Skip to main content
Springer Nature - PMC COVID-19 Collection logoLink to Springer Nature - PMC COVID-19 Collection
. 2022 May 27;28(4):110. doi: 10.1007/s10989-022-10413-1

B-Cell Epitope Mapping from Eight Antigens of Candida albicans to Design a Novel Diagnostic Kit: An Immunoinformatics Approach

Farzaneh Vahedi 1, Younes Ghasemi 2,3, Amir Atapour 1, Kamiar Zomorodian 4, Maryam Ranjbar 1, Ahmad Monabati 5, Navid Nezafat 2,3,, Amir Savardashtaki 1,6,
PMCID: PMC9136830  PMID: 35669279

Abstract

Invasive candidiasis is an emerging fungal infection and a leading cause of morbidity in health care facilities. Despite advances in antifungal therapy, increased antifungal drug resistance in Candida albicans has enhanced patient fatality. The most common method for Candida albicans diagnosing is blood culture, which has low sensitivity. Therefore, there is an urgent need to establish a valid diagnostic method. Our study aimed to use the bioinformatics approach to design a diagnostic kit for detecting Candida albicans with high sensitivity and specificity. Eight antigenic proteins of Candida albicans (HYR1, HWP1, ECE1, ALS, EAP1, SAP1, BGL2, and MET6) were selected. Next, a construct containing different immunodominant B-cell epitopes was derived from the antigens and connected using a suitable linker. Different properties of the final construct, such as physicochemical properties, were evaluated. Moreover, the designed construct underwent 3D modeling, reverse translation, and codon optimization. The results confirmed that the designed construct could identify Candida albicans with high sensitivity and specificity in serum samples of patients with invasive candidiasis. However, experimental studies are needed for final confirmation.

Supplementary Information

The online version contains supplementary material available at 10.1007/s10989-022-10413-1.

Keywords: Candida albicans, Epitope mapping, B-cell epitope, Diagnostic kit, Antigens

Introduction

Candida is a significant cause of fungal infections, with Candida albicans responsible for 70–90% of candidiasis infections worldwide (Bhakt et al. 2018; Erwig and Gow 2016). As the natural flora of the human body, Candida albicans is found on different parts of the body, such as mucosal surfaces, skin, mouth, gastrointestinal tract, and genitals (Antinori et al. 2016; León et al. 2014). The pathogenicity of Candida albicans is due to the transformation from single-celled yeast to long multicellular fibers called hyphae. The filamentous form can bind and penetrate the host tissue faster than the single-cell form. Therefore, the production of hyphae indicates the beginning of infection (Nobile et al. 2012; Sachivkina et al. 2020; Tsui et al. 2016). Today, the prevalence of invasive candidiasis as an opportunistic clinical infection is increasing for different reasons (Chen et al. 2020; Lewis and Williams 2017; Thomson et al. 2015). Due to pregnancy and the use of contraceptive estrogens, women are at high risk of fungal infection. Candida albicans have been isolated from vaginal biopsies of 20–50% of asymptomatic women of gestational age (Brown et al. 2019; Gharaghani et al. 2018). Azole antifungal agents such as miconazole, ketoconazole, and fluconazole are effective treatments for Candida albicans infections. Nevertheless, increasing drug resistance has made this treatment problematic. Therefore, the early detection of fungal infections is impressive for treatment, prevention of drugs overuse, and reduction of costs (Thomson et al. 2015).

Various identification methods such as culture on Corn Mill Agar-Tween 80, sugar uptake test by UX 20C API kit, and Germ tube test have been used to identify Candida species (Souza et al. 2015). Though blood culture is the standard method for diagnosing candidiasis, for the low sensitivity of the method (about 50%), positive results appear only in the advanced stages of infection, which significantly impairs the treatment process. Although molecular methods such as Polymerase Chain Reaction (PCR), cell wall, and cytoplasm antigens identification are used to early detect the disease, none of these methods has been widely approved (He et al. 2015). Immunological methods like Immunofluorescence Antibody Test (IFAT), Enzyme-linked Immunoassay (ELISA), and immunoblotting are more sensitive than molecular methods and help assess the host’s immune response (Buonfrate et al. 2015; Levenhagen and Costa-Cruz 2014). Considering the production of recombinant antigens and synthetic peptides that have immunogenic epitope domains, desirable improvement has been achieved in serological methods (Sefidi et al. 2013). Extensive efforts have been made to establish a valid serological test to diagnose invasive candidiasis. Detecting specific antibodies against yeast antigens in patient samples is one of the documented methods (Calandra et al. 2016; Ma et al. 2013). Based on the results of several studies, various proteins from Candida albicans were regarded as antigens. Proteins that stimulate the immune system and produce antibodies are found in two categories. The first group contains proteins that appear specifically in the invasive phase of the disease, such as HYR1, HWP1, ECE1, and ALS. The expression of the second group, including EAP1, SAP1, BGL2, and MET6, increases in the pathogenic stage (Araújo et al. 2017; Laín et al. 2008; Mayer et al. 2013; Wang et al. 2015).

The last decade has witnessed a considerable increase in the processing speed of computers and the storage capacity of information. On the one hand, sequencing the genomes of many prokaryotes, eukaryotes, and many proteins gives new insights into biological data analysis (Bansal 2005). In addition, the design, production, and purification of each of the essential antigens for the diagnosis of infectious diseases are time-consuming, requiring high costs and controlling different processes. Thus, combining these various antigenic proteins as a chimeric protein in a vector can be a valuable way to reduce the time and cost of processing. This study aimed to bioinformatically design and clone the recombinant Candida albicans multi-epitope antigen to diagnose invasive candidiasis using the ELISA system.

Methods

Study Design

The current study was done in three following steps. In the first step, according to the results of Candida albicans proteomic microarray and literature review on Candida albicans antigens, the antigenic proteins of Candida albicans were chosen. Invasive phase-specific proteins, including HWP1, ALS, ECE1, and HYR1, and proteins associated with incremental expressions of the pathogenic stage, such as BGL2, EAP1, MET6, and SAP1, were the select antigens. In the next step, the above-mentioned antigens from different Candida albicans strains were aligned via CLC Genomics Workbench 20 to select the consensus regions. Next, using immunoinformatics servers, the antigenic regions and B cell epitopes of each protein were defined, and then the final epitopes were joined by an appropriate linker. Afterward, the structural analysis of the final construct, such as 3D modeling, physicochemical properties, and validation, was performed. In the ultimate step, the protein sequence was reverse-translated to gene sequence and optimized for expression in the Escherichia coli (E. coli) host.

Sequence Retrieval

The amino acid sequences of BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1, and HYR1 were retrieved from the Protein knowledgebase (UniProtKB) database (www.uniprot.org) in the FASTA format. Also, CLC Genomics Workbench 20 was applied for antigenic protein aligning. The reviewed sequences of ALS protein were aligned to achieve a protected sequence of this protein.

Immunoinformatics Analyses

Antigenicity Prediction

The EMBOSS server 6.6.0.0 (https://www.bioinformatics.nl/cgi-bin/emboss/antigenic) was used to define antigenic regions of the proteins. The performance of this server is based on the Kolaskar and Tongaonkar technique, which forecasts protein antigenic regions using physicochemical properties of amino acid residues. In the present study, initial parameters such as antigenic region with a minimum length of 6 and output report format EMBOSS motif were utilized to establish the antigenic region of the target proteins (Rice et al. 2000).

