Abstract
Worldwide SARS-CoV-2 sequencing efforts track emerging mutations in its spike protein, as well as characteristic mutations in other viral proteins. Besides their epidemiological importance, the observed SARS-CoV-2 sequences present an ensemble of viable protein variants, and thereby a source of information on viral protein structure and function. Charting the mutational landscape of the nucleocapsid (N) protein that facilitates viral assembly, we observe variability exceeding that of the spike protein, with more than 86% of residues that can be substituted, on average by three to four different amino acids. However, mutations exhibit an uneven distribution that tracks known structural features but also reveals highly protected stretches of unknown function. One of these conserved regions is in the central disordered linker proximal to the N-G215C mutation that has become dominant in the Delta variant, outcompeting G215 variants without further spike or N-protein substitutions. Structural models suggest that the G215C mutation stabilizes conserved transient helices in the disordered linker serving as protein–protein interaction interfaces. Comparing Delta variant N-protein to its ancestral version in biophysical experiments, we find a significantly more compact and less disordered structure. N-G215C exhibits substantially stronger self-association, shifting the unliganded protein from a dimeric to a tetrameric oligomeric state, which leads to enhanced coassembly with nucleic acids. This suggests that the sequence variability of N-protein is mirrored by high plasticity of N-protein biophysical properties, which we hypothesize can be exploited by SARS-CoV-2 to achieve greater efficiency of viral assembly, and thereby enhanced infectivity.
Keywords: SARS-CoV-2, viral assembly, quasispecies, mutational landscape, protein plasticity
Significance Statement.
The SARS-CoV-2 virus is subject to random mutation due to its imperfect replication. Worldwide sequencing efforts to recognize novel mutants of epidemiological concern have also established an unprecedented database of variant species with alternate amino acid sequences. Focusing on the N-protein that facilitates viral assembly, we combine the analysis of amino acid variability with biophysical studies of a particularly conspicuous mutation associated with the spread of the Delta variant. This reveals a key early step in the viral assembly mechanism. While understanding the structure and function of viral proteins is a prerequisite for the development of targeted therapeutics, this study also highlights that SARS-CoV-2 genetic diversity can be associated with substantial structural and functional plasticity of viral proteins.
Introduction
Two years into the COVID19 pandemic, intense research into the structure and molecular mechanisms of SARS-CoV-2 virus has led to the rapid development and deployment of several types of vaccines (1), neutralizing monoclonal antibodies (2), and small molecules drugs such as ribonucleoside analogs and inhibitors of viral proteases and polymerase (3–5). A persistent concern is viral escape through evolution of therapeutic and immunological targets. Most attention in this regard is devoted to the viral spike protein that facilitates viral entry (6, 7), though recent data additionally point to the importance of viral packaging by the nucleocapsid (N) protein modulating viral loads and, thereby infectivity (8–10).
In an unprecedented global effort, several millions of genomes have been sequenced so far and submitted to the Global Initiative on Sharing All Influenza Data (GISAID) to monitor SARS-CoV-2 variants (14) (Fig. 1A). This has provided an invaluable data base for recognizing emerging variants of concern, phylogenetic analyses, and analyses of geographic spread (11, 15–18). However, the vast majority of the observed mutations are short-lived and ostensibly inconsequential. Nonetheless, such mutations play a key role in establishing the genetic diversity of RNA viruses, with profound impact on evolutionary dynamics (19–22). In accumulation, they define a mutational landscape that is intimately related to stability constraints and structure–function relationships of viral proteins (23, 24). Thus, projecting the ensemble of mutations in reported consensus sequences into the amino acid sequence space and neglecting their origin and relationships, they manifest an exhaustive mutational landscape of viable amino acid substitutions of SARS-CoV-2 proteins, all of which evidently have been successfully proliferating as part of the SARS-CoV-2 species found in patients (18, 25, 26). Unfortunately, the fine-grained interpretation of such mutation data in the biophysical context of protein structure and function is a daunting task, and the spectrum of biophysical properties defined by the ensemble of mutant sequences is largely unclear, although it has been observed that RNA virus proteins generally have more loosely packed cores and intrinsically disordered regions that may provide adaptability (27). Focused analyses of RNA virus mutational landscapes in relation to protein structures have been carried out, for example, for the poliovirus polymerase (23), and the SARS-CoV-2 spike protein receptor binding domain (28, 29).
