kinase activity reduces Egr1 protein expression

Western blotting revealed that Egr1 was highly induced upon stimulation (Fig. 5). However, Egr1 levels were markedly lower in NU7441-treated human T cells suggesting that DNA-PKcs kinase activity is required for Egr1 protein expression (Fig. 5A). To confirm inhibition of DNA-PKcs activity by NU7441 in this assay, we probed for phospho-AKT at S473, a target of DNA-PKcs (23). Phosphorylation of S473 was significantly lower in NU7441 treated samples. To validate that this result is due to specific downregulation of DNA-PKcs activity and not off target effects of the drug, we analyzed Egr1 expression patterns in total mouse splenocytes from wild-type (WT) or PRKDC (gene for DNA-PKcs) knockout mice (KO) treated with or without NU7441 (Fig. 5B) and in the embryonic kidney cell line HEK293 treated with shRNA to specifically knock down DNA-PKcs expression (Fig. 5C). Inhibition of DNA-PKcs kinase activity significantly reduced Egr1 protein expression in both additional cell lines indicating the robustness of this finding and confirming that this mechanism of regulation occurs in other cell lines that induce Egr1 expression to rapidly respond to cellular stimuli.

Figure 5.

Figure 5

Protein and RNA expression patterns associated with Egr1 in multiple cell types. Egr1 expression pattern was analyzed by Western blotting in (A) Jurkat T cells, (B) total mouse splenocytes (WT indicates WT mouse and KO indicates PRKDC functional knockout mouse), and (C) HEK293 kidney cells, which were chemically stimulated for 3 h and treated with NU7441 as indicated. D, real-time qPCR analysis of EGR1 transcripts in Jurkat cells. Error bars represent standard error of the mean. NS indicates no significant difference. E, Jurkat cells were treated as in (A) with the addition of the proteasome inhibitor MG132 and Egr1 was detected by Western blot. Error bars = s.d. of the mean of biological replicates.

EGR1 is known to be tightly regulated at the transcriptional level and, like many other T cell-responsive transcription factors, the gene is highly induced upon T cell receptor or phorbol ester stimulation. To determine whether an effect of NU7441 on EGR1 transcript levels explains the drop in Egr1 protein, qPCR was carried out in the presence or absence of NU7441. Transcript levels were unaffected (Fig. 5D) by the loss of DNA-PKcs kinase activity. To assay whether the reduction in Egr1 protein was a result of proteasomal degradation, we analyzed Egr1 levels in NU7441-treated T cells in the presence of the proteasome inhibitor MG132. Our results indicate that proteasomal inhibition is able to restore the drop in Egr1 levels observed in the presence of NU7441 (Fig. 5E).

Phosphorylation of serine 301 of Egr1 is required for protein stability

To further analyze the functional relevance of S301 phosphorylation, plasmid-based FLAG-tagged Egr1 S301 mutants were expressed under the control of a constitutive promoter in HEK293 cells. An alanine mutant (S301A) as well as two phospho-mimetic mutants (S301D and S301E) were generated. Egr1 S301A protein levels were significantly decreased in contrast to both the WT protein (S301S) and the phospho-mimetic mutants S301D and S301E (Fig. 6A). In fact, the phospho-mimetic mutations appeared to enhance protein stability. Next, we generated an EGR1 knockout (EGR1Δ) as well as an endogenous S301A mutant in Jurkat T cells using CRISPR genome editing. This yielded a similar result where a single amino acid mutation to S301A to block phosphorylation resulted in a significantly reduced level of Egr1 protein despite normal transcription (Fig. 6B). Transcript levels of the S301A mutant gene were similar to WT EGR1 levels (Fig. S2). Additionally, we performed a cycloheximide chase assay to analyze the degradation of the Egr1 S301A mutant over time. This study indicated that the S301A degraded at a much faster rate than WT further validating the importance of this site to Egr1 protein stability (Fig. 6C).

Figure 6.

Figure 6

Effect of Egr1 phosphorylation on protein stability.A, four plasmid-based variants of Egr1-3xFlag at amino acid 301, as indicated by the single-letter amino acid abbreviation (A, D, and E), were expressed in stimulated HEK293 cells. B, endogenous EGR1 S301A and knockout mutants along with the wild type S301S strain were generated in Jurkat cells using CRISPR. C, degradation of Egr1 or one of the Egr1 S301A variants over time following cycloheximide treatment and quantification of relative EGR1 protein levels from three independent experiments normalized to GAPDH. Δ = EGR1 CRISPR knockout, A = mutation generating S301A mutant (three separate clones are represented), S = WT EGR1. Error bars = standard error.

