Skip to main content
Elsevier - PMC COVID-19 Collection logoLink to Elsevier - PMC COVID-19 Collection
. 2021 Oct 30;117:105455. doi: 10.1016/j.bioorg.2021.105455

The Mpro structure-based modifications of ebselen derivatives for improved antiviral activity against SARS-CoV-2 virus

Zhen Qiao a,1, Ningning Wei a,c,1, Lin Jin b,1, Hongyi Zhang a, Jiajie Luo a, Yanru Zhang a,c,⁎, KeWei Wang a,c,d,⁎
PMCID: PMC8556866  PMID: 34740055

Graphical abstract

graphic file with name ga1_lrg.jpg

Keywords: The main protease, SARS-CoV-2 virus, Ebselen derivatives, Antiviral, Noncovalent inhibitor

Abstract

The main protease (Mpro or 3CLpro) of SARS-CoV-2 virus is a cysteine enzyme critical for viral replication and transcription, thus indicating a potential target for antiviral therapy. A recent repurposing effort has identified ebselen, a multifunctional drug candidate as an inhibitor of Mpro. Our docking of ebselen to the binding pocket of Mpro crystal structure suggests a noncovalent interaction for improvement of potency, antiviral activity and selectivity. To test this hypothesis, we designed and synthesized ebselen derivatives aimed at enhancing their non-covalent bonds within Mpro. The inhibition of Mpro by ebselen derivatives (0.3 μM) was screened in both HPLC and FRET assays. Nine ebselen derivatives (EBs) exhibited stronger inhibitory effect on Mpro with IC50 of 0.07–0.38 μM. Further evaluation of three derivatives showed that EB2-7 exhibited the most potent inhibition of SARS-CoV-2 viral replication with an IC50 value of 4.08 µM in HPAepiC cells, as compared to the prototype ebselen at 24.61 μM. Mechanistically, EB2-7 functions as a noncovalent Mpro inhibitor in LC-MS/MS assay. Taken together, our identification of ebselen derivatives with improved antiviral activity may lead to developmental potential for treatment of COVID-19 and SARS-CoV-2 infection.

1. Introduction

The severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) causes the pandemic coronavirus disease 2019 (COVID-19) that is still in unexpected spread without therapy [1], [2]. The SARS-CoV-2 gene encodes a viral 3-chymotrypsin-like protease (3CLpro, also known as Mpro) that controls coronavirus replication [3], [4]. Mpro is a cysteine protease containing a catalytic center responsible for specific enzymatic cleavage and serves as a target for antiviral drugs [4], [5], [6]. Based on the catalytic activity of Mpro, a widely used fluorescence resonance energy transfer (FRET) assay has been adapted for screen of various peptidomimetics and small molecules that show as Mpro inhibitors within a micro- to nanomolar range [7], [8], [9], [10], [11], [12], [13].

A large-scale compound repurposing effects have recently identified a multifunctional organoselenium drug candidate ebselen as a promising Mpro inhibitor that is currently in clinical phase III trial for meniere's disease and phase II trial for bipolar disorder [14], [15], [16]. Ebselen inhibits the Mpro with an IC50 of 0.67 μM and exhibits antiviral activity with IC50 at 4.67 μM. Ebselen (PZ51, DR-3305), a glutathione peroxidase mimic, has also been reported to function as antioxidant and anti-inflammatory agent with therapeutic potential in neurological disorders, noise-induced hearing loss, cancers acute pancreatitis, mania and hypomania [17], [18], [19], [20], [21], [22], [23], [24], [25], [26]. Ebselen also inhibits other viral cysteine proteases including SARS-CoV-2 papain-like protease and 2Apro or 3Cpro from enterovirus A71 (EV-A71) and EV-D68, indicating that ebselen is a multi-target drug candidate [27].

Recent crystal structures of ebselen-Mpro complex show that ebselen forms covalent bond with Cys145 (PDB: 7BAK) [28] and Cys44 (PDB: 7BFB) of Mpro. Mass spectrometry analysis also reveals ebselen is a covalent inhibitor of Mpro [14], [27], [29], [30], [31]. Based on these observations, we designed and synthesized a series of ebselen derivatives by increasing the non-covalent interaction with Mpro for enhancing the inhibitory efficacy. Among these compounds, three ebselen derivatives exhibit potent inhibition of SARS-CoV-2 replication with improved antiviral activity and selectivity.

2. Results and discussion

2.1. Mpro structure-based design of ebselen derivatives

Based on the Mpro structure information (PDB: 7BAK and 7BFB), we started performing the molecular docking of ebselen into Mpro. As shown in Fig. 1 A, ebselen fits to the binding pocket of ebselen-Mpro complex with a similar pose and its carbonyl forms a hydrogen bond with His41 and a covalent bond with Cys44 of Mpro. Interestingly, ebselen also forms a covalent bond with Cys145 and hydrogen bond with Glu166 (Fig. 1 B) in the binding pocket that is consisted of residues His41, Met49, Phe140, Cys145, Ser144, His163, Met165 and Glu166. Both docking models indicate that the free benzene ring of ebselen is unlikely to possess molecular interactions towards Mpro. Therefore, introducing hydrogen bond donor group (amino, hydroxy and carboxyl) or hydrogen bond receptor group (carbonyl, methoxyl and fluoro groups) may increase the non-covalent interaction between ebselen derivatives and Mpro for enhancement of inhibitory effect.

Fig. 1.

Fig. 1

Two putative binding mode of ebselen in Mpro. (A) Binding mode of ebselen in Mpro defined Cys44 as covalent binding site (7BFB). (B) Binding mode of ebselen in Mpro defined Cys145 as covalent binding site(7BAJ). Line: covalent bonds (in black); hydrogen bond (in red).

Based on the docking that introducing substituents at benzene rings of ebselen may improve the activity of ebselen to Mpro, we synthesized a series of ebselen derivatives (EBs) through introducing different substituents at N-position aimed at increasing the antiviral activity on SARS-CoV-2 (Scheme 1 ). The A series maintained the benzene group at N1 position. We chose a series of substituent group with different electrostatic potentials and electron density distribution, such as amino, hydroxy, methoxy, trifluoromethyl and halogen at para- or meta-position. The B series used pyridine with lower electron density distribution to replace the benzene. Combined with the substitution at ortho-, para- or meta-position, B series can effectively reduce the formation of covalent selenosulfide bond. Most of EBs were synthesized according to Scheme 2 , and the synthesis routes of the other EBs were shown in Scheme 3, Scheme 4 .

Scheme1.

Scheme1

Structure of ebselen and its newly synthesized derivatives.

Scheme 2.

Scheme 2

Synthesis of EBs (Except EB 2–9, 2–14, 2–20, 2–21).

Scheme 3.

Scheme 3

Synthesis of EB 2–14 and EB 2–20. (a) EDC, DMAP, DCM, THF, r.t. (b) Fe, NH4Cl, H2O, EtOH, reflux. (c) Potassium selenocyanate, 1,10-Phenanthroline, CuI, K2CO3, DMF, 100 °C.

Scheme 4.

Scheme 4

Synthesis of EB 2–9 and EB 2–21.

2.2. Inhibition of Mpro by ebselen derivatives in FRET assay and HPLC assay

We first evaluated the inhibitory effect of ebselen on Mpro using Mpro proteins purified under Ni-NTA column with 90% purity in FRET assay (Figure S1). Ebselen showed a concentration-dependent inhibition of Mpro with an IC50 value of 0.41 μM, consistent with previous observation for ebselen with an IC50 of 0.67 μM [14]. Further evaluating ebselen derivatives (EBs) at a single concertation (0.3 μM) revealed that EB2-1, 2–3, 2–7, 2–9, 2–10, 2–11, 2–14, 2–16, 2–17, 2–18 and 2–19 showed stronger inhibition on Mpro than ebselen (Table 1 and Table 2 ).

Table 1.

Inhibition of SARS-CoV-2 Mpro by ebselen and its derivatives containing a substitution group at the phenyl ring in FRET assay. Data are presented as the means ± SEM with 3 replicates.

graphic file with name fx1_lrg.jpg

Entry R1 R2 %Inhibition @0.3 μM
Ebselen H Ph 61.21 ± 0.76
EB2-1 H graphic file with name fx2_lrg.gif 71.60 ± 0.69
EB2-3 H graphic file with name fx3_lrg.gif 68.65 ± 0.39
EB2-5 H graphic file with name fx4_lrg.gif 19.23 ± 0.52
EB2-6 H graphic file with name fx5_lrg.gif 50.06 ± 0.62
EB2-7 H graphic file with name fx6_lrg.gif 67.28 ± 0.14
EB2-8 H graphic file with name fx7_lrg.gif 56.26 ± 0.46
EB2-9 H graphic file with name fx8_lrg.gif 71.63 ± 0.39
EB2-10 H graphic file with name fx9_lrg.gif 67.00 ± 0.47
EB2-11 H graphic file with name fx10_lrg.gif 77.68 ± 0.60
EB2-12 H graphic file with name fx11_lrg.gif 55.25 ± 0.76
EB2-13 H graphic file with name fx12_lrg.gif 49.23 ± 0.88
EB2-14 4-amino Ph 63.67 ± 0.75
EB2-20 5-amino Ph 47.00 ± 1.66

Note: bold number denotes an improved inhibition than ebselen in FRET assay.

Table 2.