Fig. 1.

Timeline of SARS-CoV-2 sequences and N-protein mutations. (A) Cumulative number of sequences originating from GISAID and preprocessed by Nextstrain.org. All sequences (black) are shown and those of 21J Delta variant (red). (B) Relative worldwide populations of N-protein sequences exhibiting the characteristic Delta variant mutations D63G, R203M, D377Y, and G215C, assembled from data of Nextstrain.org (11). To highlight the emerging role of G215C, pointed out first by Marchitelli et al. (12) and Stern et al. (13), the magenta dashed line shows the declining contributions of sequences that do not carry the G215C mutation (clades 21A and 21I). (C) Cumulative number of residues at which any substitution was observed vs. total sequences. The total (black) is subdivided in those of 21J Delta clade (red) and all others (blue). Also shown are the number of residues in 21J Delta that are also found substituted in pre-21J sequences (cyan) or where substitutions are unique to this variant (magenta).
In the present work, we aim to exploit the mutational landscape of the SARS-CoV-2 N protein as a tool to elucidate molecular aspects of the viral assembly, which requires packaging the RNA through an as-of-yet incompletely understood coassembly mechanism with N protein into well-defined ribonucleoprotein particles (30, 31). Of particular interest with regard to viral assembly is the SARS-CoV-2 variant B.1.617.2 (Delta) that in 2021 has rapidly outperformed all previous variants (32) (Fig. 1A), exhibiting reduced incubation time and significantly higher viral load in infected patients (33–35), in one study up to a 1,000-fold higher compared to the original lineage (33). Delta variant mutations in N-protein include D63G, R203M, D377Y, and in different clades additionally R385K and G215C, respectively (13). Among those, mutation R203M was shown to significantly increase replication (8), but is similar to analogous N-protein mutations in all other SARS-CoV-2 variants of concern (13) including the current Omicron variant. Conspicuously, the Delta variant containing the G215C mutation arose without accompanying changes in the spike protein (Nextstrain clade 21J) and has dramatically outperformed and virtually displaced other Delta variant clades, assuming worldwide dominance in 2021 (13, 12) (Fig. 1B). This warrants a detailed study of the impact of the G215C mutation on protein structure and function.
In analyzing the mutational landscape, we observe a highly conserved region that reveals a possible role of the G215C mutation in enhancing interactions critical for assembly. To examine molecular mechanisms in detail, we combine biophysical characterization of protein size, shape, structure, and protein interactions with structural models from molecular dynamics (MD) simulations. In comparison with biophysical properties of the ancestral N-protein, the G215C mutant displays significant differences in secondary structure, self-association, and coassembly with nucleic acid (NA), revealing a plasticity of protein biophysical properties that mirrors its remarkable sequence variability.
Results
The mutational landscape of SARS-CoV-2 N-protein reflects structural features
Among 2.49 million consensus SARS-CoV-2 sequences uploaded to GISAID and subsequently preprocessed at Nextstrain.org (11) as of 2021 November 29, we find 8.2 million instances of amino acid changes in the N-protein. Outside the consensus mutations associated with different clades (see below), each sequence exhibits on average only 1.3 additional mutations in N-protein. From inspection of phylogenetic trees at Nextstrain.org, a majority of mutations arose multiple times independently, but usually persisted only briefly. Despite their sparsity, when aggregated over 106 sequences, the mutation data is highly redundant, describing 1,264 distinct mutations observed a median of 70 times, assembled in different combinations within 24,982 distinct N-protein sequences (Fig. 2). Mutations occurred for 362 out of 419 residues of the N-protein, each on average allowing 3.5 different substitutions. In range and depth of variability, N-protein exceeds all other structural SARS-CoV-2 proteins as well as ORF1ab (Supplementary Material Appendix, Table S1). Notably, this plasticity of the amino acid sequence does not extend to most of the 37 positions strictly conserved across related betacoronaviruses, 30 of which exhibited no or only conservative substitutions in SARS-CoV-2 (Fig. 2).
Fig. 2.