Loss of S301 phosphorylation abrogates production of IL2

Egr1 is a transcriptional regulator of the cytokine IL2. Therefore, to validate the relevance of this phosphorylation site to immune cell function, we analyzed expression of IL2. We used our CRISPR-generated EGR1Δ cell line to determine if the reintroduction of the Egr1 S301 variants (S301S, S301A, S301D, S301E) via electroporated plasmids would rescue IL2 expression. We hypothesized that the unstable S301A mutant would not fully restore or rescue IL2 levels. EGR1Δ cells were electroporated with one of five plasmids and stimulated 48 h later using PMA and ionomycin for 6 h. IL2 levels in the media were determined by ELISA. EGR1Δ samples transfected with plasmids expressing WT Egr1 S301S or the mutant S301D or S301E more than doubled their IL2 production relative to samples receiving control plasmid (Fig. 7). In line with our findings, transfection of the S301A variant generated the lowest amount of IL2 rescue. IL2 levels from the cells expressing this variant were approximately 2.3-fold over the control, compared with 2.9–3.3 fold from cells expressing Egr1 S301S, S301D, or S301E.

Figure 7.

Figure 7

Effect of Egr1 phosphorylation on IL2 expression. IL2 concentrations were measured by ELISA in Jurkat EGR1Δ cells transfected by electroporation with plasmids expressing the indicated variant of Egr1. Control indicates transfection with a plasmid containing GFP in place of EGR1. Variability is represented by standard deviation of four replicates. ∗ indicates p < 0.01 evaluated by t test.

Discussion

While DNA-PKcs is a well-known mediator of double-stranded DNA damage through promotion of NHEJ, it is becoming increasing clear that it is also a critical regulator of the immune system. This is not a characteristic unique to DNA-PKcs. Other DDR kinases such as ATR and ATM have been linked to multiple processes in both the innate and adaptive responses (26, 27, 28, 29). These functions are largely separate from their roles in NHEJ and HR (homologous recombination), which highlight a clear, yet largely undefined area of immune regulation. The goal of our study was to further understand mechanisms used by DNA-PKcs to govern T cell activation by uncovering novel target proteins. A mass spectrometry phosphoproteomic screen determined that the IEG transcription factor Egr1 is a robust phospho-target of DNA-PKcs. Phosphorylation of Egr1 at S301 by DNA-PKcs is required for protein stability and prevention of proteasomal degradation. Interestingly, the region within Egr1 containing this site has previously been reported to be critical for regulation of Egr1 transcriptional activity. Jain et al., demonstrate in mouse NIH 3T3 fibroblasts that casein kinase II (CKII) phosphorylates Egr1 within this region, which reduces Egr1 binding to DNA and transcription (30). Our data further validates the importance of this region, specifically S301, and the regulation of Egr1 through phosphorylation.

IEGs are activated within 30 minutes of TCR activation and are decisive factors in mediating T cell responses to immunogenic stimuli (17, 31). Identifying a role for DNA-PKcs in regulating expression and thus activity of Egr1 suggests that it has a much greater influence on immune response outcome than previously understood and could become a novel therapeutic target for a number of immune-related disorders. For instance, our previous study indicates that DNA-PKcs is a critical regulator of the T cell response to allogeneic antigens (12). Loss of DNA-PKcs activity prevented T cells from producing a host of inflammatory cytokines in response to alloantigen recognition resulting in reduced graft rejection in vivo. This suggests it may be a prime therapeutic target for the prevention of transplant rejection. While we show in those studies that the reduction in cytokine production from DNA-PKcs inhibition was partly due to a drop in protein expression of the NFκB subunit p65, the loss of Egr1 expression most likely was also involved in this outcome given that Egr1 promotes cytokine expression including IL2, a critical driver of transplant rejection.