Prediction of Linear B Cell Epitopes

B cell epitopes considerably affect antibody production. For this purpose, in this study, B cell epitopes were determined using three servers to increase the prediction accuracy. In the beginning, for predicting linear B cell epitopes, ABCpred at (https://webs.iiitd.edu.in/raghava/abcpred/ABC_submission.html) was utilized to predict linear B cell epitopes in the antigenic sequence using an artificial neural network algorithm. In addition, ABCpred is the first server developed according to the recurrent neural network by fixed-length samples with about 65.93% accuracy (Chatterjee et al. 2021; Saha and Raghava 2006).

The BCPRED 2.0 server (https://webs.iiitd.edu.in/raghava/bcepred/bcepred_submission.html) was also applied to predict linear B cell epitopes. This server predicts B cell considering the physicochemical properties, including accessibility, hydrophilicity, polarity, flexibility/mobility, exposed surface, turns, or a combination of these features. Based on different physicochemical properties, the server can predict epitopes with various accuracies from 52.92 to 57.53%. In the case of using flexibility, hydrophilicity, polarity, and surface features simultaneously at a threshold of 2.38, this server can predict epitopes with 58.7% accuracy (Saha and Raghava 2004).

BepiPred-2.0 (http://www.cbs.dtu.dk/services/BepiPred/) is another server that predicts B cell epitopes based on epitope information from solved 3D structures and a wide range of linear epitopes downloaded from the IEDB database. About 50 sequences can be submitted simultaneously, with a length of 10–6000 amino acids. The prediction for each sequence usually takes a few minutes (Jespersen et al. 2017).

Epitopes Antigenicity Prediction

The Vaxijen 2.0 server (freely available online at http://www.jenner.ac.uk/VaxiJen) was used to analyze the antigenicity of each epitope in a multi-epitope protein structure. The VaxiJen v2.0’s threshold value was set at 0.5. The prediction method on this server is alignment-free and based on the protein’s various physicochemical properties.

Epitopes Allergenicity Prediction

The AllerTOP V2.0 server (http://www.ddg-pharmfac.net/AllerTOP) was used to predict the allergenicity of the designed construct’s epitopes. To classify allergens, the server employs methods such as amino acid E-descriptors, auto- and cross-covariance transformation, and k nearest neighbors (kNN) machine learning (Dey et al. 2022).

Multi-epitope Candidate Construction

The B cells epitope candidates, which were selected by relevant servers and got the highest scores, were ligated using a suitable amino acid linker. Eventually, an amino acid structure with multiple epitope characteristics was constructed.

Physicochemical Properties Assessment

The ProtParam tool at the EXPASY server (http://web.expasy.org/protparam/), which is the proteomics server of the Swiss Institute of Bioinformatics, was utilized for calculating different physicochemical features of proteins. The parameters consisted of theoretical pI (isoelectric point), molecular weight (kilodalton), instability index, estimated aliphatic index, and grand average of hydropathicity (GRAVY) (Gasteiger et al. 2005).

Tertiary Structure Prediction of Designed Construct

Galaxy TBM (http://galaxy.seoklab.org/cgi-bin/submit.cgi?type=TBM) was applied to predict the tertiary protein structures. Galaxy TBM performs homology modeling using comparative analysis of the amino acid sequence with those of proteins whose structures are experimentally determined to predict the structure of the regions of proteins that do not have a high degree of homology with other proteins (Ko et al. 2012).

Tertiary Structure Validation

The ProSA-web server (https://prosa.services.came.sbg.ac.at/prosa.php) is one of the servers used for evaluating the 3D structure of the protein. The software mainly revolves around the alpha carbon of amino acid residues to determine the atomic interactions of the protein query. The energy level of the query structure, depicted via a color code system, determines the z-score, which illustrates the quality of the protein structure. Natively folded proteins lie within a defined z-score value, which is used as the reference range with which query proteins are evaluated. The ProSA-web server is accessible elsewhere (Wiederstein and Sippl 2007).

The conformation of proteins is defined by the φ and ψ values, which are the allowable freedom of rotation in Cα-N and Cα-C of peptide bonds, respectively. The allowable torsion angles between atoms are those that do not cause any steric hindrance; thus, the spherical shape and van der Waals radii were meticulously analyzed. The models were categorized into three groups using the above parameters: Favored, allowed, and outlier regions. The plot was generated using PROCHECK online software (https://saves.mbi.ucla.edu/) (Lovell et al. 2003).

The ERRAT online software (http://services.mbi.ucla.edu/ERRAT/) was employed to verify the 3D structure of proteins. The program uses non-covalently bonded atom–atom interactions and determines whether regions of the target proteins are correctly folded or not. Six types of atomic interactions, including C–C, C–N, C–O, N–N, and N–O, are evaluated where C, N, and O denote carbon, nitrogen, and oxygen, respectively. The software posits that the distance between the aforementioned non-bonded interaction should not surpass 3.5 Å, and the covalently bonded atoms within the same polypeptide strand should be excluded from the analysis (Colovos and Yeates 1993).

Molecular Dynamics (MD) Simulations

Understanding macromolecular functioning requires dynamic systems simulations with biologically relevant sizes and time scales. As an alternative to atomistic simulations, coarse-grained representations combined with Normal Mode Analysis (NMA) have been established. Internal Coordinates (IC) can significantly improve the versatility and efficiency of current approaches that are usually based on Cartesian coordinates. The iMODS server (https://imods.iqfr.csic.es/) was employed to explain protein collective motion (López-Blanco et al. 2011). To investigate the motions of proteins using NMA in internal coordinates, one can simply submit the PDB-ID or the atomic coordinates in PDB format.

In Silico Cloning

Codon optimization and back-translation of the final construct were done by the OPTIMIZER server (http://genomes.urv.es/OPTIMIZER/) for the high-level expression of the multi-epitopic protein structure in E. coli. Afterward, the different factors of DNA sequence such as Codon with a Frequency Distribution (CFD), overall GC content, and no negative CIS elements and repeat sequences were evaluated by GenScript Rare Codon Analysis Tool (https://www.genscript.com/tools/rare-codon-analysis). In the next step, the pET-23a+ expression vector was used to simulate in silico cloning of the DNA sequence of the construct.

Results

Sequence Retrieval

The UniprotKB database was used to obtain the amino acid sequences of eight pathogenic Candida albicans proteins. All sequences of MET6, two sequences of BGL2, three sequences of EAP, 17 sequences of SAP1, 24 sequences of HWP1, 44 sequences of ALS, four sequences of ECE1, and 21 sequences of HYR1 were retrieved from UniProtKB (Table 1).

Table 1.