Observed mutations of N-protein in comparison with sequence alignment of related betacoronaviruses. The alignment shows Wuhan-Hu-1 SARS-CoV-2 (P0DTC9.1), SARS-CoV-1 (P59595.1), MERS (YP_009047211.1), murine hepatitis virus (NP_045302.1), human coronavirus NL63 (Q6Q1R8.1), and the 229E-related bat coronavirus APD51511.1. Conserved identical residues are highlighted in bold red, and conserved similar residues in bold black. Above the aligned sequences are observed distinct mutations of SARS-CoV-2 observed among 2.49 million sequences uploaded to GISAID since beginning of the pandemic, ordered by number of observations: 10 to 20 (light blue), 20 to 100 (gray), 100 to 1,000 (blue), and > 1,000 times (bold blue), and with magenta highlight for the four Delta variant consensus mutations.
To assess to what extent the observed sequence space has exhausted the range of possible substitutions, Fig. 1(C) shows the scope of residues at which mutations have been observed as a function of total sequences. (Because we assume most sequence fluctuations to be stochastic independent events, the cumulative number of sequences is serving here as a scaled surrogate for time to compensate for vastly different sequence deposition rates with time.) The approach of an asymptotic limit can be discerned, with a second phase of changes in emerging Delta variant sequences; these, too, approach a limit. This suggests that the observed mutation landscape attains saturation, while hinting at some changes associated with the Delta variant. To further analyze the time course of observed mutations, Fig. 3(E) presents the temporal evolution of the mutation frequency observed at each position. Insofar as the propagation of mutations in each N-protein position are driven by adventitious spreading events, or are bystander of improvements in fitness to other viral proteins, variation along the ordinate (time/sequence axis) in Fig. 3(E) is produced. By contrast, constant mutation frequencies in individual residues (constant color along vertical line in Fig. 3E) must reflect intrinsic molecular properties. Remarkably, for the overwhelming majority of positions across the N-protein, the observed mutation frequency is largely constant with minor stochastic modulations; this becomes even clearer when subdividing sequences between Delta 21J clades and others predating 21J (Supplementary Material Appendix, Figure S1). However, from the observed time–course of ancestral SARS-CoV-2 and Delta 21J mutations, it did require on the order of 105 sequences to approximate the mutational landscape (Supplementary Material Appendix, Figure S2).
Fig. 3.
Structural organization of N-protein and range and frequency of mutations. (A) Domain organization of N- and C-terminal folded domains with highlighted mutations characteristic for Delta variant SARS-CoV-2. (B) Propensity of residues to promote LLPS, showing in red droplet-promoting regions with pDP > 0.6. (C) Histogram of the number of distinct mutations of each residue. The histogram bars are subdivided to show the number of distinct mutations common to 21J Delta and non-21J Delta species (black), those that have only occurred in non-21J Delta (green) and those only observed in 21J Delta species (blue; see Supplementary Material Appendix, Figure S4). Magenta highlights below the abscissa indicate positions with no or only conservative substitutions. Gray vertical patches indicate regions of secondary structure identified by Dinesh et al. from NMR of the NTD and by Zinzula et al. from x-ray crystallography of the CTD, and + signs indicate positions with NMR chemical shifts upon NA binding in the NTD (36, 37). Yellow patches indicate regions of unknown function that appear conserved from mutations. (D) Mutations scored for physicochemical similarity with conservative substitutions green and nonconservative red. Multiple instances of the same score are depicted as darker shade. Blue circles highlight the four Delta variant mutations. (E) Frequency of mutations vs. total sequence number. To visualize the temporal fluctuations in the rate of accumulated mutations, the daily number of any mutation in each position relative to the daily number of new sequences, convoluted across 104 sequences, is plotted against the total accumulated sequences (as scale of time) and color-coded according to the relative rate of observing a mutation. Thus, structure in the vertical direction reflects adventitious spreading events and mutational drifts, superimposed to constant baseline mutation fitness dictated by molecular properties. At ∼106 sequences, a slight change in pattern may be discerned, coinciding with the rise of the Delta variant. Mutation frequency plots separately for Delta 21J and preceding variants are in Supplementary Material Appendix, Figure S1; their initial spread in the mutational landscape is shown in Supplementary Material Appendix, Figure S2.