We demonstrate that phosphorylation of Egr1 by DNA-PKcs prevents its degradation through the proteasomal pathway. Treatment with MG132 in the presence of NU7441 abrogated loss of Egr1 expression. Although the mechanisms involved in this effect are unknown and currently being investigated in our laboratory, this result has previously been observed for other DNA-PKcs targets. This includes estrogen receptor-α (ER-α) where interaction with DNA-PKcs resulted in phosphorylation at S118, which prevented proteasomal degradation (32). Additionally, our laboratory determined that DNA-PKcs controls NFAT-mediated transcription through indirect regulation of proteasomal degradation of the calcineurin inhibitor Cabin1 (6). Interestingly, in the report by Jain et al, they suggest that phosphorylation of Egr1 by CKII regulates its activity by promoting Egr1's interaction with and subsequent degradation by the proteasome (30). It is possible that phosphorylation by DNA-PKcs at this site that impedes, possibly through a conformational change, proteasomal interaction preventing degradation. In contrast, DNA-PKcs has also been shown to promote ubiquitination of proteins for proteasome targeting. For instance, in order to arrest transcription at DSB sites, Caron et al. discovered that DNA-PKcs promotes ubiquitination of RNA polymerase II by HECT E3 ubiquitin ligase WWP2, thereby thwarting transcription (33). These studies clearly indicate that DNA-PKcs commonly uses the ubiquitin-proteasome pathway as a mechanism to control cellular functions. This includes the antigen-mediated T cell response where it uses this pathway to control expression of key transcription factors involved in T cell activation. Critical questions remain regarding mechanisms that induce DNA-PKcs activation following T cell stimulation and mechanisms used by DNA-PKcs to influence proteasome specificity. Identifying these mechanisms and further analyzing DNA-PKcs phosphorylation targets will uncover a novel area of immune regulation that further explains how T cells respond differently to varying stimuli and provide critical targets for novel therapy for immune-related diseases.

Experimental procedures

Cell culture

Jurkat E6.1 cells and mouse splenocytes from BALB/c and NOD.CB17-Prkdc scid (#001303, #000651 respectively, Jackson Laboratory) were cultured in RPMI media supplemented with Penstrep antibiotics and 10% fetal bovine serum. HEK293 cells were cultured in EMEM media supplemented with Penstrep and 10% fetal bovine serum. Unless specified otherwise, cells were treated with NU7441 inhibitor (Selleckchem S2638) at a final concentration of 5 μM for 30 min prior to stimulation and harvested 3 h poststimulation. Stimulation was achieved with PMA (50 ng/ml) and PHA (1 μg/ml) or PMA (50 ng/ml) and Ionomycin (1 μg/ml).

Western blotting

Samples for Western blots were processed by lysis in 0.5× RIPA buffer with protease inhibitors (Thermo Scientific #78425) and phosphatase inhibitors (Roche # 04906837001) followed by sonication in a QSonica Q800R3 with the settings 30% amplitude, 30s on/off, and 15 min sonication time. Lysed samples were normalized by protein concentration determined using the bicinchoninic assay (BCA) (Thermo Scientific #23225). Samples were heated in LDS (lithium dodecyl sulfate) loading buffer then loaded into 4–12% bis-tris gels (Thermo Scientific #NW04122BOX). When blotting for DNA-PKcs, 3–12% tris-acetate gels were used (Thermo Scientific #EA0378BOX). Transfer to a PVDF membrane was completed using a Pierce Power Blotter system run at 25 V for 7 or 10 min (DNA-PKcs). Primary antibodies are as follows: Cell Signaling rabbit anti-Egr1 (44D5) #4154, Abcam mouse anti-DNA-PKcs [18-2] ab1832, Thermo Scientific mouse anti-Gapdh #MA5-15738, Cell Signaling rabbit anti-DYKDDDDK (FLAG) #2368, Cell Signaling rabbit anti-pAKT 473 #4060, and Cell Signaling rabbit anti-AKT #2938. Secondary antibodies are as follows: Thermo Scientific goat anti-mouse IgG (H+L) Alexa Fluor Plus 647 #A32728 and GE Healthcare donkey anti-rabbit HRP #NA934V. Imaging was done with a GE ImageQuant LAS4000.

ELISA

Enzyme-linked immunosorbent assays were completed using and according to the instructions found with the ELISA MAX Deluxe Set Human IL-2 (BioLegend #431804).