Inhibition of SARS-CoV-2 Mpro by ebselen derivatives containing a pyridine ring in FRET assay. Data are presented as the means ± SEM with 3 replicates.

graphic file with name fx13_lrg.jpg

Entry R %Inhibition @0.3 μM
EB2-15 graphic file with name fx14_lrg.gif 49.93 ± 0.88
EB2-16 graphic file with name fx15_lrg.gif 66.02 ± 0.65
EB2-17 graphic file with name fx16_lrg.gif 74.04 ± 0.55
EB2-18 graphic file with name fx17_lrg.gif 75.08 ± 0.30
EB2-19 graphic file with name fx18_lrg.gif 93.72 ± 0.01
EB2-21 graphic file with name fx19_lrg.gif 59.24 ± 0.42
EB2-22 graphic file with name fx20_lrg.gif 14.61 ± 2.50
EB2-23 graphic file with name fx21_lrg.gif 41.66 ± 0.80
EB2-24 graphic file with name fx22_lrg.gif 46.94 ± 0.48
EB2-25 graphic file with name fx23_lrg.gif 29.70 ± 2.50

Note: bold number denotes an improved inhibition than ebselen in FRET assay.

We further used the HPLC assay to verify the inhibitory effect of EBs on Mpro that digests its substrate SARS-CoV-2 Mpro MCA-AVLQSGFR-Lys(Dnp)-Lys-NH2. As compared with control without Mpro (Figure S2Aa), the substrate was hydrolyzed about 70% in the presence of Mpro (0.2 μM) due to its enzymatic cleavage (Figure S2Ab). In contrast, adding ebselen (0.3 μM) attenuated the substrate hydrolysis to 30% by inhibiting the Mpro cleavage (Figure S2Ac). We further evaluated the inhibitory effect of EBs on Mpro activity. As shown in Figure S2Ad-z, some EBs at 0.3 μM showed a significant attenuation of the substrate hydrolysis with an increased AUC by inhibiting Mpro. These results demonstrate the stronger inhibitory effects of EBs on Mpro as compared with ebselen.

To further confirm the inhibition of EBs at one concentration on Mpro, we carried out a dose-dependent inhibition of Mpro by EBs in FRET assay. As shown in Figure S3, these identified hits exhibited a dose-dependent inhibition of Mpro activity with IC50 values ranging from 0.07 to 0.59 μM. Among these derivatives, EB2-19 exhibited the most potent inhibition on Mpro.

Small molecules can self-associate into colloidal aggregates that inhibit enzymes and other proteins at micromolar concentrations in non-specific fashion [32]. Therefore, we performed the detergent-based assay to distinguish these ebselen derivatives from aggregate-based inhibitors. Adding 0.01% Triton X-100 had no obvious influence on the dose-dependent inhibition of Mpro by either ebselen or EBs, indicating that the EBs function as Mpro inhibitors rather than aggregators (Figure S3).

To evaluate the effect of reducing reagent DTT on enzymatic inhibition of Mpro by ebselen, 4 mM DTT was added in HPLC assay and FRET assay. As shown in Figure S4 and S5, the addition of DTT decreased the inhibitory effect of ebselen and its derivatives on Mpro and increased the hydrolysis of the substrate in HPLC assay. Similarly, DTT also led to the right shift of dose-dependent curves in FRET assay (Figure S6).

2.3. Cellular antiviral activity of ebselen derivatives

To investigate the effect of EBs on SARS-CoV-2 viral replication, we determined the complementary RNA copy number of SARS-CoV-2 virus in the infected HPAepiC cells after treatment of 11 ebselen derivatives (EB2-1, 2–3, 2–7, 2–9, 2–10, 2–11, 2–14, 2–16, 2–17, 2–18 and 2–19) at single concentration of 10 µM and found that 10 µM EB2-7, 2–9 and 2–19 inhibited the viral replication in HPAepiC cells. As shown in Figure S7, EB2-7, EB2-9 and EB2-19 dose-dependently inhibited the replication of SARS-CoV-2 with IC50 of 4.07 µM, 19.91 µM and 8.23 µM, as compared with ebselen at 24.60 µM in infected HPAepiC cells. The three ebselen derivatives (EB2-7, 2–9 and 2–19) were also the most potent Mpro inhibitors, suggesting that inhibiting Mpro activity can lead to potential discovery of SARS-CoV-2 antiviral drugs. Ebselen derivatives with 3-methoxyphenyl, 3-fluorophenyl and 3-fluoropyridin-4-yl showed stronger antiviral activity than ebselen, demonstrating that substituting methoxy or fluoro group of ebselen increases the inhibition of Mpro activity through non-covalent interactions. We also examined the safely profile of ebselen derivatives (EB2-1, 2–3, 2–7, 2–9, 2–10, 2–11, 2–14, 2–16, 2–17, 2–18 and 2–19) on HPAepiC cells in MTT assay. As shown in Table S1 and Figure S8, these eleven potent Mpro inhibitors had no obvious cytotoxicity in HPAepiC cells at 100 µM for 24 h, suggesting a less safety liability of these compounds.

2.4. Reduction of Se activity by ebselen derivatives

Ebselen reacts with the thiol (RSH) of Mpro for formation of a selenenyl sulfide [28]. Ebselen is also a well-known anti-inflammatory agent with glutathione peroxidase-like activity in living cells through reacting with intracellular reactive oxygen species (ROS) for the formation of selenoxide [33], thus likely reducing an available amount of ebselen derivatives and subsequently reducing their antiviral activity in vivo. After confirming that EB2-7, 2–9 and 2–19 had promising antiviral activity, we further tested the ROS reactivity of these three Mpro inhibitors using a 2,7-dichloro-fluorescein diacetate (DCFH-DA) fluorescent probe by detecting the level of intracellular ROS. As shown in Fig. 2 , adding H2O2 induced the highest level of ROS and caused oxidative and free radical damage in HPAepiC cells. The preincubation of 10 mM NAC (an ROS scavenger) for 1 h scavenged the intracellular ROS and reversed the cytotoxicity induced by ROS. With the addition of ebselen and EBs, fluorescence levels and cell death were dramatically decreased as compared to the H2O2 group. As shown in Fig. 2 B and C, EB2-7 and 2–9 exhibited a much weaker effect on ROS scavenging than ebselen, suggesting that these two compounds may exert a higher antiviral activity in vivo.

Fig. 2.

Fig. 2

Inhibition of H2O2 induced intracellular reactive oxygen species (ROS) production by 10 μM EBs. (A) Confocal imaging of ROS generation induced by 50 μM H2O2 in HPAepiC cells by DCFH-DA. (B) Relative change of fluorescence intensity detected by DCFH-DA under confocal imaging. (C) The effect of EBs on ROS induced cell death. Excitation: 488 nm, and emission: 520–570 nm. Scale bar, 20 μm. The data are presented as the means ± SEM from five replicates (n = 5). NAC (N-Acetyl-l-cysteine, 10 mM). ***P < 0.001, compared with control group.

2.5. Proposed interaction between ebselen derivatives and Mpro

Molecular docking of ebselen derivatives (EB2-7, EB2-9, EB2-19) revealed an increased bond length from 2.3 Å (Se-S bond) to 4.7 Å, 3.5 Å and 3.5 Å, respectively, between the Se atom of ebselen derivatives and the Cys44 of Mpro, suggesting a non-covalent formation between ebselen derivatives and Mpro (Fig. 3 ). And hydrogen bonds were formed between the carbonyl group of EB2-7, EB2-9 and EB2-19 and their surrounding His41 and Ser46, indicating that these residues might be essential to maintain their inhibitory activity on Mpro (Fig. 3). To further confirm the binding of ebselen derivatives to Mpro, we used LC-MS/MS analysis to capture residues modified by ebselen or EB2-7. As shown in Figure S9, a short peptide (GLWLDDVVYCPRHVICTSEDMLNPNYEDLLI) containing the Cys44 of Mpro was identified to bind to ebselen, but not EB2-7 (Figure S10), indicating that it is a non-covalent inhibitor.

Fig. 3.

Fig. 3

The putative molecular binding sites of ebselen derivatives EB2-7, EB2-9 and EB2-19 to SARS-CoV-2 Mpro. Putative binding mode of EB2-7 (A), EB2-9 (B) and EB2-19 (C) in Mpro defined Cys44 as covalent binding site. (D) Overlays of EB2-7, EB2-9 and EB2-19 in the binding pocket of ebselen. All molecular binding results generated based on the crystal structure of SARS-CoV-2 Mpro (PDB: 7BFB). Lines: hydrogen bonds (in red), the distance between Se atom and Cys44 (in black).

2.6. Molecular docking and structure–activity relationship analysis

Based on the Mpro inhibitory activity of ebselen derivatives and LC-MS/MS analysis, a structure–activity relationship was analyzed based on molecular docking studies. EB2-7, 2–9 and 2–19 were the most potent Mpro inhibitors among those ebselen derivatives with improved antiviral activity compared to ebselen. As shown in Fig. 3, molecular docking suggests that substituting 3-methoxyphenyl (EB2-7), 3-fluorophenyl (EB2-9) and 3-fluoropyridin-4-yl (EB2-19) group can increase the distance between the Se atom of ebselen derivatives and the Cys44 of Mpro with additional hydrogen bonds formed between the carbonyl groups and their surrounding residues His41 or Ser46. Moreover, the methoxy group of EB2-7 and fluorine atom of EB2-9 also forms hydrogen bond with Thr24 of Mpro, thus leading to their higher inhibitory activity on Mpro, as compared to ebselen. Among the three compounds, EB2-19 exhibits the most potent inhibition on SARS-CoV-2 Mpro, likely due to the increased water solubility by the introduction of pyridine group. However, the hydrophilic EB2-19 may not easily pass across cell membrane, which may explain its weak antiviral activity.