We can better examine the significance of the mutations in more detail in the context of the N-protein structural organization and its assembly function. Briefly, N-protein is dimeric, with each chain comprised of a C-terminal dimerization domain (CTD) and an N-terminal NA binding domain (NTD), both flanked and linked by long intrinsically disordered arms (Fig. 3A) (38). Both domains and linker contribute to promiscuous NA binding. NA binding induces a more ordered conformation that allows dimer–dimer interactions, which, in turn, and in concert with scaffolding on NA, lead to multimeric coassemblies (39). NA binding also promotes liquid–liquid phase separation (LLPS), and the highly concentrated cocondensates of N-protein and NA allow the formation of ribonucleoprotein particles (40–43). N-protein also interacts with the viral M-protein, which appears to play a role in promotion of N-protein condensates, in anchoring ribonucleoprotein particles to the viral membrane, and in the recognition of viral RNA (41, 44).
Overall, the number of distinct mutations tracks well with the folded domains, which have a more restricted range of viable mutations than the largely disordered arms and linkers (average number of different substitutions is 2.14 for NTD and CTD, vs. 3.81 for arms and linkers; Fig. 3C). Residues close to the secondary structure elements previously revealed by nuclear magnetic resonance (NMR) spectroscopy and x-ray crystallography are mostly either completely protected from mutations or highly conserved, as are the majority of NTD residues likely in contact with NAs, as inferred from NMR chemical shifts (36, 37). Conversely, regions in the linker that score high for disorder and LLPS propensity (Fig. 3B) exhibit the largest clusters of mutations. When examining the nature of the replacements through a scoring for physicochemical properties, such as polarity, hydrophobicity, and secondary structure propensity, we can discern a majority of conservative substitutions in the folded domains, and greatest variety of residues with altered physicochemical properties in the disordered regions (Fig. 3D).
New features appear in this mutational landscape in the disordered linkers and arms. The linker is critical to RNA-mediated phase separation (41) and was early identified as a region of high sequence variability (16). The large coverage of the mutational landscape now available allows identification of constrained islands within the disordered regions. These include positions 49 to 56 proximal to the first sheet in the NTD, the highly conserved leucine-rich sequence 218 to 231, as well as two stretches in the C-terminal arm (C-arm) at 390 to 394 and 403 to 408 (yellow highlights in Fig. 3C and D). Interestingly, these regions also approximately correspond to distinct stretches of amino acids with low disorder score. Based on their apparent conservation, these regions likely endow N-protein with critical functions.
The disordered C-arm of N-protein is thought to play a critical role in the interaction with viral M-protein and the packaging signal, based on studies with corresponding regions of other coronaviruses (44). The observed conserved stretches in the mutational landscape coincide with helices (383 to 396 and 402 to 415) previously observed in MD simulations (40). In further support, we find structural prediction displays transient helices in this region, in the AlphaFold2 result spanning residues 400 to 410 (Supplementary Material Appendix, Figure S3). The relatively low confidence score is expected given the intrinsic disorder of the C-arm, but nonetheless suggests a propensity for transient helix formation.
For the protected leucine-rich sequence 218 to 231, a potential role arises from its location within the linker region 210 to 246 found to be essential for RNA-mediated LLPS (41). The conserved island is also overlapping with the locus of a previously identified nuclear export signal 224 to 230 (45). Incidentally, it overlaps with the peptide 222 to 230 that is a binder for HLA-A02:01 and immunogenic (46). Cubuk et al. reported transient helices in the leucine-rich region in MD simulations, proposed to provide oligomerization interfaces (40), and Guseva et al. observed significant helical propensity from 216 to 224 in NMR experiments (47). Using structure-prediction tools, we confirm the presence of a helical segment spanning residues 215 to 235 (Supplementary Material Appendix, Figure S3), and, as further described below, find evidence for its role in protein oligomerization and coassembly with NA.