Mass spectrometry phospho-screen

Prior to analysis, three biological replicates each of Jurkat cells were treated with PMA and PHA for 6 h and one sample treated at 5 μM concentration with NU7441. Samples were harvested and lysed. Proteins were reduced, alkylated, and purified by chloroform/methanol extraction prior to digestion with sequencing grade trypsin and LysC (Promega). The resulting peptides were labeled using a tandem mass tag 10-plex isobaric label reagent set (Thermo) and enriched using High-Select TiO2 and Fe-NTA phosphopeptide enrichment kits (Thermo) following the manufacturer's instructions. Both enriched and unenriched labeled peptides were separated into 46 fractions on a 100 × 1.0 mm Acquity BEH C18 column (Waters) using an UltiMate 3000 UHPLC system (Thermo) with a 50 min gradient from 99:1 to 60:40 buffer A:B ratio under basic pH conditions, and then consolidated into 18 super-fractions. Each super-fraction was then further separated by reverse-phase XSelect CSH C18 2.5 um resin (Waters) on an in-line 150 × 0.075 mm column using an UltiMate 3000 RSLCnano system (Thermo). Peptides were eluted using a 60 min gradient from 98:2 to 60:40 buffer A:B ratio. Eluted peptides were ionized by electrospray (2.2 kV) followed by mass spectrometric analysis on an Orbitrap Eclipse Tribrid mass spectrometer (Thermo) using multinotch MS3 parameters. MS data were acquired using the FTMS analyzer in top-speed profile mode at a resolution of 120,000 over a range of 375–1500 m/z. Following CID activation with normalized collision energy of 31.0, MS/MS data were acquired using the ion trap analyzer in centroid mode and normal mass range. Using synchronous precursor selection, up to ten MS/MS precursors were selected for HCD activation with normalized collision energy of 55.0, followed by acquisition of MS3 reporter ion data using the FTMS analyzer in profile mode at a resolution of 50,000 over a range of 100–500 m/z. Buffer A = 0.1% formic acid, 0.5% acetonitrile, Buffer B = 0.1% formic acid, 99.9% acetonitrile. Both buffers adjusted to pH 10 with ammonium hydroxide for offline separation.

Protein identification, normalization, and statistical analysis were performed as previously described by Storey et al. Proteins were identified and reporter ions quantified by searching the UniprotKB Homo sapiens database (January 2021, 194,237 entries) using MaxQuant (version 1.6.17.0, Max Planck Institute) with a parent ion tolerance of 3 ppm, a fragment ion tolerance of 0.5 Da, a reporter ion tolerance of 0.001 Da, trypsin/P enzyme with two missed cleavages, variable modifications including oxidation on M, acetyl on protein N-term, and phosphorylation on STY, and fixed modification of carbamidomethyl on C. Protein identifications were accepted if they could be established with less than 1.0% false discovery. Proteins identified only by modified peptides were removed. Protein probabilities were assigned by the Protein Prophet algorithm (34).

TMT MS (3) reporter ion intensity values from the evidence.txt file were filtered by localization probability, summed for each phosphosite, and log2 transformed. Protein reporter ion intensities were log2 transformed. Phosphosite changes were then normalized against protein-level differences by subtracting protein log2 intensity values from the corresponding phosphosite. Statistical significance was assessed using Student's t test. The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository with the dataset identifier PXD026352. We have uploaded the MaxQuant search results to the MSViewer program to provide annotated spectra for all identified peptides. It can be reached at: https://msviewer.ucsf.edu:443/prospector/cgi-bin/mssearch.cgi?report_titleMS-Viewer&search_keyp8ndc9umma&search_namemsviewer.

In vitro kinase assay

The DNA-PK Kinase Enzyme System (Cat # V4106) and ADP-Glo Assay (Cat # V6930) from Promega were used to perform this assay. The Egr1 substrate was ordered from Origene (Cat # TP720992). The amino acid sequence of this peptide is: SSHHHHHHSSGLVPRGSHMQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVAS.

The assay was done according to the recommended instructions in a 96-well plate format with 150 μM ATP, 1 μg of positive control (peptide provided in kinase kit) or Egr1 peptide substrates, and 50 units of DNA-PK, in a total volume of 25 μl. A 1 h incubation at room temperature was performed before carrying out the ADP-Glo protocol.