The list of epitope sequence of BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1 and HYR1 proteins obtained from UniprotKB

Name of protein Accession number Length of amino acid (aa)
BGL2 Q5AMT2 308
BGL2 P43070 308
EAP1 G1UBC2 653
EAP1 Q5AP80 785
EAP1 Q5AQ12 176
MET6 P82610 767
SAP1 P0CY27 391
SAP1 P0DJ06 398
SAP1 Q5AC08 418
SAP1 P0CY29 398
SAP1 Q5A8N2 417
SAP1 Q59VH7 588
SAP1 Q5A651 453
SAP1 Q5AEM6 405
SAP1 P0CS83 398
SAP1 C4YMJ3 398
SAP1 C4YSF6 391
SAP1 C4YNQ5 398
SAP1 O42778 405
HWP1 C4YHA6 633
HWP1 Q59PF9 908
HWP1 Q00312 527
HWP1 Q5ABZ2 534
HWP1 Q5AF41 213
HWP1 Q5AF39 113
HWP1 Q59TP1 721
HWP1 Q07730 271
HWP1 Q5A312 527
HWP1 Q5AAF4 1485
HWP1 Q5A220 600
HWP1 Q5AL52 1732
HWP1 Q5AL03 919
HWP1 Q5A0E5 310
HWP1 Q59U10 740
HWP1 P0CY34 512
HWP1 Q5AMQ6 1111
HWP1 Q5A8T4 1260
HWP1 Q59L12 1155
HWP1 Q5A8T7 1347
HWP1 A0A1D8PQ86 1890
HWP1 A0A1D8PQB9 2100
HWP1 P0CU38 2530
ALS Q59L12 1155
ALS Q5A312 1568
ALS Q5A8T7 1347
ALS A0A1D8PQ86 1890
ALS A0A1D8PQB9 2100
ALS Q5A2Z7 1366
ALS Q5A8T4 1260
ALS Q9URQ0 874
ALS P0CU38 2530
ALS O13368 1419
ALS O74660 875
ALS O74623 1119
ALS P46590 1260
ALS Q59U10 740
ALS Q9P940 248
ALS Q5APJ9 219
ALS P46593 634
ALS Q5A0E5 310
ALS O74189 877
ALS Q5AMQ6 1111
ALS Q5A220 600
ECE1 Q07730 271
ECE1 P46593 634
ECE1 Q5A0E5 310
ECE1 Q5AMQ6 1111
ECE1 Q5A220 600
ECE1 Q8X3T7 29
HYR1 Q5AL03 919
HYR1 Q59U10 740
HYR1 P87020 299
HYR1 Q59XX2 378
HYR1 P46593 634
HYR1 Q5A0E5 310
HYR1 Q5AMQ6 1111
HYR1 Q5A220 600
HYR1 Q5APU2 597
HYR1 Q59XA7 1249
HYR1 Q5A849 1225
HYR1 Q59XL0 1085
HYR1 Q5AAL9 1526
HYR1 Q5A7R7 511
HYR1 P46591 937
HYR1 Q59XB0 714
HYR1 Q5A1E0 1308
HYR1 Q5A5M7 1562
HYR1 Q5A6U1 941
HYR1 Q5A029 941
HYR1 Q59L86 872

Immunoinformatics Analyses

Antigenicity Prediction

The EMBOSS server was used to detect the antigenic sequence with the highest score for antigenicity. Approximately 13 antigenic regions of BGL2 protein, 27 antigenic regions of EAP1 protein, 32 antigenic regions of MET6 protein, 18 antigenic regions of SAP1 protein, 25 antigenic regions of HWP1 protein, 23 antigenic regions of ALS protein, 13 antigenic regions of ECE1 protein, and 32 antigenic regions of HYR1 protein were identified. All the results obtained from this server were found in Supplementary Tables (S1a–h).

Determining Linear B Cell Epitopes

The ABCpred, BCPRED, and BepiPred servers were used to detect linear B-cell epitopes from all eight proteins based on their amino acid sequences. The number of linear epitopes and their scores are listed in Table 2.

Table 2.

Linear B cells epitopes analysis of BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1 and HYR1 proteins by ABCpred, BCPRED and BepiPred servers

Protein Server Number of linear B cell epitopes Maximum score
BGL2 ABCpred 29 0.91
BGL2 BCPRED 6 0.999
BGL2 BepiPred 11 0.66
EAP1 ABCpred 84 0.95
EAP1 BCPRED 26 1
EAP1 BepiPred 1 0.66
MET6 ABCpred 78 0.97
MET6 BCPRED 10 0.999
MET6 BepiPred 28 0.67
SAP1 ABCpred 33 0.94
SAP1 BCPRED 7 0.997
SAP1 BepiPred 11 0.7
HWP1 ABCpred 65 0.97
HWP1 BCPRED 26 1
HWP1 BepiPred 1 0.71
ALS ABCpred 62 0.95
ALS BCPRED 19 1
ALS BepiPred 15 0.65
ECE1 ABCpred 24 0.90
ECE1 BCPRED 3 1
ECE1 BepiPred 7 0.65
HYR1 ABCpred 92 0.92
HYR1 BCPRED 27 1
HYR1 BepiPred 8 0.7

The shared sequences predicted by the two mentioned servers were selected by Microsoft Excel software, and the best immunogenic epitopes were chosen. The finally selected regions of BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1, and HYR1 proteins are presented in Table 3.

Table 3.

The final selected B cell epitopes regions of BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1 and HYR1 proteins

Protein Start–end position Sequence Length of sequence
BGL2 276–306 WKPDTSGTSSVEKHWGVWQSDKTLKYSIDCK 31
EAP1 91–114 STSYTTDTAYTTTVITVTKCDGGS 24
MET6 77–110 NAIPERYTKFDLAPIDVLFAMGRGLQKKATETQA 34
SAP1 22–53 KRSPGFVTLDFDVIKTPVNATGQEGKVKRQAI 32
HWP1 376–408 TTVITVTSCSESSCTESEVTTGVVVVTSEETVY 33
ALS 313–354 TGYRNSDAGSNGIVIVATTRTVTDSTTAVTTLPFDPNRDKTK 42
ECE1 79–103 QIIMSIVKAFKGNKREDIDSVVAGII 25
HYR1 831–863 ANPVTTSTESDTTISVTVSITSYMTGFDGKPKP 33

Antigenicity and Allergenicity of Designed Construct’s Epitopes

The antigenicity of each epitope was estimated separately using the VaxiJen 2.0 server and a fungal model. Epitopes were identified as antigens or potential antigens based on the findings. The scores obtained from the VaxiJen 2.0 server are as follows: BGL2 is 1.35, EAP1 is 1.26, MET6 is 0.5, SAP1 is 0.76, HWP1 is 0.96, ALS is 0.93, ECE1 is 0.56, and HYR1 is 1.67. Allergenicity prediction by the AllerTOP server showed that all epitopes in the designed structure were non-allergenic.

Assembling Epitopes

The select B cell epitopes of BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1, and HYR1 proteins, displayed in Table 3, were connected using an EAAAK linker. Linkers are short peptides to connect different protein domains. Building a multi-epitope diagnostic kit without a proper linker can exacerbate protein folding issues. The EAAAK rigid linker was used to assemble the designed diagnostic kit. The EAAAK linker not only maintains proper spacing between epitopes and fragments of the designed vaccine but also eliminates unwanted interactions. Also, a 6xHis tag was added to the C-terminus to facilitate the purification process of multi-epitope protein structures (Fig. 1).

Fig. 1.