On the N-terminal half of the disordered linker, the SR-rich region 176 to 206 has been a locus of particular interest due to the cluster of charged residues and phosphorylation sites. Their phosphorylation state is thought to regulate N-protein functions (38, 41, 42, 48) and interaction with the viral NSP3 protein (48) and host proteins such as glycogen synthase kinase-3 (49, 50), CDK-1 (42), and 14–3–3 proteins (51). Focusing on the 14 serine residues in this stretch, the mutational landscape shows that, with the exception of completely conserved S176, all other phosphorylation sites can be substituted, and new ones can be introduced. Overall, 14.3% of all sequences exhibit changes in the serine pattern; however, there is a significant anticorrelation to maintain a total number of 13 or more serines in this region (Table S2, Supplementary Material). Thus, it appears that except for S176, there is redundancy and flexibility in the phosphorylation sites, but with a constraint to maintain their local density.
Within this SR-rich region, the R203 mutation was noted early in the pandemic and remained common to all variants of interest (13, 52, 53). The earlier R203K/G204R was shown experimentally to enhance the ability of N-protein to form condensates (6), and R203M—prevalent in the Delta variant—was recently reported to enhance viral replication (8).
The most recent mutation G215C is located in the linker between the SR-rich and leucine rich regions. It has arisen in the Delta 21J clade during the second half of 2021. Accompanied solely by mutations in ORF1ab and ORF7b, it quickly outcompeted any variants not containing G215C to assume worldwide dominance (Fig. 1B). As of 2021 November 29, 49.6% of sequences in the data base contain the G215C mutation, but these describe only 34.9% of unique sequences (8,720), consistent with the shorter period of time since the 21J clade has emerged. Nevertheless, when examining to what extent these have already expanded to reproduce the mutational landscape, we find 97.2% of instances of N mutations occur in positions that show mutations in both 21J and non-21J clades (Fig. 3C; see Supplementary Material Appendix, Figure S4 for a detailed list). Incomplete overlap can be discerned mostly among rare substitutions and in highly disordered regions. Quantitatively, 14.0% of distinct mutations in non-21J (pre-Delta) species have not yet been observed in the 21J clade, potentially due to still incomplete coverage. Interestingly, however, 21.8% of distinct substitutions in the 21J clade were not previously observed in non-21J clades, suggesting evolution of biophysical properties (Fig. 1C).
N-protein mutants display altered secondary structure and assembly properties
To study the impact of the mutation on structure and assembly function of N-protein, we compare the biophysical properties of select N-protein mutants derived from the Delta variant with those of the ancestral Wuhan-Hu-1 N-protein (Nref) in vitro. First, we examined the coarse-grained size and shape using sedimentation velocity analytical ultracentrifugation (SV) and dynamic light scattering (DLS). As shown previously (39), when expressed in Escherichia coli and purified to remove NA, Nref forms noncovalent 4.1 S dimers with a Stokes radius of 5.9 nm. Its translational frictional ratio of 1.82 indicates a highly extended hydrodynamic shape as a result of significant disorder. The dimers are linked tightly at the dimerization interface in the CTD with KD < 10 nM, but show only ultraweak further self-association (KD = 760 µM).
An overlay of sedimentation coefficient distributions of the N:D63G and N:G215C mutants, as well as the quadruple N:D63G,R203M,G215C,D377Y mutant reflecting the full set of canonical mutations in 21J Delta variant is shown in Fig. 4. While N:D63G sediments similar to Nref, indicating no change in size, shape, or self-association properties, both N:G215C and the quadruple mutant sediment much faster, at a rate that demonstrates the formation of tetramers at low micromolar concentrations. To comprehensively examine the altered state we focus on N:G215C, in light of its unique epidemiological impact, and to enable clear structural attribution of changes to a single residue substitution.
Fig. 4.

Self-association properties differ for N-protein mutants. Sedimentation coefficient distributions are shown for ancestral protein (Nref; black), the N:D63G mutant (cyan) the N:G215C mutant (magenta), and the quadruple mutant N:D63G,R203M,G215C,D377Y that reflects the set of mutations common to the 21J Delta clade (red).