Mass spectrometry analysis of kinase assay

The samples for mass spectrometric analysis were set up similar to the in vitro kinase assay, but were analyzed by mass spectrometry rather than the ADP-Glo assay. One microgram of Egr1 peptide was used in each sample performed in triplicate, with one sample group lacking the 50 units of DNA-PK (- DNA-PK). Protein samples were reduced, alkylated, and digested using filter-aided sample preparation [Nature Methods 6: 359-62 (2009)] with sequencing grade modified porcine trypsin (Promega). Tryptic peptides were separated by reverse-phase XSelect CSH C18 2.5 um resin (Waters) on an in-line 150 × 0.075 mm column using an UltiMate 3000 RSLCnano system (Thermo). Peptides were eluted using a 60 min gradient from 98:2 to 65:35 buffer A:B ratio. Eluted peptides were ionized by electrospray (2.2 kV) followed by mass spectrometric analysis on an Orbitrap Eclipse Tribrid mass spectrometer (Thermo). MS data were acquired using the FTMS analyzer in profile mode at a resolution of 120,000 over a range of 375–1200 m/z. Following HCD activation, MS/MS data were acquired using the ion trap analyzer in centroid mode and normal mass range with a normalized collision energy of 30%. Proteins were identified by database search using MaxQuant (Max Planck Institute) label-free quantification with a parent ion tolerance of 2.5 ppm and a fragment ion tolerance of 0.5 Da. Modification site assignments were evaluated using Ascore-derived probabilities with Scaffold PTM (Proteome Software). Buffer A = 0.1% formic acid, 0.5% acetonitrile. Buffer B = 0.1% formic acid, 99.9% acetonitrile.

Real-time PCR

RNA was purified with an Arum Total RNA mini kit (Bio-rad #732-6820). Reverse transcription was carried out using the iScript Advanced cDNA Synthesis kit (Bio-rad #1725037). Each PCR reaction was performed in technical duplicate and biological triplicate using SYBR green detection with a Bio-rad CFX96 Touch Real-time PCR detection system. Data was analyzed using the ΔΔCt method to determine relative concentrations of the EGR1 transcript normalized to TBP transcript levels. Primers for qPCR are as follows: EGR1 fwd – 5′ CAG CAC CTT CAA CCC TCA G, EGR1 rev – 5′ CAC AAG GTG TTG CCA CTG TT, TBP fwd – 5′ GCT GTT TAA CTT CGC TTC CG, TBP rev – 5′ CAG CAA CTT CCT CAA TTC CTT G.

Transfection

Transfection of HEK293 cells was accomplished using Lipofectamine 3000 (#L300000X) according to the manufacturer's instructions. Transfection of Jurkat cells was accomplished by electroporation using the Lonza Nucleofector 4D system with the Amaxa SE Cell Line kit (#V4XC-1032). The manufacturer's instructions were followed, and the pre-set Jurkat CL-120 program was used. In both cases, cells were grown for 48 h posttransfection before use in experiments.

Cycloheximide chase assay

Jurkat cells (wild type or alanine mutants) at 500,000 cells/ml were stimulated with PMA/Ionomycin (same concentration as in other experiments) for 30 min. At 30 min, cycloheximide (Millipore, 239765) was added to 50 μg/ml and 2.5 ml of cell culture was added to the wells of a 6-well plate (one for each time point). Samples were pelleted for 1 min at 1000g, washed once with cold PBS, pelleted again, and the pellets frozen. Lysis and Western blotting were performed as in other experiments with the same primary antibodies. Quantitation of the Western blot experiments was performed by plotting the level of WT or S301A normalized to Gapdh (three independent experiments). This was performed by AlphaEase software.

Statistical analysis

Analysis of significance was done using standard t test and expressed as the mean ± standard deviation. Assays were performed in triplicate. p ≤ 0.05 was considered significant.

Data availability

The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository with the dataset identifier PXD026352. Sequencing data for EGR1 mutants and plasmids can be shared upon request: Zachary Waldrip, ZWaldrip@uams.edu. Additional data is contained within the manuscript.

Supporting information

This article contains supporting information.

Conflict of interest

The authors declare that they have no conflicts of interest with the contents of this article.

Acknowledgments

The mass spectrometry phosphoproteomics study was carried out in collaboration with the UAMS Discovery Proteomics Service Line under the guidance of Dr Ricky Edmondson. Bioinformatics support was provided by director of the UAMS Bioinformatics Core Dr Stephanie Byrum. We would also like to acknowledge the UAMS DNA Sequencing Core Facility at the Center for Microbial Pathogenesis and Host Inflammatory Responses for providing Sanger sequencing services. The project described was supported by the Center for Translational Pediatric Research NIH COBRE P20GM121293 and the Translational Research Institute (TRI) grant TL1 TR003109 through the National Center for Advancing Translational Sciences of the NIH.