Except ebselen, EB2-7, EB2-9 and EB2-19, other ebselen derivatives were also tested to explore their structure–activity relationship. Four ebselen derivative (EB2-1, EB2-3, EB2-14 and EB2-20) containing amino groups were fitted into the binding pocket of Mpro. As shown in Figure S11, the bond distances between Se atom of EB2-1, EB2-3, EB2-14, EB2-20 and Cys44 of Mpro were 3.4 Å, 3.6 Å, 4.3 Å and 4.6 Å, respectively. The amino groups of EB2-1, 2–3 and 2–14 can form hydrogen interaction with surrounding Thr25 of Mpro but not EB2-20, indicating that EB2-20 had a relatively weaker inhibitory effect on Mpro (Table 1).

Molecular docking of EB2-5, EB2-6 and EB2-8 (substitution at meta-position) defines their binding to the binding pocket of Mpro. As shown in Figure S12, compared to EB2-6 and EB2-8, no hydrogen bond was observed between carbonyl group of EB2-5 and His41 of Mpro due to steric hindrance of trifluoromethyl group, which may explain its dramatic decrease of inhibitory activity (Table 1). EB2-10, EB2-11, EB2-12 and EB2-13 (substitution at para-position) are shown to share a similar pose in the binding pocket of ebselen in Mpro (Figure S13). The bond distance between the Se atom of these four compounds and the Cys44 of Mpro was about 3.2–3.6 Å and the hydrogen bonds between the carbonyl group and the His41 of Mpro are critical for maintaining the antiviral activity of ebselen derivatives such as EB2-10, EB2-11, EB2-12 and EB2-13.

Ebselen derivatives containing pyridine ring without substitution (EB2-15 and 2–16) show similar pose in the binding picket of Mpro (Figure S14). However, EB2-16 (pyridin-4-yl) exhibited a higher inhibitory effect on Mpro. Therefore, the subsequent studies were focused on substituting the pyridine ring of EB2-16. Substitution at meta-position with methyl (EB2-18) and fluorine (EB2-19) leads to an improvement of inhibitory activity compared to EB2-16 (Table 2). As shown in Figure S14 and S15 EB2-16, 2–18, and 2–19 showed a similar pose in the binding pocket. In contrast, substitution at ortho-position (EB2-21 and 2–25) was not helpful to the improvement of activity (Table 2 and Figure S16).

In general, our docking reveals that ebselen derivatives can fit into the binding pocket of Mpro with a similar pose to ebselen, and the formation of hydrogen bonds with the His41 is essential to maintain the inhibition of Mpro by these compounds. The residues Thr24, Thr25, Val42 and Ser46 are important in mediating the molecular interactions with the substitutions of ebselen for improvement of Mpro inhibition by ebselen.

3. Conclusion

In conclusion, we designed and synthesized a series of ebselen derivatives based on our docking that substituting critical groups of ebselen for reducing steric hindrance through a noncovalent binding to Mpro for improvement of antiviral activity. Two candidates EB2-7 and 2–19 exhibite potent antiviral activity with six-fold and three-fold improved potency, respectively, better than their prototype ebselen. Ebselen derivative EB2-7 may hold a promise as an antiviral agent with repurposing potential against SARS-CoV-2 virus.

4. Methods and materials

4.1. Synthetic details

All raw materials were obrained from TCI, Sinopharm Chemical Reagent Company, Bide pharmatech, Energy Chemical, Sigma Aldrich. Bruker AVANCE III HD 400 MHz was applied to obtain 1H NMR (400 MHz) and 13C NMR (101 MHz) spectra, solvent and internal standard were d6-DMSO and tetramethylsilane (TMS), respectively.

4.2. Chemistry

4.2.1. General procedure for synthesis of benzamide

The syntheses of corresponding benzamide were shown in Scheme1, Scheme 2, Scheme 3. 2-iodobenzoic acid (1 mmol, 248 mg) were dissolved in 10 mL DCM and 2.5 mL THF, then DMAP (0.2 mmol, 24.4 mg), amine (1.1 mmol) and EDC (1.4 mmol, 267 mg) were added into the solution subsequently. After the mixture solution was kept stirring for 12 h at 25 °C. Ethyl acetate was used to extract the reaction solution. The organic phase was combined and dried with anhydrous magnesium sulfate, followed by removal of the solvent by rotary evaporation, and the crude product was purified by silica gel chromatography to obtain purified product.

2-iodo-4-nitrobenzoic acid or 2-iodo-5-nitrobenzoic acid (1 mmol, 293 mg) were added into a round flask containing 10 mL DCM and 2.5 mL THF, then DMAP (0.2 mmol, 24.4 mg), aniline (1.1 mmol, 111 mg) and EDC (1.4 mmol, 267 mg) were added into the flask subsequently. After the reaction solution was kept stirring for 12 h at 25 °C. Ethyl acetate was used to extract the reaction solution. The organic phase was combined and dried with anhydrous magnesium sulfate, followed by removal of the solvent by rotary evaporation, and the crude product was purified by silica gel chromatography to obtain 2-iodo-5-nitro-N-phenylbenzamide product.

2-iodo-5-nitro-N-phenylbenzamide (0.5 mmol, 184 mg) was dissolved in the mixture solvent of EtOH and H2O, into which iron powder (2.1 mmol, 115 mg) and ammonium chloride (1 mmol, 54 mg) were added. After the reaction solution was kept reflux for 8 h, iron powder was removed through filtration and solvents were evaporated under reduced pressure. The crude product was purified by column chromatography to obtain target compound.

2-iodobenzoyl chloride (300 mg, 1 equiv) was taken into a round-bottom flask, then 1 mL DCM was added to dissolved the solid. Amine (1.2 mmol) and Et3N (341 mg, 3 equiv) were mixed in 1 mL DCM, and the mixture was dropwise added into the reaction flask. The reaction was stirred for 12 h at 25 °C. After completed, the solvent was removed by rotary evaporation, and the crude product was purified by silica gel chromatography to obtain purified product.

4.2.2. General procedure for synthesis of ebselen derivatives [34]

The syntheses of ebselen derivatives were shown in Scheme1, Scheme 2, Scheme 3. The starting benzamide (1.3 mmol), cesium carbonate (3.25 mmol), CuI (1.95 mmol), 1,10-phenanthroline (1.95 mmol), and KSeCN (1.56 mmol) were taken into a round-bottom flask. The round-bottom flask was purged with nitrogen. Then N, N-dimethylmethanamide was added as solvent, and stirred at 100 °C for 1 h. After the reaction completed, the reaction mixture was filtered to remove precipitate. The filtrate was extracted with ethyl acetate and washed with H2O to remove N,N-dimethylmethanamide. The organic phase was combined and dried with anhydrous magnesium sulfate, followed by removal of the solvent by rotary evaporation. The crude product was purified by silica gel chromatography to obtain purified product.

4.2.2.1. Synthesis of EB 2–1

N-(4-aminophenyl)-2-iodobenzamide (439 mg, 1.3 mmol) was used as starting benzamide. Purified product: yellow solid (80 mg, 21%). 1H NMR (400 MHz, DMSO‑d6) δ 8.05 (d, J = 7.9 Hz, 1H), 7.85 (dd, J = 7.8, 0.9 Hz, 1H), 7.68 – 7.62 (m, 1H), 7.49 – 7.43 (m, 1H), 7.19 – 7.14 (m, 2H), 6.63 – 6.58 (m, 2H), 5.25 (s, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 165.29 (s), 147.96 (s), 139.50 (s), 132.22 (s), 128.85 (s), 128.21 (s), 127.92 (s), 127.09 (s), 126.51 (s), 126.18 (s), 114.24 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9960.

4.2.2.2. Synthesis of EB 2–3

N-(3-aminophenyl)-2-iodobenzamide (439 mg, 1.3 mmol), was used as starting benzamide. Purified product: yellow solid (271 mg, 72%). 1H NMR (400 MHz, DMSO‑d6) δ 8.07 (d, J = 7.9 Hz, 1H), 7.89 (dd, J = 7.8, 0.8 Hz, 1H), 7.70 – 7.64 (m, 1H), 7.50 – 7.44 (m, 1H), 7.07 (t, J = 8.0 Hz, 1H), 6.87 (t, J = 2.1 Hz, 1H), 6.77 (ddd, J = 7.9, 2.1, 0.8 Hz, 1H), 6.47 (ddd, J = 8.0, 2.1, 0.9 Hz, 1H), 5.31 (s, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 165.14 (s), 150.00 (s), 140.76 (s), 139.36 (s), 132.51 (s), 129.88 (s), 129.29 (s), 128.32 (s), 126.63 (s), 126.19 (s), 112.37 (s), 112.12 (s), 110.38 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9947.