Fig. 1

Schematic diagram of assembled multi-epitope structure. B cell epitopes were selected from antigenic proteins (BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1 and HYR1). Using EMBOSS, BepiPred, ABCpred, and BCPRED servers. The selected sequences were connected to each other the utilization EAAAK linkers. as well as, a 6xHis tag was added to the C-terminus for ease of purification

Assessment of Physicochemical Properties

Different physicochemical properties of the designed multi-epitope construct were determined via the ProtParam server. The construct’s number of amino acids and molecular weight (MW) were 255 and 27.3 kDa, respectively. The theoretical pI of the construct to indicate the basic condition of the protein was 6.80. The estimated half-life was 2.8 h in mammalian reticulocytes, 3 min in yeast, and 2 min in E. coli. The aliphatic index was 71.37, and the grand average of hydropathicity (GRAVY) was − 0.289, which showed that the protein was hydrophobic and could better interact with neighboring water molecules. The instability index was computed as 32.48, which classified the protein as stable.

Tertiary Structure Modeling

The 3D model of the structure was predicted by the GalaxyTBM server, resulting in five initial models (Fig. 2a–e).

Fig. 2.

Fig. 2

In order to predict the third structure of the designed multi-epitope structure, GalaxyTBM server was used. As a result, five different models of designed multi-epitope protein by GalaxyTBM server, a model 1, b model 2, c model 3, d model 4, e model 5

Tertiary Structure Validation

The ERRAT (Fig. 3a–e), ProSA-web (Fig. 4a–e), and Ramachandran plot servers (Fig. 5a–e) were used to evaluate the quality of the predicted models to select the best model. The ProSA-web server shows the overall quality score of protein (z-score) obtained by comparing the 3D model of the target protein with similar proteins of the same size deposited in PDB. The validation results of the five modeled structures by the ERRAT, ProSA-Web and Ramachandran servers are presented in Table 4. After comparing all the obtained results from the servers mentioned above, model 4 was selected as the best structure. In this model, the ERRAT quality and ProSA z-score were 78.59 and − 3.33, respectively (Table 4). Moreover, the Ramachandran plot showed that 86.6%, 11.5%, and 1.5% of the amino acid residues were located in the favored region, allowed region, and generously allowed regions, respectively.

Fig. 3.

Fig. 3

The 3D structure validation results of multi-epitopic protein construct with ERRAT plot. The overall quality factor obtained from the ERRAT server for the proposed models are as follows: a Model 1(78.4), b Model 2 (75.3), c Model 3 (78.6), d Model 4 (77) and e Model 5 (76.5)

Fig. 4.

Fig. 4

ProSA-Web z-score, indicate the validation of protein 3D models. The ProSA Z-score, based on X-ray crystallography and NMR spectroscopy, of Models a 1, b 2, c 3, d 4, e 5, are − 3.33, − 3.23, − 2.9, − 2.96, and − 3.4, respectively

Fig. 5.

Fig. 5

The PROCHECK’s Ramachandran plot validate the 3D models of selected multi-epitopic construct. Favoured regions in models was shown; a model 1 (87.0%), b model 2 (87.4%), c model 3 (86.6%), d models 4 (85.9%), e model 5 (86.3%)

Table 4.

The ERRAT, ProSA-Web AND Ramachandran plot servers analysis

Models Ramachandran plot results ERRAT overall quality factor ProSA-Web (z-scores)
Model 1 Favoured regions: 87.0% 78.4 − 3.33
Allowed regions: 11.1%
Generously allowed regions: 3 1.1%
Disallowed regions: 0.8%
Model 2 Favoured regions: 87.4% 75.3 − 3.23
Allowed regions: 10.03%
Generously allowed regions: 1.5%
Disallowed regions: 0.8%
Model 3 Favoured regions: 86.6% 78.6 − 2.9
Allowed regions: 11.5%
Generously allowed regions: 1.5%
Disallowed regions: 0.4%
Model 4 Favoured regions: 85.9% 77 − 2.96
Allowed regions: 11.8%
Generously allowed regions: 1.5%
Disallowed regions: 0.8%
Model 5 Favoured regions: 86.3% 76.5 − 3.4
Allowed regions: 11.5%
Generously allowed regions: 1.5%
Disallowed regions: 0.8%

Molecular Dynamics (MD) Simulations

Understanding the macromolecular function of the protein complex was performed using the internal coordinates of the iMODS server (Fig. 6a). The complex’s eigenvalue was 2.744204e40 (Fig. 6b). Arrows indicated the direction of each residue in the 3D model, and the length of the line represented the extent of mobility. The B-factor values derived from normal mode analysis were comparable to RMS (Fig. 6c). Hinges in the chain indicated the complex’s probable deformability as measured by the contortion of each individual residue (Fig. 6d). Each normal mode’s variance was inversely related to its eigenvalue. The covariance matrix explained the link between pairs of residues by representing correlated, uncorrelated, or anti-correlated motions with red, white, and blue colors, respectively (Fig. 6e). As a result, an elastic network model (Fig. 6f) was generated, which identified the pairs of atoms connected by springs. Each dot in the diagram represented one spring between the corresponding pair of atoms and was colored according to its stiffness.

Fig. 6.

Fig. 6

Molecular dynamics simulation of multi-epitope diagnostic kit; stability of the protein complex was a investigated through mobility, b eigenvalue, c B-factor, d deformability, e covariance and f elastic network analysis

In Silico Cloning of the Final Construct

The OPTIMIZER online server was used for back-translation and codon optimization of the multi-epitope construct for this study. The gene sequence’s CAI, CFD, and GC content were 0.88, 0%, and 53.3%, respectively (Fig. 7a–c). A CAI of > 0.8 is considered good for expression in a selected host. The optimal percentage range of GC content is between 30 and 70%. Codons with a frequency distribution (CFD) < 30% are likely to impede transcriptional and translational efficiency. All the above-mentioned factors of our sequence were in the ideal range. This indicated that the final multi-epitope construct with optimized sequence would be efficiently expressed in E. coli. Next, an optimized nucleotide sequence was cloned into the pET-23a+ expression vector. For this purpose, NdeI and XhoI restriction sites were added to the N and C-terminals of the sequence, respectively (Fig. 8).

Fig. 7.

Fig. 7

Designed structural analysis to express high levels of multi-epitope protein in E. coli host. a Codon frequency distribution (CFD) value of gene sequence is 91–100, 81–90, 71–80, 61–70, 51–60 in the gene is 61%, 7%, 10%, 13%, and 5%, respectively. b The average GC content of our sequence is 53.3%. c CAI of gene sequence is 0.88; a CAI of 40.8 is considered as good for expression in selected host

Fig. 8.