Author contributions

Z. J. W., L. B., A. C. A.-P., and M. S. B. conceptualization; D. K. H., A. J. S., O. G. M., and S. G. M. data curation; L. B., D. K. H., A. J. S., and M. S. B. formal analysis; M. S. B. funding acquisition; Z. J. W., D. K. H., and A. C. A.-P. investigation; L. B. and M. S. B. project administration; M. S. B. resources; L. B., A. C. A.-P., and M. S. B. supervision; Z. J. W. validation; Z. J. W. writing–original draft; L. B. and M. S. B. writing–review and editing.

Funding and additional information

The content is solely the responsibility of the authors and does not necessarily represent the official views of the NIH. Additional funding was provided by the Arkansas Children's Research Institute Post-doctoral Fellowship Program awarded to Z. J. W.

Edited by Peter Cresswell

Supporting information

Figure S1
mmc1.pdf (82.9KB, pdf)
Figure S2
mmc2.pdf (15.8KB, pdf)
Supporting information 1
mmc3.xlsx (22.4KB, xlsx)
Supporting information 2
mmc4.xlsx (6.2MB, xlsx)
Supporting information 3
mmc5.xlsx (61MB, xlsx)
Supporting information 4
mmc6.xlsx (46.7MB, xlsx)
Supporting information 5
mmc7.xlsx (13.7MB, xlsx)