Compared to the ancestral Nref, N:G215C sediments much faster at 7.3 S (Fig. 5A), with a lower hydrodynamic frictional ratio of 1.58, in a relatively more compact, tetrameric solution state with a Stokes radius of 7.09 nm (Fig. 5C). Electrospray mass spectrometry (ESI-MS) shows an intact mass of 93,792 Da, consistent with the expected value for a His-tagged dimer. Furthermore, liquid chromatorgraphy with tandem mass spectrometry (LC-MS/MS) of tryptic digests shows a peptide consistent with a species composed of two tryptic peptides cross-linked by disulfide bond at 215C. Finally, we used mass photometry (MP) to obtain an independent direct measurement of the molecular weight distribution of N:G215C in solution (Fig. 5D). Different from ESI-MS, this method leaves the noncovalent dimerization at the CTD intact. Accordingly, a majority peak can be discerned approximately at the tetramer mass. In summary, N:G215C forms a tightly bound, compact tetramer via disulfide cross-links of noncovalent dimers.
Fig. 5.
Solution structure and higher-order assembly properties of N:G215C protein. (A) Sedimentation coefficient distributions of N:G215C at a range of concentrations. For comparison, dimeric Nref is shown as dotted line. (B) Sedimentation data in reducing conditions after incubation in working buffer supplemented with 1 mM TCEP. The inset shows the concentration-dependence of the weight-average sedimentation coefficient (circles) and best-fit isotherm model (line) leading to a KD for dimer–tetramer self-association of 3.3 µM. No significant changes in protein self-association was observed across a range of reducing conditions including 1 mM and 10 mM DTT, 1 mM and 10 mM TCEP, and 70 mM β-mercaptoethanol. (C) Autocorrelation function in DLS (circles) and best-fit single-species models (lines). (D) Determination of mass distribution by MP. Shown are histograms of the masses associated with single molecule surface adsorption events of N:G215C in working buffer (magenta) and in reducing conditions (blue) after incubation with 10 mM DTT. MP is restricted to low nM concentrations, leading to partial dissociation of the CTD dimerization interface. This can be discerned from the minority dimer peak under nonreducing conditions. Due to the lower mass limit of MP of 50 kDa, free N-protein monomer cannot be measured. (E) Secondary structure content of Nref and N:G215C at different conditions by CD, and conformational changes of N:G215C in presence of T10. Spectra for reduced and nonreduced N:G215C virtually overlap. (F) and (G) Cartoons of N-protein assembly with different chains of CTD-linked dimers (CTD circles, NTD squares, blue and green depicting dimer chains, and brightness scale distinguishing different dimers) are forming a series of dimer-dimer (F) or one pair of intratetramer (G) cross-links at 215C (stars). (H) Sedimentation coefficient distributions of 2 µM N-protein in the presence of 1 µM oligonucleotide T20 which can bridge N-protein dimers. For reference, T20 binding to Nref leads to weak dimer self-association at these low concentrations (black). For N:G215C (magenta), which is constitutively tetrameric, binding of T20 causes an increased SV consistent with the additional bound mass. Reduced N:G215C (blue, with 10 mM DTT) is constitutively in a dimer–tetramer self-association equilibrium, which T20 binding shifts strongly to tetramers. For both disulfide-linked and reduced N:G215C weak higher-order coassembly of the tetramer/T20 complex cannot be excluded. (I) Promotion of particle growth at higher concentrations and higher temperature. Shown are the average Stokes radii measured by DLS for 3 µM N:G215C in standard (magenta) and reducing conditions (blue, with 10 mM DTT), and, for comparison, 3 µM Nref in standard conditions (black). Also shown is 3 µM N:G215C in presence of 10 µM T10 oligonucleotide (dashed red), as well as 3 µM Nref with 10 µM T10 (dashed black).
When disrupting disulfide bonds in reducing conditions, as expected, the intact mass obtained from ESI-MS was 46,897 Da, consistent with the mass of the monomer. By MP, the mass distribution exhibits a peak at the dimer molecular weight (Fig. 5D), consistent with significant noncovalent CTD dimerization similar to Nref. However, at the much higher µM concentrations in SV, reduced N:G215C shows much different behavior (Fig. 5B): In addition to a major peak at 4.1 S for the dimer, a faster sedimenting population with distinct concentration dependence can be discerned. This is characteristic of further self-association in rapid association/dissociation exchange (54). An isotherm of weigh-average s-values can be modeled as a dimer–tetramer association step with a best-fit dimer KD of 3.3 µM (Fig. 5B inset). This is ∼200-fold stronger than previously measured for Nref. Thus, the G215C mutation induces conformational alterations that create, or significantly enhance, a noncovalent dimer–dimer protein interaction interface outside the CTD, even in the absence of covalent disulfide bonds.