Fig. 8

Schematic representation of cloning process. The gene sequence of multi-epitope protein with the name of Vahedi opt, and the length of 882 nucleotides shown in the designed structure. The Vahedi opt gene sequence in the Vahedi cloned structure is distinct between the NdeI and XhoI cleavage sites

Discussion

The occurrence of invasive candidiasis was increased by 50% globally over the past decade, varying from 2.4 per 100,000 to 15 per 100,000, according to the clinical and national conditions. Despite considerable advances in antifungal remedies, candidiasis spreads with high mortality (40–60%). The timely use of appropriate antifungal agents is necessary to increase survival. However, yeast blood cultures are much less available and require long-term (24 h or longer) incubation (Poissy et al. 2020). ELISA and concomitant immunological methods are used in most detection approaches due to desirable features such as high sensitivity, convenience, and relatively low cost (Khatami et al. 2020b). Recombinant antigenic proteins are the best options for detecting antibodies against invasive Candida antigenic proteins in the blood. Also, as an efficient serological diagnostic method, ELISA is one of the most effective procedures for detecting antibodies in invasive candidiasis. Using the complete sequence of an antigen to detect antibodies can cause nonspecific binding to the target antibody due to the similarity and overlap with similar sequences of other living antigenic proteins. In general, this method reduces the degree of specificity (Dey et al. 2021; Laín et al. 2007b). Each antigen’s design, production, and purification in diagnosing infectious diseases are time-consuming, requiring high costs and controlling different processes. Thus, a combination of different antigenic proteins as a chimeric protein can be a valuable way to reduce the time and cost of the process. In recent years, bioinformatics knowledge has increased in various scientific fields, e.g., the production of recombinant products and proteins (Khatami et al. 2020a; Mahapatra et al. 2020; Sabetian et al. 2019; Shahbazi et al. 2016; Tehrani et al. 2020; Zarei et al. 2019). The present study used various bioinformatics strategies to design the Candida albicans diagnostic kit based on linear B cell epitopes of BGL2, EAP1, MET6, SAP1, HWP1 ALS, ECE1, and HYR1 antigens. Zheng et al. conducted serological assays for rapid diagnosis of invasive candidiasis. In this regard, recombinant BGL2 protein of Candida albicans cell wall was produced, and an indirect ELISA method was developed to detect IgG antibodies. The sensitivity, specificity, positivity, and negative predictive values were 80.8%, 90.0%, 89.4%, and 81.8%, respectively for anti-BGL2 detection. The results showed that recombinant BGL2 antigen from Candida albicans reacted to the sera of proven IC patients infected with Candida albicans (He et al. 2015). The EAP1 protein, expressed by the EAP1 gene, binds to glycosylphosphatidylinositol in the Candida albicans cell wall. The EAP1 protein is involved in surface adhesion. Different studies have shown that mutations in this protein reduce Candida albicans adhesion to epithelial cells, indicating the importance of this protein in the binding of yeast cells. The EAP1 protein is also effective in forming and developing Candida albicans biofilms (Li et al. 2007). Recently, it was discovered that EAP1 plays a role in macrophage regulation and lymphocyte activation. Furthermore, EAP1 suppressed CD69 expression, implying that EAP1 is involved in CD4T-cell activation (Ramalho‐Oliveira et al. 2019). Secreted Aspartic Proteinases (SAPs) are a group of hydrolytic enzymes secreted by Candida albicans to penetrate host cell membranes. There is an unequal tendency for SAPs proteins to penetrate various cell types. Therefore, in different stages of yeast infection, they could be expressed and secreted into both intracellular and extracellular environments. In this regard, the SAP1 protein is mainly observed in vaginal infections caused by Candida albicans (Oliver et al. 2019; Singh et al. 2019). According to studies, the increase in Th1/Th2/Th17 cytokine levels observed in SAP2-vaccinated mice indicates that SAP2 has immunomodulatory properties. SAP2 immunization also significantly increases total CD45+ leukocytes in the spleen, preventing a significant decrease in their number following fungal infection. Furthermore, SAP2 immunization increases plasma cell counts and the proportion of fungal-binding B cells in the spleens of immunized mice (Shukla and Rohatgi 2020). Leighann et al. showed that using a defined panel of genes during the initial growth of biofilm may be very significant for diagnosing Candida albicans. Panels of genes such as SAP, HWP1, and EAP1 are examined sequentially to identify different biomarkers for diagnosing invasive candidiasis in immunocompromised patients (Sherry et al. 2014). Methionine synthase (MET6) is a protein with an essential role in methionine biosynthesis during Candida albicans morphogenesis (Sáez-Rosón et al. 2014). Patients with disseminated candidiasis have a better prognosis when MET6-specific IgG serum antibodies are produced (Adams et al. 2021). Hyphal Wall Protein 1 (HWP1) facilitates Candida albicans attachment to host epithelial cells. In addition, HWP1 encodes a principal protein of Candida albicans that is involved in cell wall proliferation and intracellular signaling (Orsi et al. 2014). Agglutinin-Like Sequence (ALS) proteins are important proteins in the Candida albicans cell wall, which encode large cell surface glycoproteins and play a key role in adhesion to different surfaces (Lombardi et al. 2019). Generally, a valid diagnostic method is used to detect antibodies against ALS, HWP1, and MET6 Candida albicans proteins. The results obtained by ELISA showed that the sensitivity to detect the desired antibodies is more than 66%. Also, in immunocompromised patients, anti-MET6 antibodies were named the best biomarkers (Díez et al. 2021). ECEIp is a large protein with 271 aa that is processed in the Endoplasmic Reticulum (ER) and the Golgi complex. Candidalysin toxin is also derived from the Ece1p protein (Richardson et al. 2018). Antifungal drugs have been shown to eliminate various components of fungi required for their virulence. They also influence the expression of genes involved in hyphae growth, such as Hwpl and Ecel, in the epithelium. As a result, Hwpl reduced IL-8 production, inhibited aspartyl proteinase expression, and reduced the inflammatory response (Rodríguez-Cerdeira et al. 2020). A Hyphally Regulated Gene (HYR1) is expressed specifically during hyphal development. Hyr1p contributes to Candida albicans virulence by resisting phagocyte killing (a major host defense mechanism against candidiasis) via an unknown mechanism. (Uppuluri et al. 2018). Numerous studies have investigated the recombinant Candida albicans antigens for their potential use in diagnosing invasive candidiasis. In this context, SAP, HWP1, HYR1, ECE1, and ALS proteins as Candida albicans recombinant antigens have been tested for serodiagnosis of invasive candidiasis (Laín et al. 2007a, 2008).

In the current study, the proteins sequences were obtained from the UniProt databases at www.uniprot.org. Prediction of B cell epitopes plays a vital role in developing diagnostic kits based on multi-epitope proteins. Due to the subject’s significance, three different servers were used to identify the linear 16-mer B cell epitopes regions. The final epitopes were selected and then connected by the EAAAK linker. Selecting a suitable linker is crucial for the appropriate binding of protein fragments in a multi-epitope structure. The linkers are responsible for connecting protein segments and have an essential role in maintaining the biological activity and increasing the expression of the structure (Chen et al. 2013; Li et al. 2016; Mahapatra et al. 2021). The EAAAK (Glu–Ala–Ala–Ala–Lys) sequence is a tough and helix-forming linker. Lee et al. conducted a study to enhance the antibacterial activity of an attacin-coleoptericin hybrid protein fused with a linker. They used helical (Glu–Ala–Ala–Ala–Lys) and non-helical linkers (Gly–Gly–Gly–Gly–Ser) to compare them in binding the two antimicrobial proteins. The results showed that the fused proteins with the EAAAK linker had more antibacterial properties (Lee et al. 2013). Our study selected and ligated antigenic regions of different proteins using linkers. The three-dimensional structures of the proteins were modeled and evaluated by several servers. In this way, the Galaxy-TBM server developed five models for the desired structure. Then, the obtained models were evaluated by the ERRAT, ProSA-Web, and Ramachandran plot servers, and finally, model 4 was selected.