4.2.2.3. Synthesis of EB 2–5

2-iodo-N-(3-(trifluoromethyl)phenyl)benzamide (508 mg, 1.3 mmol) was used as starting benzamide. Purified product: white solid (267 mg, 60%). 1H NMR (400 MHz, DMSO‑d6) δ 8.20 (s, 1H), 8.11 (d, J = 8.0 Hz, 1H), 7.94 (dd, J = 7.7, 0.9 Hz, 1H), 7.85 (d, J = 9.7 Hz, 1H), 7.75 – 7.69 (m, 2H), 7.63 (d, J = 7.9 Hz, 1H), 7.54 – 7.49 (m, 1H). 13C NMR (101 MHz, DMSO‑d6) δ 165.94 (s), 141.10 (s), 139.28 (s), 133.12 (s), 131.10 (s), 130.07 (s), 128.88 – 128.47 (m), 126.91 (s), 126.40 (s), 122.52 (s), 121.10 (d, J = 4.0 Hz). MS: m/z [M+H]+ calcd for C14H18F3NOSe: 343.9723, found: 343.9427.

4.2.2.4. Synthesis of EB 2–6

2-iodo-N-(4-phenoxyphenyl)benzamide (540 mg, 1.3 mmol) was used as starting benzamide. Purified product: brown solid (157 mg, 33%). 1H NMR (400 MHz, DMSO‑d6) δ 8.10 (d, J = 8.0 Hz, 1H), 7.91 (dd, J = 7.7, 0.7 Hz, 1H), 7.72 – 7.66 (m, 1H), 7.66 – 7.61 (m, 2H), 7.52 – 7.46 (m, 1H), 7.46 – 7.40 (m, 2H), 7.17 (t, J = 7.4 Hz, 1H), 7.08 (td, J = 7.9, 1.5 Hz, 4H). 13C NMR (101 MHz, DMSO‑d6) δ 165.50 (s), 157.02 (s), 154.87 (s), 139.37 (s), 135.41 (s), 132.69 (s), 130.52 (d, J = 16.4 Hz), 128.80 (s), 128.42 (s), 127.07 (s), 126.74 (s), 126.32 (s), 124.14 (s), 119.57 (s), 119.21 (s). MS: m/z [M+H]+ calcd for C19H13NO2Se: 368.0112, found: 368.0119.

4.2.2.5. Synthesis of EB 2–7

2-iodo-N-(3-methoxyphenyl)benzamide (459 mg, 1.3 mmol) was used as starting benzamide. Purified product: brown solid (139 mg, 35%). 1H NMR (400 MHz, DMSO‑d6) δ 8.20 (d, J = 8.0 Hz, 1H), 7.90 (d, J = 7.2 Hz, 1H), 7.70 – 7.64 (m, 1H), 7.48 (t, J = 7.3 Hz, 1H), 7.39 – 7.30 (m, 2H), 7.16 (dd, J = 7.9, 1.3 Hz, 1H), 6.85 (dd, J = 8.2, 2.2 Hz, 1H), 3.79 (s, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 165.42 (s), 160.13 (s), 141.50 (s), 139.38 (s), 132.60 (s), 130.44 (s), 129.34 (s), 128.31 (s), 126.65 (d, J = 6.4 Hz), 117.10 (s), 111.72 (s), 110.77 (s), 55.72 (s). MS: m/z [M+H]+ calcd for C14H11NO2Se: 305.9955, found: 305.9964.

4.2.2.6. Synthesis of EB 2–8

N-(3-hydroxyphenyl)-2-iodobenzamide (441 mg, 1.3 mmol) was used as starting benzamide. Purified product: yellow solid (90 mg, 24%). 1H NMR (400 MHz, DMSO‑d6) δ 9.69 (s, 1H), 8.08 (d, J = 8.0 Hz, 1H), 7.92 – 7.88 (m, 1H), 7.71 – 7.66 (m, 1H), 7.51 – 7.46 (m, 1H), 7.24 (t, J = 8.1 Hz, 1H), 7.15 (t, J = 2.2 Hz, 1H), 7.05 (ddd, J = 8.0, 2.0, 0.8 Hz, 1H), 6.67 (ddd, J = 8.2, 2.3, 0.8 Hz, 1H). 13C NMR (101 MHz, DMSO‑d6) δ 165.30 (s), 158.35 (s), 141.19 (s), 139.26 (s), 132.70 (s), 130.38 (s), 129.21 (s), 128.40 (s), 126.72 (s), 126.23 (s), 115.42 (s), 113.41 (s), 111.86 (s). MS: m/z [M+H]+ calcd for C13H9NO2Se: 291.9799, found: 291.9806.

4.2.2.7. Synthesis of EB 2–9

N-(3-fluorophenyl)-2-iodobenzamide (443 mg, 1.3 mmol) was used as starting benzamide. Purified product: yellow solid (87 mg, 23%). 1H NMR (400 MHz, DMSO‑d6) δ 8.10 (d, J = 8.0 Hz, 1H), 7.92 (dd, J = 7.8, 0.9 Hz, 1H), 7.73 – 7.68 (m, 2H), 7.53 – 7.47 (m, 2H), 7.45 – 7.42 (m, 1H), 7.12 (tdd, J = 8.6, 2.6, 1.0 Hz, 1H). 13C NMR (101 MHz, DMSO‑d6) δ 165.72 (s), 163.78 (s), 161.36 (s), 141.97 (d, J = 10.6 Hz), 139.24 (s), 133.02 (s), 131.32 (d, J = 9.5 Hz), 128.96 (s), 128.51 (s), 126.85 (s), 126.36 (s), 120.54 (d, J = 2.8 Hz), 112.89 (s), 112.68 (s), 111.77 (s), 111.52 (s). MS: m/z [M+H]+ calcd for C13H8FNOSe: 293.9755, found: 293.9751.

4.2.2.8. Synthesis of EB 2–10

N-(4-fluorophenyl)-2-iodobenzamide (443 mg, 1.3 mmol) was used as starting benzamide. Purified product: white solid (72 mg, 19%). 1H NMR (400 MHz, DMSO‑d6) δ 8.09 (d, J = 8.0 Hz, 1H), 7.91 (dd, J = 7.8, 0.9 Hz, 1H), 7.72 – 7.69 (m, 1H), 7.66 (ddd, J = 7.1, 4.1, 1.7 Hz, 2H), 7.52 – 7.47 (m, 1H), 7.33 – 7.28 (m, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 165.58 (s), 161.40 (s), 158.98 (s), 139.39 (s), 136.35 (s), 132.77 (s), 129.57 (s), 128.68 (s), 128.45 (s), 127.39 (d, J = 8.4 Hz), 126.77 (s), 126.34 (s), 116.50 (s), 116.28 (s). MS: m/z [M+H]+ calcd for C13H8FNOSe: 293.9755, found: 293.9751.

4.2.2.9. Synthesis of EB 2–11

N-(4-hydroxyphenyl)-2-iodobenzamide (441 mg,1.3 mmol) was used as starting benzamide. Purified product: yellow solid (79 mg, 21%). 1H NMR (400 MHz, DMSO‑d6) δ 9.62 (s, 1H), 8.07 (d, J = 8.0 Hz, 1H), 7.88 (dd, J = 7.7, 0.9 Hz, 1H), 7.70 – 7.64 (m, 1H), 7.50 – 7.44 (m, 1H), 7.39 – 7.33 (m, 2H), 6.86 – 6.81 (m, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 165.37 (s), 156.21 (s), 139.48 (s), 132.40 (s), 131.09 (s), 128.79 (s), 128.29 (s), 127.25 (s), 126.60 (s), 126.24 (s), 116.04 (s). MS: m/z [M+H]+ calcd for C13H9NO2Se: 291.9799, found: 291.9793.

4.2.2.10. Synthesis of EB 2–12

2-iodo-N-(4-methoxyphenyl)benzamide (459 mg,1.3 mmol) was used as starting benzamide. Purified product: yellow solid (119 mg, 30%). 1H NMR (400 MHz, DMSO‑d6) δ 8.08 (d, J = 8.0 Hz, 1H), 7.89 (dd, J = 7.7, 0.9 Hz, 1H), 7.71 – 7.65 (m, 1H), 7.53 – 7.46 (m, 3H), 7.05 – 7.00 (m, 2H), 3.79 (s, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 165.42 (s), 157.80 (s), 139.45 (s), 132.71 (s), 132.52 (s), 128.78 (s), 128.34 (s), 127.00 (s), 126.66 (s), 126.27 (s), 114.81 (s), 55.84 (s). MS: m/z [M+H]+ calcd for C14H11NO2Se: 305.9955, found: 305.9955.

4.2.2.11. Synthesis of EB 2–13

N-(4-chlorophenyl)-2-iodobenzamide (464 mg,1.3 mmol) was used as starting benzamide. Purified product: yellow solid (153 mg, 38%). 1H NMR (400 MHz, DMSO‑d6) δ 8.10 (d, J = 8.0 Hz, 1H), 7.92 (dd, J = 7.7, 0.9 Hz, 1H), 7.73 – 7.67 (m, 3H), 7.54 – 7.49 (m, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 165.61 (s), 139.22 (s), 132.92 (s), 130.11 (s), 129.57 (s), 129.11 (s), 128.82 (s), 128.49 (s), 126.83 (s), 126.56 (s), 126.35 (s), 121.37 (s), 40.62 (s), 40.41 (s), 40.20 (s), 39.99 (s), 39.79 (s), 39.58 (s), 39.37 (s). MS: m/z [M+H]+ calcd for C13H8ClNOSe: 309.9460, found: 309.9465.