The possibility of covalent dimerization of CTD-linked dimers poses a question regarding the quaternary structure, since multivalent dimers could potentially self-assemble into wide range of higher-order oligomers (Fig. 5F). Such structures would be detected with high sensitivity both in SV and DLS, but are virtually absent in our data. Instead, as supported by reduction and reoxidation experiments (Supplementary Material Appendix, Figure S5), measurement of free sulfhydryls (Supplementary Material Appendix, Figure S6), and the measured compact hydrodynamic shape (Fig. 5A and C), we propose a more compact configuration with two intratetramer cross-links (Fig. 5G). Unfortunately, published cryoelectron tomography structures do not yet allow unambiguous structural assignment of N-protein configurations in the ribonucleoprotein particles (31).
To complement the study of coarse-grained aspects of N-protein size and shape, we examined the secondary structure content of N:G215C by circular dichroism spectroscopy (CD). Whereas the spectrum of Nref is dominated by a large negative ellipticity at 200 nm that is characteristic for disordered chains, N:G215C shows much reduced negative 200 nm signal and instead stronger ellipticity in the range 220 to 230 nm typical for helical structures (Fig. 5E). Such diminished disorder is consistent with the more compact hydrodynamic shape of N:G215C. Virtually identical spectra were obtained in reducing conditions, and across a concentration range populating different fractions of dimers and tetramers.
A key step in assembly is the interaction between NA and N-protein. We previously probed consequences of NA binding on N-protein interactions by studying N-protein liganded with short oligonucleotides (39). Up to a decanucleotide T10, a length that spans the binding grove of the NTD (36), we observed similar binding affinities of NA for N:G215C as previously determined for Nref (Supplementary Material Appendix, Figure S7). Likewise, virtually unaltered is a reduction in disorder by CD spectroscopy when liganded by T10 (Fig. 5E), as well as a NA binding-related shift to greater thermal stability of the folded domains observed by differential scanning fluorometry (Supplementary Material Appendix, Figure S8). Apparently, elementary features of NA binding are not substantially affected by the G215C mutation.
A much different picture arises when binding the longer oligonucleotides T20. These spatially extend beyond a single NTD domain and can bridge between two N-protein dimers (39). For Nref, they promote formation of tetramers and higher oligomers at low micromolar protein concentrations (39). In the case of N:G215C, we find this coassembly significantly augmented. While this may be expected for disulfide-linked N:G215C tetramer, even in the reduced conditions N:G215C exhibits significantly stronger hetero-oligomerization (Fig. 5H). This shows cooperativity or an avidity advantage of N:G215C in the earliest steps of assembly with NA, presumably due to its ability to constitutively tetramerize.
Finally, we compare aspects of higher-order assembly and LLPS. LLPS depends on highly multivalent, weak interactions (55), such as transient aromatic side-chain and backbone interactions of disordered chains (56). These can be expected to differ from protein/NA and protein–protein interactions that stabilize the discrete oligomeric coassemblies observed above (57), including the tetramerization property augmented by the G215C mutation.
LLPS of Nref can be induced at higher temperature and by NA binding (43). It is preceded by the formation of ∼0.1 to 1 µm sized clusters (39, 58). This is accompanied by structural transitions by CD (39), which we similarly observe for N:G215C (Supplementary Material Appendix, Figure S9). However, N:G215C exhibits much steeper transitions, and at a lower transition temperature, as may be discerned from the temperature-dependent particle size in DLS (Fig. 5I). Interestingly, while for Nref a lower phase transition temperature is achieved in the presence of T10, the same transition temperature is observed for N:G215C already without any NA, and addition of T 10 to N:G215C does not lead to a further shift. Removal of disulfide bonds in reducing conditions further lowered the phase transition temperature. These results indicate more cooperative assembly with lower energy barrier. The largest objects in the coassembly process of N-protein and NA in vitro are droplets from LLPS that are visible in light microscopy. At 20°C (i.e. below the transition temperature) Nref and N:G215C only exhibited small differences, with slightly larger droplets observed for reduced N:G215C compared to Nref (Supplementary Material Appendix, Figure S10).