Conclusion

In this present study, to provide a diagnostic kit for Candida albicans, we used immunodominant linear B cell epitopes from eight pathogenic Candida albicans antigens (BGL2, EAP1, MET6, SAP1, HWP1, ALS, ECE1, and HYR1) to model and design a multi-epitope protein using suitable linkers. The structural and physicochemical evaluations of the designed protein construct showed that our recombinant protein was thermostable, hydrophilic, and basic. Finally, it was found that the designed chimeric protein could be significantly expressed in E. coli. The multi-epitope-designed protein can be used to construct a high-performance serological test for the diagnosis of candidiasis infections.

Supplementary Information

Below is the link to the electronic supplementary material.

Acknowledgements

We are grateful to all members of Department of Medical biotechnology at Shiraz University of Medical Sciences for technical assistance on this work.

Funding

This manuscript was extracted from the PhD thesis of Farzaneh Vahedi and was supported by Shiraz University of Medical Sciences, Shiraz, Iran.

Data Availability

All data generated or analysed during this study are included in this published article, and its supplementary information files.

Declarations

Conflict of interest

All the authors declare that they have none conflict of interest.

Research Involving Human and/or Animal Participants

This article does not contain any studies with human participants or animals performed by any of the authors.

Footnotes

Publisher's Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Contributor Information

Navid Nezafat, Email: n.nezafat@srbiau.ac.ir.

Amir Savardashtaki, Email: Dashtaki63@gmail.com.