4.2.2.12. Synthesis of EB 2–14

4-amino-2-iodo-N-phenylbenzamide (439 mg, 1.3 mmol) was used as starting benzamide. Purified product: yellow solid (68 mg, 18%). 1H NMR (400 MHz, DMSO‑d6) δ 7.66 (d, J = 1.1 Hz, 1H), 7.64 (d, J = 0.9 Hz, 1H), 7.57 (d, J = 8.4 Hz, 1H), 7.48 – 7.43 (m, 2H), 7.27 – 7.20 (m, 1H), 7.16 (d, J = 2.0 Hz, 1H), 6.68 (dd, J = 8.5, 2.0 Hz, 1H), 6.08 (s, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 165.91 (s), 153.51 (s), 140.88 (d, J = 26.5 Hz), 129.46 (d, J = 8.5 Hz), 125.27 (s), 124.44 (s), 116.79 (s), 113.61 (s), 108.05 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9968.

4.2.2.13. Synthesis of EB 2–15

2-iodo-N-(pyridin-3-yl)benzamide (421 mg, 1.3 mmol) was used as starting benzamide. Purified product: brown solid (104 mg, 30%). 1H NMR (400 MHz, DMSO‑d6) δ 8.89 (s, 1H), 8.46 (d, J = 3.2 Hz, 1H), 8.12 (d, J = 8.1 Hz, 1H), 8.07 (ddd, J = 8.2, 2.5, 1.4 Hz, 1H), 7.94 (dd, J = 7.7, 0.8 Hz, 1H), 7.74 – 7.68 (m, 1H), 7.55 – 7.48 (m, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 146.89 (s), 145.89 (s), 139.50 (s), 133.06 (s), 132.41 (s), 128.45 (d, J = 17.7 Hz), 126.89 (s), 126.47 (s), 124.55 (s). MS: m/z [M+H]+ calcd for C12H8N2OSe: 276.9802, found: 276.9797.

4.2.2.14. Synthesis of EB 2–16

N-(2-chloropyridin-4-yl)-2-iodobenzamide (465 mg, 1.3 mmol) was used as starting benzamide. Purified product: white solid (97 mg, 23%). 1H NMR (400 MHz, DMSO‑d6) δ 8.40 (d, J = 5.7 Hz, 1H), 8.10 (t, J = 4.7 Hz, 2H), 7.95 (dd, J = 7.8, 0.9 Hz, 1H), 7.77 – 7.70 (m, 2H), 7.54 – 7.49 (m, 1H). 13C NMR (101 MHz, DMSO‑d6) δ 166.96 (s), 151.68 (s), 151.21 (s), 150.19 (s), 138.97 (s), 133.90 (s), 128.81 (d, J = 8.4 Hz), 127.14 (s), 126.45 (s), 116.65 (s), 116.44 (s). MS: m/z [M+H]+ calcd for C12H7ClN2OSe: 276.9802, found: 276.9808.

4.2.2.15. Synthesis of EB 2–17

2-iodo-N-(pyridin-4-yl)benzamide (421 mg, 1.3 mmol) was used as starting benzamide. Purified product: yellow solid (83 mg, 23%). 1H NMR (400 MHz, DMSO‑d6) δ 8.58 (s, 2H), 8.11 (d, J = 8.0 Hz, 1H), 7.94 (dd, J = 7.8, 0.9 Hz, 1H), 7.85 (d, J = 5.0 Hz, 2H), 7.75 – 7.70 (m, 1H), 7.54 – 7.48 (m, 1H). 13C NMR (101 MHz, DMSO‑d6) δ 166.56 (s), 151.15 (s), 147.77 (s), 138.82 (s), 133.58 (s), 129.18 (s), 128.64 (s), 127.03 (s), 126.44 (s). MS: m/z [M+H]+ calcd for C12H8N2OSe: 310.9412, found: 310.9419.

4.2.2.16. Synthesis of EB 2–18

2-iodo-N-(3-methylpyridin-4-yl)benzamide (439 mg, 1.3 mmol) was used as starting benzamide. Purified product: white solid (117 mg, 31%). 1H NMR (400 MHz, DMSO‑d6) δ 8.54 (d, J = 30.1 Hz, 2H), 8.12 (d, J = 8.1 Hz, 1H), 7.92 (dd, J = 7.7, 0.8 Hz, 1H), 7.74 – 7.69 (m, 1H), 7.53 – 7.48 (m, 1H), 7.35 (d, J = 5.1 Hz, 1H), 2.16 (s, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 165.39 (s), 152.43 (s), 148.79 (s), 145.90 (s), 140.81 (s), 132.82 (s), 128.52 (s), 127.51 (s), 126.70 (d, J = 18.3 Hz), 15.67 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9949.

4.2.2.17. Synthesis of EB 2–19

N-(3-fluoropyridin-4-yl)-2-iodobenzamide (445 mg, 1.3 mmol) was used as starting benzamide. Purified product: white solid (130 mg, 34%). 1H NMR (400 MHz, DMSO‑d6) δ 8.72 (d, J = 2.7 Hz, 1H), 8.50 (d, J = 5.2 Hz, 1H), 8.11 (d, J = 8.1 Hz, 1H), 7.95 (dd, J = 7.7, 1.0 Hz, 1H), 7.74 (ddd, J = 9.4, 7.5, 3.3 Hz, 2H), 7.54 – 7.49 (m, 1H). 13C NMR (101 MHz, DMSO‑d6) δ 169.05 (s), 146.96 (d, J = 5.2 Hz), 139.23 (s), 138.32 (s), 138.12 (s), 135.32 (s), 133.20 (d, J = 9.1 Hz), 131.19 (s), 129.81 (s), 128.57 (d, J = 16.5 Hz), 116.41 (s). MS: m/z [M+H]+ calcd for C12H7FN2OSe: 294.9708, found: 294.9690.

4.2.2.18. Synthesis of EB 2–20

5-amino-2-iodo-N-phenylbenzamide (439 mg, 1.3 mmol) was used as starting benzamide. Purified product: brown solid (75 mg, 20%). 1H NMR (400 MHz, DMSO‑d6) δ 7.64 – 7.58 (m, 2H), 7.40 (dd, J = 10.7, 5.1 Hz, 2H), 7.18 (t, J = 7.4 Hz, 1H), 7.10 (d, J = 2.4 Hz, 1H), 6.91 (dd, J = 8.6, 2.5 Hz, 1H), 5.29 (s, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 165.68 (s), 147.88 (s), 141.44 (s), 130.67 (s), 129.38 (s), 129.19 (s), 127.45 (s), 125.28 (s), 124.94 (s), 124.57 (s), 119.93 (s), 111.72 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9959.

4.2.2.19. Synthesis of EB 2–21

2-iodo-N-(2-methylpyridin-4-yl)benzamide (439 mg, 1.3 mmol) was used as starting benzamide. Purified product: white solid (80 mg, 21%). 1H NMR (400 MHz, DMSO‑d6) δ 7.88 (dd, J = 7.9, 1.6 Hz, 1H), 7.62 (d, J = 1.7 Hz, 1H), 7.56 (dd, J = 5.6, 1.8 Hz, 2H), 7.48 – 7.42 (m, 1H), 7.04 – 6.95 (m, 2H), 2.46 (s, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 167.19 (s), 158.98 (s), 158.41 (s), 158.01 (s), 149.84 (s), 134.27 (s), 130.09 (s), 119.72 (s), 118.92 (s), 117.60 (s), 113.68 (s), 112.22 (s), 24.57 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9949.

4.2.2.20. Synthesis of EB 2–22

2-iodo-N-(4-methylpyridin-2-yl)benzamide (439 mg, 1.3 mmol) was used as starting benzamide. Purified product: yellow solid (103 mg, 27%). 1H NMR (400 MHz, DMSO‑d6) δ 8.07 (dd, J = 7.8, 1.5 Hz, 1H), 7.77 (ddd, J = 8.7, 7.3, 1.6 Hz, 1H), 7.50 (d, J = 8.5 Hz, 1H), 7.31 – 7.23 (m, 2H), 7.17 – 7.12 (m, 1H), 7.01 (s, 1H), 2.12 (s, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 161.49 (s), 150.29 (s), 139.77 (s), 135.79 (s), 128.90 – 128.39 (m), 127.77 (d, J = 15.8 Hz), 123.04 (s), 115.47 (s), 114.76 (s), 25.74 (s). MS: m/z [M+H]+ calcd for C13H10N2OSe: 290.9958, found: 290.9951.

4.2.2.21. Synthesis of EB 2–23

N-(5-aminopyridin-3-yl)-2-iodobenzamide (441 mg, 1.3 mmol) was used as starting benzamide. Purified product: brown solid (87 mg, 23%). 1H NMR (400 MHz, DMSO‑d6) δ 8.60 (d, J = 7.8 Hz, 1H), 8.08 (d, J = 2.1 Hz, 1H), 7.86 – 7.81 (m, 1H), 7.75 (d, J = 2.3 Hz, 1H), 7.61 – 7.56 (m, 1H), 7.41 (t, J = 6.9 Hz, 2H), 7.21 (t, J = 2.3 Hz, 1H), 5.50 (s, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 168.32 (s), 159.08 (s), 150.69 (s), 143.36 (s), 139.29 (d, J = 4.9 Hz), 131.27 (s), 128.44 (d, J = 18.1 Hz), 104.46 (s), 102.16 (s), 93.99 (s). MS: m/z [M+H]+ calcd for C12H9N3OSe: 291.9911, found: 291.9960.