References

  • 1.Davis A.J., Chen B.P., Chen D.J. DNA-PK: A dynamic enzyme in a versatile DSB repair pathway. DNA Repair (Amst) 2014;17:21–29. doi: 10.1016/j.dnarep.2014.02.020. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Pannunzio N.R., Watanabe G., Lieber M.R. Nonhomologous DNA end-joining for repair of DNA double-strand breaks. J. Biol. Chem. 2018;293:10512–10523. doi: 10.1074/jbc.TM117.000374. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Taccioli G.E., Amatucci A.G., Beamish H.J., Gell D., Xiang X.H., Torres Arzayus M.I., Priestley A., Jackson S.P., Marshak Rothstein A., Jeggo P.A., Herrera V.L. Targeted disruption of the catalytic subunit of the DNA-PK gene in mice confers severe combined immunodeficiency and radiosensitivity. Immunity. 1998;9:355–366. doi: 10.1016/s1074-7613(00)80618-4. [DOI] [PubMed] [Google Scholar]
  • 4.van der Burg M., van Dongen J.J., van Gent D.C. DNA-PKcs deficiency in human: Long predicted, finally found. Curr. Opin. Allergy Clin. Immunol. 2009;9:503–509. doi: 10.1097/ACI.0b013e3283327e41. [DOI] [PubMed] [Google Scholar]
  • 5.Smider V., Chu G. The end-joining reaction in V(D)J recombination. Semin. Immunol. 1997;9:189–197. doi: 10.1006/smim.1997.0070. [DOI] [PubMed] [Google Scholar]
  • 6.Kim Wiese A., Schluterman Burdine M., Turnage R.H., Tackett A.J., Burdine L.J. DNA-PKcs controls calcineurin mediated IL-2 production in T lymphocytes. PLoS One. 2017;12 doi: 10.1371/journal.pone.0181608. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Ghonim M.A., Pyakurel K., Ju J., Rodriguez P.C., Lammi M.R., Davis C., Abughazleh M.Q., Mansy M.S., Naura A.S., Boulares A.H. DNA-dependent protein kinase inhibition blocks asthma in mice and modulates human endothelial and CD4+ T-cell function without causing severe combined immunodeficiency. J. Allergy Clin. Immunol. 2015;135:425–440. doi: 10.1016/j.jaci.2014.09.005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Dornmair K., Goebels N., Weltzien H.U., Wekerle H., Hohlfeld R. T-cell-mediated autoimmunity: Novel techniques to characterize autoreactive T-cell receptors. Am. J. Pathol. 2003;163:1215–1226. doi: 10.1016/S0002-9440(10)63481-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Issa F., Schiopu A., Wood K.J. Role of T cells in graft rejection and transplantation tolerance. Expert Rev. Clin. Immunol. 2010;6:155–169. doi: 10.1586/eci.09.64. [DOI] [PubMed] [Google Scholar]
  • 10.Yu F., Sharma S., Edwards J., Feigenbaum L., Zhu J. Dynamic expression of transcription factors T-bet and GATA-3 by regulatory T cells maintains immunotolerance. Nat. Immunol. 2015;16:197–206. doi: 10.1038/ni.3053. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Mishra A., Brown A.L., Yao X., Yang S., Park S.J., Liu C., Dagur P.K., McCoy J.P., Keeran K.J., Nugent G.Z., Jeffries K.R., Qu X., Yu Z.X., Levine S.J., Chung J.H. Dendritic cells induce Th2-mediated airway inflammatory responses to house dust mite via DNA-dependent protein kinase. Nat. Commun. 2015;6:6224. doi: 10.1038/ncomms7224. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Harrison D.K., Waldrip Z.J., Burdine L., Shalin S.C., Burdine M.S. DNA-PKcs Inhibition Extends Allogeneic Skin Graft Survival. Transplantation. 2020;105:540–549. doi: 10.1097/TP.0000000000003442. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Ferguson B.J., Mansur D.S., Peters N.E., Ren H., Smith G.L. DNA-PK is a DNA sensor for IRF-3-dependent innate immunity. Elife. 2012;1 doi: 10.7554/eLife.00047. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Shin H.J., Lee J.B., Park S.H., Chang J., Lee C.W. T-bet expression is regulated by EGR1-mediated signaling in activated T cells. Clin. Immunol. 2009;131:385–394. doi: 10.1016/j.clim.2009.02.009. [DOI] [PubMed] [Google Scholar]
  • 15.Li B., Power M.R., Lin T.J. De novo synthesis of early growth response factor-1 is required for the full responsiveness of mast cells to produce TNF and IL-13 by IgE and antigen stimulation. Blood. 2006;107:2814–2820. doi: 10.1182/blood-2005-09-3610. [DOI] [PubMed] [Google Scholar]
  • 16.Pang Z., Raudonis R., McCormick C., Cheng Z. Early growth response 1 deficiency protects the host against pseudomonas aeruginosa lung infection. Infect. Immun. 2019;88 doi: 10.1128/IAI.00678-19. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Mortlock S.A., Wei J., Williamson P. T-cell activation and early gene response in dogs. PLoS One. 2015;10 doi: 10.1371/journal.pone.0121169. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Lee S.M., Vasishtha M., Prywes R. Activation and repression of cellular immediate early genes by serum response factor cofactors. J. Biol. Chem. 2010;285:22036–22049. doi: 10.1074/jbc.M110.108878. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Oeckinghaus A., Ghosh S. The NF-kappaB family of transcription factors and its regulation. Cold Spring Harb. Perspect. Biol. 2009;1 doi: 10.1101/cshperspect.a000034. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Besnard A., Galan-Rodriguez B., Vanhoutte P., Caboche J. Elk-1 a transcription factor with multiple facets in the brain. Front. Neurosci. 2011;5:35. doi: 10.3389/fnins.2011.00035. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Lee J.U., Kim L.K., Choi J.M. Revisiting the concept of targeting NFAT to control T cell immunity and autoimmune diseases. Front. Immunol. 2018;9:2747. doi: 10.3389/fimmu.2018.02747. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Zhao Y., Thomas H.D., Batey M.A., Cowell I.G., Richardson C.J., Griffin R.J., Calvert A.H., Newell D.R., Smith G.C., Curtin N.J. Preclinical evaluation of a potent novel DNA-dependent protein kinase inhibitor NU7441. Cancer Res. 2006;66:5354–5362. doi: 10.1158/0008-5472.CAN-05-4275. [DOI] [PubMed] [Google Scholar]