References

  1. Adams AL, Eberle K, Colón JR, Courville E, Xin H. Synthetic conjugate peptide Fba-Met6 (MP12) induces complement-mediated resistance against disseminated Candida albicans. Vaccine. 2021;39:4099–4107. doi: 10.1016/j.vaccine.2021.06.001. [DOI] [PubMed] [Google Scholar]
  2. Antinori S, Milazzo L, Sollima S, Galli M, Corbellino M. Candidemia and invasive candidiasis in adults: a narrative review. Eur J Intern Med. 2016;34:21–28. doi: 10.1016/j.ejim.2016.06.029. [DOI] [PubMed] [Google Scholar]
  3. Araújo D, Henriques M, Silva S. Portrait of Candida species biofilm regulatory network genes. Trends Microbiol. 2017;25:62–75. doi: 10.1016/j.tim.2016.09.004. [DOI] [PubMed] [Google Scholar]
  4. Bansal AK. Bioinformatics in microbial biotechnology—a mini review. Microb Cell Fact. 2005;4:1–11. doi: 10.1186/1475-2859-4-19. [DOI] [PMC free article] [PubMed] [Google Scholar]
  5. Bhakt P, Battu A, Kaur R. Candida: friend and foe of humans. In: Singh PP, editor. Infectious diseases and your health. Singapore: Springer; 2018. pp. 403–418. [Google Scholar]
  6. Brown SE, et al. The vaginal microbiota and behavioral factors associated with genital Candida albicans detection in reproductive-age women. Sex Transm Dis. 2019;46:753. doi: 10.1097/OLQ.0000000000001066. [DOI] [PMC free article] [PubMed] [Google Scholar]
  7. Buonfrate D, Formenti F, Perandin F, Bisoffi Z. Novel approaches to the diagnosis of Strongyloides stercoralis infection. Clin Microbiol Infect. 2015;21:543–552. doi: 10.1016/j.cmi.2015.04.001. [DOI] [PubMed] [Google Scholar]
  8. Calandra T, Roberts JA, Antonelli M, Bassetti M, Vincent J-L. Diagnosis and management of invasive candidiasis in the ICU: an updated approach to an old enemy. Crit Care. 2016;20:1–6. doi: 10.1186/s13054-016-1313-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  9. Chatterjee R, et al. Development of a conserved chimeric vaccine for induction of strong immune response against Staphylococcus aureus using immunoinformatics approaches. Vaccines. 2021;9:1038. doi: 10.3390/vaccines9091038. [DOI] [PMC free article] [PubMed] [Google Scholar]
  10. Chen X, Zaro JL, Shen W-C. Fusion protein linkers: property, design and functionality. Adv Drug Deliv Rev. 2013;65:1357–1369. doi: 10.1016/j.addr.2012.09.039. [DOI] [PMC free article] [PubMed] [Google Scholar]
  11. Chen H, Zhou X, Ren B, Cheng L. The regulation of hyphae growth in Candida albicans. Virulence. 2020;11:337–348. doi: 10.1080/21505594.2020.1748930. [DOI] [PMC free article] [PubMed] [Google Scholar]
  12. Colovos C, Yeates TO. Verification of protein structures: patterns of nonbonded atomic interactions. Protein Sci. 1993;2:1511–1519. doi: 10.1002/pro.5560020916. [DOI] [PMC free article] [PubMed] [Google Scholar]
  13. Dey J, Mahapatra SR, Singh P, Patro S, Kushwaha GS, Misra N, Suar M. B and T cell epitope-based peptides predicted from clumping factor protein of Staphylococcus aureus as vaccine targets. Microb Pathog. 2021;160:105171. doi: 10.1016/j.micpath.2021.105171. [DOI] [PubMed] [Google Scholar]
  14. Dey J, Mahapatra SR, Lata S, Patro S, Misra N, Suar M. Exploring Klebsiella pneumoniae capsule polysaccharide proteins to design multiepitope subunit vaccine to fight against pneumonia. Expert Rev Vaccines. 2022 doi: 10.1080/14760584.2022.2021882. [DOI] [PubMed] [Google Scholar]
  15. Díez A, Carrano G, Bregón-Villahoz M, Cuétara M-S, García-Ruiz JC, Fernandez-de-Larrinoa I, Moragues M-D. Biomarkers for the diagnosis of invasive candidiasis in immunocompetent and immunocompromised patients. Diagn Microbiol Infect Dis. 2021;101:115509. doi: 10.1016/j.diagmicrobio.2021.115509. [DOI] [PubMed] [Google Scholar]
  16. Erwig LP, Gow NA. Interactions of fungal pathogens with phagocytes. Nat Rev Microbiol. 2016;14:163–176. doi: 10.1038/nrmicro.2015.21. [DOI] [PubMed] [Google Scholar]
  17. Gasteiger E, Hoogland C, Gattiker A, Wilkins MR, Appel RD, Bairoch A. Protein identification and analysis tools on the ExPASy server. In: Walker JM, editor. The proteomics protocols handbook. Totowa: Humana Press; 2005. pp. 571–607. [Google Scholar]
  18. Gharaghani M, et al. Identification of Candida species isolated from vulvovaginal candidiasis patients by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) in Yasuj southwestern Iran. Jundishapur J Microbiology. 2018;11(8):e65359. doi: 10.5812/jjm.65359. [DOI] [Google Scholar]
  19. He Z, Chen J, Li W, Cheng Y, Zhang H-p, Zhang L-n, Hou T-w. Serological response and diagnostic value of recombinant candida cell wall protein enolase, phosphoglycerate kinase, and β-glucosidase. Front Microbiol. 2015;6:920. doi: 10.3389/fmicb.2015.00920. [DOI] [PMC free article] [PubMed] [Google Scholar]
  20. Jespersen MC, Peters B, Nielsen M, Marcatili P. BepiPred-2.0: improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res. 2017;45:W24–W29. doi: 10.1093/nar/gkx346. [DOI] [PMC free article] [PubMed] [Google Scholar]
  21. Khatami SH, Taheri-Anganeh M, Arianfar F, Savardashtaki A, Sarkari B, Ghasemi Y, Mostafavi-Pour Z. Analyzing signal peptides for secretory production of recombinant diagnostic antigen B8/1 from Echinococcus granulosus: an in silico approach. Mol Biol Res Commun. 2020;9:1. doi: 10.22099/mbrc.2019.35429.1457. [DOI] [PMC free article] [PubMed] [Google Scholar]
  22. Khatami SH, Taheri-Anganeh M, Movahedpour A, Savardashtaki A, Ramezani A, Sarkari B, Mostafavi-Pour Z. Serodiagnosis of human cystic echinococcosis based on recombinant antigens B8/1 and B8/2 of Echinococcus granulosus. J Immunoass Immunochem. 2020;41:1010–1020. doi: 10.1080/15321819.2020.1807359. [DOI] [PubMed] [Google Scholar]
  23. Ko J, Park H, Seok C. GalaxyTBM: template-based modeling by building a reliable core and refining unreliable local regions. BMC Bioinform. 2012;13:1–8. doi: 10.1186/1471-2105-13-198. [DOI] [PMC free article] [PubMed] [Google Scholar]
  24. Laín A, Elguezabal N, Brena S, García-Ruiz JC, Del Palacio A, Moragues MD, Pontón J. Diagnosis of invasive candidiasis by enzyme-linked immunosorbent assay using the N-terminal fragment of Candida albicans hyphal wall protein 1. BMC Microbiol. 2007;7:1–11. doi: 10.1186/1471-2180-7-35. [DOI] [PMC free article] [PubMed] [Google Scholar]
  25. Laín A, Moragues MD, Ruiz JCG, Mendoza J, Camacho A, Del Palacio A, Pontón J. Evaluation of a novel enzyme-linked immunosorbent assay to detect immunoglobulin G antibody to enolase for serodiagnosis of invasive candidiasis. Clin Vaccine Immunol. 2007;14:318–319. doi: 10.1128/CVI.00396-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  26. Laín A, Elguezabal N, Amutio E, Fernández de Larrinoa I, Moragues MD, Pontón J. Use of recombinant antigens for the diagnosis of invasive candidiasis. Clin Dev Immunol. 2008 doi: 10.1155/2008/721950. [DOI] [PMC free article] [PubMed] [Google Scholar]
  27. Lee M, Bang K, Kwon H, Cho S. Enhanced antibacterial activity of an attacin-coleoptericin hybrid protein fused with a helical linker. Mol Biol Rep. 2013;40:3953–3960. doi: 10.1007/s11033-012-2472-4. [DOI] [PubMed] [Google Scholar]
  28. León C, Ostrosky-Zeichner L, Schuster M. What’s new in the clinical and diagnostic management of invasive candidiasis in critically ill patients. Intensive Care Med. 2014;40:808–819. doi: 10.1007/s00134-014-3281-0. [DOI] [PubMed] [Google Scholar]
  29. Levenhagen MA, Costa-Cruz JM. Update on immunologic and molecular diagnosis of human strongyloidiasis. Acta Trop. 2014;135:33–43. doi: 10.1016/j.actatropica.2014.03.015. [DOI] [PubMed] [Google Scholar]
  30. Lewis M, Williams D. Diagnosis and management of oral candidosis. Br Dent J. 2017;223:675–681. doi: 10.1038/sj.bdj.2017.886. [DOI] [PubMed] [Google Scholar]
  31. Li F, et al. Eap1p, an adhesin that mediates Candida albicans biofilm formation in vitro and in vivo. Eukaryot Cell. 2007;6:931–939. doi: 10.1128/EC.00049-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  32. Li G, et al. Construction of a linker library with widely controllable flexibility for fusion protein design. Appl Microbiol Biotechnol. 2016;100:215–225. doi: 10.1007/s00253-015-6985-3. [DOI] [PubMed] [Google Scholar]
  33. Lombardi L, Zoppo M, Rizzato C, Bottai D, Hernandez AG, Hoyer LL, Tavanti A. Characterization of the Candida orthopsilosis agglutinin-like sequence (ALS) genes. PLoS ONE. 2019;14:e0215912. doi: 10.1371/journal.pone.0215912. [DOI] [PMC free article] [PubMed] [Google Scholar]