4.2.2.22. Synthesis of EB 2–24

N-(6-aminopyridin-2-yl)-2-iodobenzamide (441 mg,1.3 mmol) was used as starting benzamide. Purified product: brown solid (113 mg, 30%). 1H NMR (400 MHz, DMSO‑d6) δ 8.06 (d, J = 8.0 Hz, 1H), 7.86 (d, J = 7.1 Hz, 1H), 7.72 (d, J = 7.6 Hz, 1H), 7.67 – 7.62 (m, 1H), 7.43 (dt, J = 7.2, 6.2 Hz, 3H), 6.14 (d, J = 5.0 Hz, 2H). 13C NMR (101 MHz, DMSO‑d6) δ 164.69 (s), 158.84 (s), 150.88 (s), 140.17 (s), 139.74 (s), 132.74 (s), 131.30 (s), 127.84 (s), 126.29 (s), 126.17 (s), 104.80 (s), 101.11 (s). MS: m/z [M+H]+ calcd for C12H9N3OSe: 291.9911, found: 291.9901.

4.2.2.23. Synthesis of EB 2–25

2-iodo-N-(2-methoxypyridin-4-yl)benzamide (460 mg, 1.3 mmol) was used as starting benzamide. Purified product: brown solid (163 mg, 41%). 1H NMR (400 MHz, DMSO‑d6) δ 8.05 (d, J = 5.8 Hz, 1H), 7.74 (dd, J = 7.4, 1.7 Hz, 1H), 7.45 (dtd, J = 9.0, 7.4, 1.5 Hz, 2H), 7.34 (dd, J = 7.6, 1.3 Hz, 1H), 7.24 (dd, J = 5.7, 1.7 Hz, 1H), 7.20 (d, J = 1.5 Hz, 1H), 3.83 (s, 3H). 13C NMR (101 MHz, DMSO‑d6) δ 167.98 (s), 165.02 (s), 148.39 (s), 147.80 (s), 138.77 (s), 134.66 (s), 132.18 (s), 131.84 (s), 128.79 (s), 127.86 (s), 109.03 (s), 99.49 (s), 53.62 (s). MS: m/z [M+H]+ calcd for C13H10N2O2Se: 306.9907, found: 306.9916.

4.3. Virus lines

The SARS-CoV-2 strain 107 was obtained from the Guangdong Provincial CDC, Guangdong, China.

4.4. Expression and purification of SARS-CoV-2 Mpro

The preparation of SARS-CoV-2 Mpro was performed by Beijing Ambition Biotechnology Co, Ltd. The SARS-CoV-2 Mpro full-length gene (NC_045512) was optimized and synthesized for the adaption of Escherichia coli. The expression plasmid was transformed into Escherichia coli Rosetta (DE3). After the OD600 value of cells reached 0.6, 0.5 mM isopropyl-beta-d-thiogalactopyranoside (IPTG) was added into the cell culture and incubated overnight at 23 °C, and then centrifugated at 8000 rmp to harvest the cells. The precipitate was resuspended in 0.02 M Na2HPO4/NaH2PO4, 0.5 M NaCl (pH 7.4), and high-pressure homogenization was applied to lyse cells. After centrifugation at 12,000 rmp, the supernatant was loaded and purified Mpro was obtained by Ni-NTA affinity column with 0.02 M Na2HPO4/NaH2PO4, 0.5 M NaCl, 500 mM imidazole (pH 7.4). The purified Mpro was stored in assay buffer 50 mM Tris-HCl, 1 mM EDTA (pH 7.3) before use.

4.5. LC-MS/MS analysis

The LC-MS/MS analysis was performed by Shanghai Bioprofile Technology Co, Ltd. LC-MS/MS experiments were performed on a QE-HFX mass spectrometer that was coupled to Easy nLC (Thermo Scientific). The sample was lysed by SDT (4% SDS, 100 mM DTT, 100 mM TrisHCl) and redissolved in 200 µL UA buffer (8 M Urea, 150 mM Tris-HCl, pH8.0). After digested for 16–18 h at 37 °C by 40 µL Trypsin buffer (6 µg Trypsin in 40 µL NH4HCO3 buffer), the samples were centrifuged at 12,000 g for 10 min. The filtrate contained peptide was collect and desalted by C18 StageTip. After vacuum drying, peptide was redissolved in 0.1% FA (0.1% Formic acid in water) and quantified at OD280 for LC-MS/MS analysis. Peptide was first loaded to a trap column (100 μm*20 mm, 5 μm, C18, Dr. Maisch GmbH, Ammerbuch, Germany) in buffer A (0.1% Formic acid in water). Reverse-phase high-performance liquid chromatography (RP-HPLC) separation was performed using a self-packed column (75 μm × 150 mm; 3 μm ReproSil-Pur C18 beads, 120 Å, Dr. Maisch GmbH, Ammerbuch, Germany) at a flow rate of 300 nL/min. The RP–HPLC mobile phase A was 0.1% formic acid in water, and B was 0.1% formic acid in 95% acetonitrile. The gradient was set as following: 2–4% buffer B from 0 min to 2 min, 4–30% buffer B from 2 min to 47 min, 30–45% buffer B from 47 min to 52 min, 45–90% buffer B from 52 min to 54 min, 90% buffer B kept till to 60 min. MS data was acquired using a data-dependent top20 method dynamically choosing the most abundant precursor ions from the survey scan (350–1800 m/z) for HCD fragmentation. A lock mass of 445.120025 Da was used as internal standard for mass calibration. The full MS scans were acquired at a resolution of 70,000 at m/z 200, and 17,500 at m/z 200 for MS/MS scan. The maximum injection time was set to for 50 ms for MS and 50 ms for MS/MS. Normalized collision energy was 27 and the isolation window was set to 1.6 Th. Dynamic exclusion duration was 60 s.

4.6. FRET assay for inhibition of Mpro [7]

A buffer containing 50 mM Tris–HCl and 1 mM EDTA (pH 7.3) was used in inhibitory activity assay. The substrate with the cleavage site of SARS-CoV-2 Mpro MCA-AVLQSGFR-Lys(Dnp)-Lys-NH2 (95% purity, GL Biochem Shanghai Ltd, Shanghai, China) was employed in the fluorescence resonance energy transfer (FRET)-based cleavage assay. The fluorescent intensity was detected by a Flexstation 3 (Molecular Device) and the excitation and emission wavelength were 320 nm and 405 nm, respectively. Firstly, for initially evaluate, stocked Mpro protein was diluted to the work concentration of 0.2 μM in each well, 0.3 μM tested compound and 20 μM substrate were added and the reaction was stirred in a Tris-HCl buffer at 30 °C. For the determination of the IC50, we used various concentrations (0–10 μM) of tested compounds in reaction buffer at 30 °C. It is reported that some compounds as aggregators can inhibit Mpro, thus 0.01% Triton X-100 was added into the reaction at the same time as detergent-based control. The IC50 value was determined by using the Origin 8.6 software. Each experiment was repeated at least five times.

4.7. HPLC assay for inhibition of Mpro

A buffer containing 50 mM Tris–HCl and 1 mM EDTA (pH 7.3) was used in the HPLC assay. As a blank control, the retention time and absorbance of Mpro substrate (SARS-CoV-2 Mpro MCA-AVLQSGFR-Lys(Dnp)-Lys-NH2) at 100 μM was detected before further incubation with Mpro protein at 0.2 μM for 30 min at 30 °C. For the measurement of inhibitory effect of ebselen or EBs at 0.3 μM on Mpro, 0.2 μM Mpro protein and 100 μM substrate were added and stirred at 30 °C for 30 min before the area under curve (AUC) of the substrate absorbance was detected using the HPLC assay. Column: Diamonsil C18, 4.6*250 mm, 5 μm. Solvent A: 0.1% trifluoroacetic in 100% acetonitrile; solvent B: 0.1% trifluoroacetic in 100% water. 32% A/B to 57% A/B in 25 min, at 1 mL min−1 flow rate.

4.8. Molecular modeling

The crystal structure of ebselen to the SARS-CoV-2 Mpro complex (PDB: 7BFB) was obtained from the Protein Data Bank (http://www.rcsb.org/). Ligand, waters and ions were removed from PDB file.

The chemical structures of ebselen and ebselen derivatives were optimized in SYBYL (Tripos, St Louis, MO, USA) The chemical structures of ebselen and ebselen derivatives were sketched in SYBYL (Tripos, St Louis, MO, USA) and protonated, before energy minimization using the Tripos force field (Gasteiger–Hückel charges, distance-dependent dielectric constant = 4.0, nonbonded interaction cutoff = 8 Å, and termination criterion = energy gradient < 0.05 kcal/(mol × Å) for 10 000 iterations).

The molecular docking was performed on the program GOLD Suite 5.1 (Cambridge Crystallographic Data Center, Cambridge, U.K.). The original ligand was extracted and the new ligands were fit into the binding pocket of ebselen after defined Cys44 as binding site. The ChemScore was selected to fitness scoring function and the output results were also evaluated by the GoldScore function. The exported complexes were edited by UCSF Chimera 1.15 software.

4.9. Cytotoxicity test

Each well was cultivated with different concentrations of ebselen derivatives for 24 h, and then treated with 10 μL of MTT solution for 4 h. After discarding the medium contained MTT of each well, DMSO was added. OD values (Optical density) of each well were measured with a Microplate Reader at 490 nm. The CC50 values were calculated with dose–response curves by GraphPad Prism 5. Each well was duplicated for five times.