  • 23.Dong J., Ren Y., Zhang T., Wang Z., Ling C.C., Li G.C., He F., Wang C., Wen B. Inactivation of DNA-PK by knockdown DNA-PKcs or NU7441 impairs non-homologous end-joining of radiation-induced double strand break repair. Oncol. Rep. 2018;39:912–920. doi: 10.3892/or.2018.6217. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Uematsu N., Weterings E., Yano K., Morotomi-Yano K., Jakob B., Taucher-Scholz G., Mari P.O., van Gent D.C., Chen B.P., Chen D.J. Autophosphorylation of DNA-PKCS regulates its dynamics at DNA double-strand breaks. J. Cell Biol. 2007;177:219–229. doi: 10.1083/jcb.200608077. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Bednarski J.J., Sleckman B.P. At the intersection of DNA damage and immune responses. Nat. Rev. Immunol. 2019;19:231–242. doi: 10.1038/s41577-019-0135-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Sun L.L., Yang R.Y., Li C.W., Chen M.K., Shao B., Hsu J.M., Chan L.C., Yang Y., Hsu J.L., Lai Y.J., Hung M.C. Inhibition of ATR downregulates PD-L1 and sensitizes tumor cells to T cell-mediated killing. Am. J. Cancer Res. 2018;8:1307–1316. [PMC free article] [PubMed] [Google Scholar]
  • 27.Dillon M.T., Bergerhoff K.F., Pedersen M., Whittock H., Crespo-Rodriguez E., Patin E.C., Pearson A., Smith H.G., Paget J.T.E., Patel R.R., Foo S., Bozhanova G., Ragulan C., Fontana E., Desai K. ATR inhibition potentiates the radiation-induced inflammatory tumor microenvironment. Clin. Cancer Res. 2019;25:3392–3403. doi: 10.1158/1078-0432.CCR-18-1821. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Petersen A.J., Rimkus S.A., Wassarman D.A. ATM kinase inhibition in glial cells activates the innate immune response and causes neurodegeneration in Drosophila. Proc. Natl. Acad. Sci. U. S. A. 2012;109:E656–E664. doi: 10.1073/pnas.1110470109. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Riabinska A., Lehrmann D., Jachimowicz R.D., Knittel G., Fritz C., Schmitt A., Geyer A., Heneweer C., Wittersheim M., Frenzel L.P., Torgovnick A., Wiederstein J.L., Wunderlich C.M., Ortmann M., Paillard A. ATM activity in T cells is critical for immune surveillance of lymphoma in vivo. Leukemia. 2020;34:771–786. doi: 10.1038/s41375-019-0618-2. [DOI] [PubMed] [Google Scholar]
  • 30.Jain N., Mahendran R., Philp R., Guy G.R., Tan Y.H., Cao X. Casein kinase II associates with Egr-1 and acts as a negative modulator of its DNA binding and transcription activities in NIH 3T3 cells. J. Biol. Chem. 1996;271:13530–13536. doi: 10.1074/jbc.271.23.13530. [DOI] [PubMed] [Google Scholar]
  • 31.Bahrami S., Drabløs F. Gene regulation in the immediate-early response process. Adv. Biol. Regul. 2016;62:37–49. doi: 10.1016/j.jbior.2016.05.001. [DOI] [PubMed] [Google Scholar]
  • 32.Medunjanin S., Weinert S., Schmeisser A., Mayer D., Braun-Dullaeus R.C. Interaction of the double-strand break repair kinase DNA-PK and estrogen receptor-alpha. Mol. Biol. Cell. 2010;21:1620–1628. doi: 10.1091/mbc.E09-08-0724. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Caron P., Pankotai T., Wiegant W.W., Tollenaere M.A.X., Furst A., Bonhomme C., Helfricht A., de Groot A., Pastink A., Vertegaal A.C.O., Luijsterburg M.S., Soutoglou E., van Attikum H. WWP2 ubiquitylates RNA polymerase II for DNA-PK-dependent transcription arrest and repair at DNA breaks. Genes Dev. 2019;33:684–704. doi: 10.1101/gad.321943.118. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Nesvizhskii A.I., Keller A., Kolker E., Aebersold R. A statistical model for identifying proteins by tandem mass spectrometry. Anal. Chem. 2003;75:4646–4658. doi: 10.1021/ac0341261. [DOI] [PubMed] [Google Scholar]
  • 35.Magee N., Zhang Y. Role of early growth response 1 in liver metabolism and liver cancer. Hepatoma Res. 2017;3:268–277. doi: 10.20517/2394-5079.2017.36. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Figure S1
mmc1.pdf (82.9KB, pdf)
Figure S2
mmc2.pdf (15.8KB, pdf)
Supporting information 1
mmc3.xlsx (22.4KB, xlsx)
Supporting information 2
mmc4.xlsx (6.2MB, xlsx)
Supporting information 3
mmc5.xlsx (61MB, xlsx)
Supporting information 4
mmc6.xlsx (46.7MB, xlsx)
Supporting information 5
mmc7.xlsx (13.7MB, xlsx)

Data Availability Statement

The mass spectrometry proteomics data have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository with the dataset identifier PXD026352. Sequencing data for EGR1 mutants and plasmids can be shared upon request: Zachary Waldrip, ZWaldrip@uams.edu. Additional data is contained within the manuscript.


Articles from The Journal of Biological Chemistry are provided here courtesy of American Society for Biochemistry and Molecular Biology

RESOURCES