  34. Lopéz-Blanco JR, Garzón JI, Chacón P. iMod: multipurpose normal mode analysis in internal coordinates. Bioinformatics. 2011;27:2843–2850. doi: 10.1093/bioinformatics/btr497. [DOI] [PubMed] [Google Scholar]
  35. Lovell SC, et al. Structure validation by Cα geometry: ϕ, ψ and Cβ deviation. Proteins. 2003;50:437–450. doi: 10.1002/prot.10286. [DOI] [PubMed] [Google Scholar]
  36. Ma C-f, Li F-q, Shi L-n, Hu Y-a, Wang Y, Huang M, Kong Q-q. Surveillance study of species distribution, antifungal susceptibility and mortality of nosocomial candidemia in a tertiary care hospital in China. BMC Infect Dis. 2013;13:1–9. doi: 10.1186/1471-2334-13-337. [DOI] [PMC free article] [PubMed] [Google Scholar]
  37. Mahapatra SR, Sahoo S, Dehury B, Raina V, Patro S, Misra N, Suar M. Designing an efficient multi-epitope vaccine displaying interactions with diverse HLA molecules for an efficient humoral and cellular immune response to prevent COVID-19 infection. Expert Rev Vaccines. 2020;19:871–885. doi: 10.1080/14760584.2020.1811091. [DOI] [PMC free article] [PubMed] [Google Scholar]
  38. Mahapatra SR, et al. Immunoinformatic approach employing modeling and simulation to design a novel vaccine construct targeting MDR efflux pumps to confer wide protection against typhoidal Salmonella serovars. J Biomol Struct Dyn. 2021 doi: 10.1080/07391102.2021.1964600. [DOI] [PubMed] [Google Scholar]
  39. Mayer FL, Wilson D, Hube B. Candida albicans pathogenicity mechanisms. Virulence. 2013;4:119–128. doi: 10.4161/viru.22913. [DOI] [PMC free article] [PubMed] [Google Scholar]
  40. Nobile CJ, et al. A recently evolved transcriptional network controls biofilm development in Candida albicans. Cell. 2012;148:126–138. doi: 10.1016/j.cell.2011.10.048. [DOI] [PMC free article] [PubMed] [Google Scholar]
  41. Oliver JC, Ferreira CBRJ, Silva NC, Dias ALT. Candida spp. and phagocytosis: multiples evasion mechanisms. Antonie van Leeuwenhoek. 2019;112(10):1409–23. doi: 10.1007/s10482-019-01271-x. [DOI] [PubMed] [Google Scholar]
  42. Orsi CF, et al. Impact of Candida albicans hyphal wall protein 1 (HWP1) genotype on biofilm production and fungal susceptibility to microglial cells. Microb Pathog. 2014;69:20–27. doi: 10.1016/j.micpath.2014.03.003. [DOI] [PubMed] [Google Scholar]
  43. Poissy J, et al. Risk factors for candidemia: a prospective matched case-control study. Crit Care. 2020;24:1–11. doi: 10.1186/s13054-020-2766-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  44. Ramalho-Oliveira R, Oliveira-Vieira B, Viola JP. IRF2BP2: a new player in the regulation of cell homeostasis. J Leukoc Biol. 2019;106:717–723. doi: 10.1002/JLB.MR1218-507R. [DOI] [PubMed] [Google Scholar]
  45. Rice P, Longden I, Bleasby A. EMBOSS: the European molecular biology open software suite. Trends Genet. 2000;16:276–277. doi: 10.1016/S0168-9525(00)02024-2. [DOI] [PubMed] [Google Scholar]
  46. Richardson JP, et al. Processing of Candida albicans Ece1p is critical for candidalysin maturation and fungal virulence. mBio. 2018 doi: 10.1128/mBio.02178-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  47. Rodríguez-Cerdeira C, et al. Pathogenesis and clinical relevance of Candida biofilms in vulvovaginal candidiasis. Front Microbiol. 2020;11:2884. doi: 10.3389/fmicb.2020.544480. [DOI] [PMC free article] [PubMed] [Google Scholar]
  48. Sabetian S, Nezafat N, Dorosti H, Zarei M, Ghasemi Y. Exploring dengue proteome to design an effective epitope-based vaccine against dengue virus. J Biomol Struct Dyn. 2019;37:2546–2563. doi: 10.1080/07391102.2018.1491890. [DOI] [PubMed] [Google Scholar]
  49. Sachivkina N, Lenchenko E, Blumenkrants D, Ibragimova A, Bazarkina O. Effects of farnesol and lyticase on the formation of Candida albicans biofilm. Vet World. 2020;13:1030. doi: 10.14202/vetworld.2020.1030-1036. [DOI] [PMC free article] [PubMed] [Google Scholar]
  50. Sáez-Rosón A, Sevilla M-J, Moragues M-D. Identification of superficial Candida albicans germ tube antigens in a rabbit model of disseminated candidiasis. A proteomic approach. Int Microbiol. 2014;17:21–29. doi: 10.2436/20.1501.01.204. [DOI] [PubMed] [Google Scholar]
  51. Saha S, Raghava GPS. International conference on artificial immune systems. Berlin: Springer; 2004. BcePred: prediction of continuous B-cell epitopes in antigenic sequences using physico-chemical properties; pp. 197–204. [Google Scholar]
  52. Saha S, Raghava GPS. Prediction of continuous B-cell epitopes in an antigen using recurrent neural network. Proteins. 2006;65:40–48. doi: 10.1002/prot.21078. [DOI] [PubMed] [Google Scholar]
  53. Sefidi FJ, Keyvani H, Monavari SH, Alavian SM, Fakhim S, Bokharaei-Salim F. Distribution of hepatitis C virus genotypes in Iranian chronic infected patients. Hepat Mon. 2013;13:e7991. doi: 10.5812/hepatmon.7991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  54. Shahbazi M, Haghkhah M, Rahbar MR, Nezafat N, Ghasemi Y. In silico sub-unit hexavalent peptide vaccine against an Staphylococcus aureus biofilm-related infection. Int J Pept Res Ther. 2016;22:101–117. doi: 10.1007/s10989-015-9489-1. [DOI] [Google Scholar]
  55. Sherry L, et al. Biofilms formed by Candida albicans bloodstream isolates display phenotypic and transcriptional heterogeneity that are associated with resistance and pathogenicity. BMC Microbiol. 2014;14:1–14. doi: 10.1186/1471-2180-14-182. [DOI] [PMC free article] [PubMed] [Google Scholar]
  56. Shukla M, Rohatgi S. Vaccination with secreted aspartyl proteinase 2 protein from candida parapsilosis can enhance survival of mice during c. tropicalis-mediated systemic candidiasis. Infect Immun. 2020;88:e00312–00320. doi: 10.1128/IAI.00312-20. [DOI] [PMC free article] [PubMed] [Google Scholar]
  57. Singh DK, et al. Functional characterization of secreted aspartyl proteases in Candida parapsilosis. Msphere. 2019;4:e00484-00419. doi: 10.1128/mSphere.00484-19. [DOI] [PMC free article] [PubMed] [Google Scholar]
  58. Souza MN, Ortiz SO, Mello MM, Oliveira FdM, Severo LC, Goebel CS. Comparison between four usual methods of identification of Candida species. Rev Inst Med Trop São Paulo. 2015;57:281–287. doi: 10.1590/S0036-46652015000400002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  59. Tehrani SS, et al. Suitable signal peptides for secretory production of recombinant granulocyte colony stimulating factor in Escherichia coli. Recent Pat Biotechnol. 2020;14:269–282. doi: 10.2174/1872208314999200730115018. [DOI] [PubMed] [Google Scholar]
  60. Thomson DD, Wehmeier S, Byfield FJ, Janmey PA, Caballero-Lima D, Crossley A, Brand AC. Contact-induced apical asymmetry drives the thigmotropic responses of Candida albicans hyphae. Cell Microbiol. 2015;17:342–354. doi: 10.1111/cmi.12369. [DOI] [PMC free article] [PubMed] [Google Scholar]
  61. Tsui C, Kong EF, Jabra-Rizk MA. Pathogenesis of Candida albicans biofilm. Pathog Dis. 2016 doi: 10.1093/femspd/ftw018. [DOI] [PMC free article] [PubMed] [Google Scholar]
  62. Uppuluri P, et al. The Hyr1 protein from the fungus Candida albicans is a cross kingdom immunotherapeutic target for Acinetobacter bacterial infection. PLoS Pathog. 2018;14:e1007056. doi: 10.1371/journal.ppat.1007056. [DOI] [PMC free article] [PubMed] [Google Scholar]
  63. Wang X-j, Sui X, Yan L, Wang Y, Cao Y-b, Jiang Y-y. Vaccines in the treatment of invasive candidiasis. Virulence. 2015;6:309–315. doi: 10.4161/21505594.2014.983015. [DOI] [PMC free article] [PubMed] [Google Scholar]
  64. Wiederstein M, Sippl MJ. ProSA-web: interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res. 2007;35:W407–W410. doi: 10.1093/nar/gkm290. [DOI] [PMC free article] [PubMed] [Google Scholar]
  65. Zarei M, Nezafat N, Rahbar MR, Negahdaripour M, Sabetian S, Morowvat MH, Ghasemi Y. Decreasing the immunogenicity of arginine deiminase enzyme via structure-based computational analysis. J Biomol Struct Dyn. 2019;37:523–536. doi: 10.1080/07391102.2018.1431151. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Data Availability Statement

All data generated or analysed during this study are included in this published article, and its supplementary information files.


Articles from International Journal of Peptide Research and Therapeutics are provided here courtesy of Nature Publishing Group

RESOURCES