For measurement of ROS-induced cell death, HPAepiC cells were exposed to 50 μM H2O2 for 1 h before washed with fresh medium for three times. Cells were treated with medium contained 10 mM NAC (N-acetyl-l-cysteine), 10 μM ebselen, EB2-7, EB2-9 or EB2-19 for 24 h.

4.10. Antiviral assays

The antiviral activity of ebselen derivative was determined using reported method [4]. HPAepiC cells were infected with SARS-CoV-2 at MOI of 0.1 with or without drug candidates for 1 h. The equivalent amount of DMSO was used as solvent control. Virus-drug mixture was removed before cells were further cultured with fresh drug-free RPMI 1640 medium with 3% FBS. 24 h post infection, total RNAs of cells were extracted. For detection of SARS-CoV-2 RNA, a THUNDERBIRD Probe One-Step qRT-PCR Kit (QRZ-101, TOYOBO, Japan) was used in accordance with the manufacturer’s protocols. Primers and probes used in this experiment included forward primer 5′-GGGGAACTTCTCCTGCTAGAAT-3′, reverse primer 5′-CAGACATTTTGCTCTCAAGCTG-3′, and probe FAM-TTGCTGCTGCTTGACAGATT-TAMRA-3′ [35]. In each run, serial dilutions of the SARS-CoV-2 RNA reference standard (GBW(E)091089, National Institute of Metrology, China) were carried out in parallel to determine the viral RNA copies per μg RNA. IC50 values were calculated using the GraphPad Prism 6 software using reported methods (Version 6.01, GraphPad Software, Inc., San Diego, CA, 2012) [36], [37], [38]. All experiments were performed at biosafety level-3 (BSL-3) in the Kunming National High-Level Biosafety Research Center for Non-Human Primates, Center for Biosafety Mega-Science, Kunming Institute of Zoology, Chinese Academy of Sciences.

4.11. Measurement of intracellular reactive oxygen (ROS)

The generation of intracellular reactive oxygen was measured by an oxidation-sensitive probe 2′,7′-dichlorodihydrofluoresceindiacetate (DCFH-DA, Beyotime Institute of Biotechnology, China). DCFH-DA can be cleaved by esterases, and then becomes highly fluorescent DCFH upon oxidation by ROS. HPAepiC cells were seed in 35-mm dishes and cultured in prepared medium for 24 h. Then, HPAepiC cells were exposed to 50 μM H2O2 for 1 h, and washed with fresh medium for three times. Cells were treated with medium contained 10 μM ebselen, EB2-7, EB2-9, EB2-19 for 24 h. Cells treated with 10 mM NAC (N-acetyl-l-cysteine) were used as positive control for inhibition of ROS generation. Then cells were incubated with 10 μM DCFH-DA at 37 °C for 30 min in the dark before washed with PBS for three times. The cell imaging of DCFH was captured by confocal fluorescence microscopy. Ex: 488 nm Em: 520–570 nm.

4.12. Statistical analysis

The IC50 values of Mpro inhibitors were calculated using the Origin 8.6 software. The IC50 values of antiviral drugs were calculated using the GraphPad Prism 6 software (Version 6.01, GraphPad Software, Inc., San Diego, CA, 2012).

Declaration of Competing Interest

The authors declare that they have no known competing financial interests or personal relationships that could have appeared to influence the work reported in this paper.

Acknowledgments

We thank Dr. Peng Wang (Dalian Institute of Chemical Physics, Chinese Academy of Science) for the HPAepiC cells. We thank Dr. Rilei Yu (Key Laboratory of Marine Drugs, Chinese Ministry of Education, School of Medicine and Pharmacy, Ocean University of China) for the molecular docking software. We also thank Shanghai Bioprofile Technology Company Ltd. for technical support in mass spectroscopy. This project was supported by grants awarded to K.W.W. from the Science and Technology Program of Guangdong, China (2018B030334001).

Footnotes

Appendix A

Supplementary data to this article can be found online at https://doi.org/10.1016/j.bioorg.2021.105455.

Appendix A. Supplementary material

The following are the Supplementary data to this article:

Supplementary data 1
mmc1.docx (13.9MB, docx)

References

  • 1.Wu F., Zhao S.u., Yu B., Chen Y.-M., Wang W., Song Z.-G., Hu Y.i., Tao Z.-W., Tian J.-H., Pei Y.-Y., Yuan M.-L., Zhang Y.-L., Dai F.-H., Liu Y.i., Wang Q.-M., Zheng J.-J., Xu L., Holmes E.C., Zhang Y.-Z. A new coronavirus associated with human respiratory disease in China. Nature. 2020;579(7798):265–269. doi: 10.1038/s41586-020-2008-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Zhou P., Yang X.-L., Wang X.-G., Hu B., Zhang L., Zhang W., Si H.-R., Zhu Y., Li B., Huang C.-L., Chen H.-D., Chen J., Luo Y., Guo H., Jiang R.-D., Liu M.-Q., Chen Y., Shen X.-R., Wang X.i., Zheng X.-S., Zhao K., Chen Q.-J., Deng F., Liu L.-L., Yan B., Zhan F.-X., Wang Y.-Y., Xiao G.-F., Shi Z.-L. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature. 2020;579(7798):270–273. doi: 10.1038/s41586-020-2012-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Anand K., Ziebuhr J., Wadhwani P., Mesters J.R., Hilgenfeld R. Coronavirus main proteinase (3CLpro) structure: basis for design of anti-SARS drugs. Science. 2003;300(5626):1763–1767. doi: 10.1126/science.1085658. [DOI] [PubMed] [Google Scholar]
  • 4.Zhang L., Lin D., Sun X., Curth U., Drosten C., Sauerhering L., Becker S., Rox K., Hilgenfeld R. Crystal structure of SARS-CoV-2 main protease provides a basis for design of improved alpha-ketoamide inhibitors. Science. 2020;368(6489):409–412. doi: 10.1126/science.abb3405. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Hilgenfeld R. From SARS to MERS: crystallographic studies on coronaviral proteases enable antiviral drug design. FEBS J.. 2014;281(18):4085–4096. doi: 10.1111/febs.12936. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Zhang L., Lin D., Kusov Y., Nian Y., Ma Q., Wang J., von Brunn A., Leyssen P., Lanko K., Neyts J., de Wilde A., Snijder E.J., Liu H., Hilgenfeld R. alpha-Ketoamides as broad-spectrum inhibitors of coronavirus and enterovirus replication: structure-based design, synthesis, and activity assessment. J. Med. Chem. 2020;63(9):4562–4578. doi: 10.1021/acs.jmedchem.9b01828. [DOI] [PubMed] [Google Scholar]
  • 7.Yang H., Xie W., Xue X., Yang K., Ma J., Liang W., Zhao Q.i., Zhou Z., Pei D., Ziebuhr J., Hilgenfeld R., Yuen K.Y., Wong L., Gao G., Chen S., Chen Z., Ma D., Bartlam M., Rao Z., Bjorkman P. Design of wide-spectrum inhibitors targeting coronavirus main proteases. PLoS Biol. 2005;3(10):e324. doi: 10.1371/journal.pbio.0030324. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Pillaiyar T., Manickam M., Namasivayam V., Hayashi Y., Jung S.H. An overview of severe acute respiratory syndrome-coronavirus (SARS-CoV) 3CL protease inhibitors: peptidomimetics and small molecule chemotherapy. J. Med. Chem. 2016;59(14):6595–6628. doi: 10.1021/acs.jmedchem.5b01461. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Zhu W., Xu M., Chen C.Z., Guo H., Shen M., Hu X., Shinn P., Klumpp-Thomas C., Michael S.G., Zheng W. Identification of SARS-CoV-2 3CL protease inhibitors by a quantitative high-throughput screening. ACS Pharmacol. Transl. Sci. 2020;3(5):1008–1016. doi: 10.1021/acsptsci.0c00108. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Sun L.Y., Chen C., Su J., Li J.Q., Jiang Z., Gao H., Chigan J.Z., Ding H.H., Zhai L., Yang K.W. Ebsulfur and Ebselen as highly potent scaffolds for the development of potential SARS-CoV-2 antivirals. Bioorg. Chem. 2021;112 doi: 10.1016/j.bioorg.2021.104889. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Loschwitz J., Jackering A., Keutmann M., Olagunju M., Eberle R.J., Coronado M.A., Olubiyi O.O., Strodel B. Novel inhibitors of the main protease enzyme of SARS-CoV-2 identified via molecular dynamics simulation-guided in vitro assay. Bioorg. Chem. 2021;111 doi: 10.1016/j.bioorg.2021.104862. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Guo S., Xie H., Lei Y., Liu B., Zhang L., Xu Y., Zuo Z. Discovery of novel inhibitors against main protease (Mpro) of SARS-CoV-2 via virtual screening and biochemical evaluation. Bioorg. Chem. 2021;110 doi: 10.1016/j.bioorg.2021.104767. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Girgis A.S., Panda S.S., Srour A.M., Abdelnaser A., Nasr S., Moatasim Y., Kutkat O., El Taweel A., Kandeil A., Mostafa A., Ali M.A., Fawzy N.G., Bekheit M.S., Shalaby E.M., Gigli L., Fayad W., Soliman A.A.F. 3-Alkenyl-2-oxindoles: Synthesis, antiproliferative and antiviral properties against SARS-CoV-2. Bioorg. Chem. 2021;114 doi: 10.1016/j.bioorg.2021.105131. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Jin Z., Du X., Xu Y., Deng Y., Liu M., Zhao Y., Zhang B., Li X., Zhang L., Peng C., Duan Y., Yu J., Wang L., Yang K., Liu F., Jiang R., Yang X., You T., Liu X., Yang X., Bai F., Liu H., Liu X., Guddat L.W., Xu W., Xiao G., Qin C., Shi Z., Jiang H., Rao Z., Yang H. Structure of M(pro) from SARS-CoV-2 and discovery of its inhibitors. Nature. 2020;582(7811):289–293. doi: 10.1038/s41586-020-2223-y. [DOI] [PubMed] [Google Scholar]
  • 15.Haritha C.V., Sharun K., Jose B. Ebselen, a new candidate therapeutic against SARS-CoV-2. Int. J. Surg. 2020;84:53–56. doi: 10.1016/j.ijsu.2020.10.018. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Sies H., Parnham M.J. Potential therapeutic use of ebselen for COVID-19 and other respiratory viral infections. Free Radical. Bio. Med. 2020;156:107–112. doi: 10.1016/j.freeradbiomed.2020.06.032. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Schewe T. Molecular actions of ebselen - an antiinflammatory antioxidant. Gen Pharmacol.-Vasc. S. 1995;26(6):1153–1169. doi: 10.1016/0306-3623(95)00003-j. [DOI] [PubMed] [Google Scholar]
  • 18.Batna A., Fuchs C., Spiteller G. Lipid peroxidation in presence of ebselen. Chem. Phys. Lipids. 1997;87(2):149–158. doi: 10.1016/s0009-3084(97)00037-6. [DOI] [PubMed] [Google Scholar]
  • 19.Chew P., Yuen D.Y.C., Stefanovic N., Pete J., Coughlan M.T., Jandeleit-Dahm K.A., Thomas M.C., Rosenfeldt F., Cooper M.E., Haan J.B.d. Antiatherosclerotic and renoprotective effects of ebselen in the diabetic apolipoprotein E/GPx1-double knockout mouse. Diabetes. 2010;59(12):3198–3207. doi: 10.2337/db10-0195. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Chew P., Yuen D.Y.C., Koh P., Stefanovic N., Febbraio M.A., Kola I., Cooper M.E., de Haan J.B. Site-specific antiatherogenic effect of the antioxidant ebselen in the diabetic apolipoprotein E-deficient mouse. Arterioscl. Throm. Vas. 2009;29(6):823–830. doi: 10.1161/ATVBAHA.109.186619. [DOI] [PubMed] [Google Scholar]
  • 21.Singh N., Halliday A.C., Thomas J.M., Kuznetsova O.V., Baldwin R., Woon E.C.Y., Aley P.K., Antoniadou I., Sharp T., Vasudevan S.R., Churchill G.C. A safe lithium mimetic for bipolar disorder. Nat. Commun. 2013;4(1) doi: 10.1038/ncomms2320. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Wendel A., Fausel M., Safayhi H., Tiegs G., Otter R. A novel biologically-active organoselenium compound. 2. Activity of Pz-51 in relation to glutathione-peroxidase. Biochem. Pharmacol. 1984;33(20):3241–3245. doi: 10.1016/0006-2952(84)90084-4. [DOI] [PubMed] [Google Scholar]
  • 23.Safayhi H., Tiegs G., Wendel A. A Novel Biologically-active seleno-organic compound. 5. inhibition by ebselen (Pz-51) of rat peritoneal neutrophil lipoxygenase. Biochem. Pharmacol. 1985;34(15):2691–2694. doi: 10.1016/0006-2952(85)90569-6. [DOI] [PubMed] [Google Scholar]
  • 24.Bijian K., Zhang Z., Xu B., Jie S.u., Chen B.o., Wan S., Wu JianHui, Jiang T., Alaoui-Jamali M.A. Synthesis and biological activity of novel organoselenium derivatives targeting multiple kinases and capable of inhibiting cancer progression to metastases. Eur. J. Med. Chem. 2012;48:143–152. doi: 10.1016/j.ejmech.2011.12.006. [DOI] [PubMed] [Google Scholar]
  • 25.Sharpley A.L., Williams C., Holder A.A., Godlewska B.R., Singh N., Shanyinde M., MacDonald O., Cowen P.J. A phase 2a randomised, double-blind, placebo-controlled, parallel-group, add-on clinical trial of ebselen (SPI-1005) as a novel treatment for mania or hypomania. Psychopharmacology. 2020;237(12):3773–3782. doi: 10.1007/s00213-020-05654-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Ruberte A.C., Sanmartin C., Aydillo C., Sharma A.K., Plano D. Development and therapeutic potential of selenazo compounds. J. Med. Chem. 2020;63(4):1473–1489. doi: 10.1021/acs.jmedchem.9b01152. [DOI] [PubMed] [Google Scholar]
  • 27.Ma C., Hu Y., Townsend J.A., Lagarias P.I., Marty M.T., Kolocouris A., Wang J. Ebselen, disulfiram, carmofur, PX-12, tideglusib, and shikonin are nonspecific promiscuous SARS-CoV-2 main protease inhibitors. ACS Pharmacol. Transl. Sci. 2020;3(6):1265–1277. doi: 10.1021/acsptsci.0c00130. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Amporndanai K., Meng X., Shang W., Jin Z., Rogers M., Zhao Y., Rao Z., Liu Z.J., Yang H., Zhang L., O'Neill P.M., Samar Hasnain S. Inhibition mechanism of SARS-CoV-2 main protease by ebselen and its derivatives. Nat. Commun. 2021;12(1):3061. doi: 10.1038/s41467-021-23313-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Menéndez Cintia A., Byléhn Fabian, Perez-Lemus Gustavo R., Alvarado Walter, de Pablo Juan J. Molecular characterization of ebselen binding activity to SARS-CoV-2 main protease. Sci. Adv. 2020;6(37) doi: 10.1126/sciadv.abd0345. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Aljoundi A., Bjij I., El Rashedy A., Soliman M.E.S. Covalent versus non-covalent enzyme inhibition: which route should we take? A justification of the good and bad from molecular modelling perspective. Protein J. 2020;39(2):97–105. doi: 10.1007/s10930-020-09884-2. [DOI] [PubMed] [Google Scholar]
  • 31.De Cesco Stephane, Kurian Jerry, Dufresne Caroline, Mittermaier Anthony K., Moitessier Nicolas. Covalent inhibitors design and discovery. Eur. J. Med. Chem. 2017;138:96–114. doi: 10.1016/j.ejmech.2017.06.019. [DOI] [PubMed] [Google Scholar]
  • 32.Feng Brian Y, Shoichet Brian K. A detergent-based assay for the detection of promiscuous inhibitors. Nat. Protoc. 2006;1(2):550–553. doi: 10.1038/nprot.2006.77. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Antony Sonia, Bayse Craig A. Modeling the mechanism of the glutathione peroxidase mimic ebselen. Inorg. Chem. 2011;50(23):12075–12084. doi: 10.1021/ic201603v. [DOI] [PubMed] [Google Scholar]
  • 34.Thanna S., Goins C.M., Knudson S.E., Slayden R.A., Ronning D.R., Sucheck S.J. Thermal and photoinduced copper-promoted C-Se bond formation: synthesis of 2-Alkyl-1,2-benzisoselenazol-3(2H)-ones and evaluation against mycobacterium tuberculosis. J. Org. Chem. 2017;82(7):3844–3854. doi: 10.1021/acs.joc.7b00440. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Song T.Z., Zheng H.Y., Han J.B., Jin L., Yang X., Liu F.L., Luo R.H., Tian R.R., Cai H.R., Feng X.L., Liu C., Li M.H., Zheng Y.T. Delayed severe cytokine storm and immune cell infiltration in SARS-CoV-2-infected aged Chinese rhesus macaques. Zool. Res. 2020;41(5):503–516. doi: 10.24272/j.issn.2095-8137.2020.202. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Wang L.Y., Bu F.Z., Yu Y.M., Niu Y.Y., Li Y.T., Yan C.W., Wu Z.Y. A novel crystalline molecular salt of sulfamethoxazole and amantadine hybridizing antiviral-antibacterial dual drugs with optimal in vitro/vivo pharmaceutical properties. Eur. J. Pharm. Sci. 2021;163 doi: 10.1016/j.ejps.2021.105883. [DOI] [PubMed] [Google Scholar]
  • 37.Wang Ling-Yang, Niu Yuan-Yuan, Zhao Ming-Yu, Yu Yue-Ming, Li Yan-Tuan, Wu Zhi-Yong, Yan Cui-Wei. Supramolecular self-assembly of amantadine hydrochloride with ferulic acid via dual optimization strategy establishes a precedent of synergistic antiviral drug-phenolic acid nutraceutical cocrystal. Analyst. 2021;146(12):3988–3999. doi: 10.1039/d1an00478f. [DOI] [PubMed] [Google Scholar]
  • 38.Wang L.Y., Zhao M.Y., Bu F.Z., Niu Y.Y., Yu Y.M., Li Y.T., Yan C.W., Wu Z.Y. Cocrystallization of amantadine hydrochloride with resveratrol: the first drug-nutraceutical cocrystal displaying synergistic antiviral activity. Cryst. Growth Des. 2021;21(5):2763–2776. [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplementary data 1
mmc1.docx (13.9MB, docx)

Articles from Bioorganic Chemistry are provided here courtesy of Elsevier

RESOURCES