Structural basis of protected islands in disordered regions and effects of the G215C mutation
While several NMR and crystallographic structures are available for the NTD and CTD domains (16, 36, 37, 59–61), the features of the structure and dynamics of the disordered linker and arms are less well-understood. The mutationally protected sequence islands in the C-arm at 390 to 394 and 403 to 408 and the central linker region 218 to 231 coincide with transient helices previously revealed in MD simulations and NMR experiments (40, 47). As described above, helices in these segments are also found with different structure prediction methods (Fig. 6A; Supplementary Material Appendix, Figure S3).
Fig. 6.

Dynamic simulations of the leucine-rich linker segment 210 to 246 with and without G215C mutation. (A) Conformations of the reference sequence predicted by AlphaFold2 (left; five models obtained; helix superimposed for comparison), the highest-ranked I-TASSER model (middle), and Phyre2 (right). G215 is highlighted in red. (B) Results of MD simulations for the reference sequence. Left: positions of residues that play a role in (i) stabilizing the helix (mainly by hydrophobic interactions; yellow), (ii) conferring flexibility to the N- and C- segments (mainly through the six Gly residues flanking the helix; yellow), and (iii) inducing and stabilizing the major changes observed upon the G-to-C mutation. Right: molecular surface showing the exposed bed of hydrophobic residues (indicated with bracket) likely involved in protein–protein contacts. (C) Snapshots throughout the 100-nsec dynamics simulation of the G215 species (left) and C215 mutant (right) peptide, showing the major conformational changes induced by the mutation. The helix remains structurally stable throughout the simulations regardless of temperature in both cases, but in the mutant, the N-term of the helix is redirected (upward in the figure) and becomes less flexible (position 215 shown in yellow, 214 and 216 in red). (D) Stabilizing interactions. In the reference sequence (upper structures), the flexibility conferred by G215 (arrow) allows M210 and A211 to get close to A218, L219, L221, and L222. These hydrophobic interactions (yellow surfaces) stabilize the N-term segment in a different orientation than in the C215 mutant (lower structures). Here, the Cys sidechain (arrow) shows persistent hydrophobic interactions with A218 and L219, thus redirecting the chain in a different orientation relative to the helix.
To assess the impact of the G215C mutation, we studied the disordered stretch 210 to 246 in the central linker containing the leucine-rich region. Although structure prediction is generally poor in the disordered segments, all the models show varying degrees of α-helical structure in the sequence of interest, with G215 at the stem of the helix. Highest reliability is obtained in the 222 to 234 stretch (Fig. 6A). The top-ranked AlphaFold2 model was used here as the initial structure for MD calculations.
Key residues of the helix can be discerned in Fig. 6(B), which highlights six flanking Gly residues conferring structural flexibility, and a bed of hydrophobic residues that stabilize the helix and may serve as a protein–protein interaction interface. Mutation of G215 by C215 results in redirection and reduced flexibility of the N-term of the helix (Fig. 6C). These structural and dynamic changes of the mutant originate both in the higher flexibility of Gly relative to Cys and in the stabilization of the Cys sidechain through persistent hydrophobic interactions with A218 and L219 (Fig. 6D). This results in a more open configuration that appears better poised for helix–helix and thiol interactions. This is consistent with the experimentally observed enhanced dimer–dimer interactions of the N:G215C under reduced conditions and the possibility of forming disulfide bonds across different protomers.
Discussion
The worldwide sequencing effort has led to the assembly of an unprecedented database of viable SARS-CoV-2 variants, alone for N-protein describing ∼25,000 different species as of November 2021. In the present work, we have combined an analysis of the amino acid variability of SARS-CoV-2 N-protein with biophysical experiments of select mutants, and found remarkable plasticity on all levels of organization. Plasticity has been hypothesized to be a unique feature of RNA virus proteins, which have more loosely packed cores and an abundance of intrinsically disordered regions that confer high degrees of flexibility for adaptation and tolerance to mutations (27). In the present case of the SARS-CoV-2 N-protein, more than 86% of positions in the amino acid sequence are subject to variation, on average by three to four different amino acids, about half of which score low on a physicochemical similarity scale. We observed viable substitutions at many positions thought to be critical due to their conservation across related coronaviruses, or their constitution of phosphorylation and protein interaction sites. Our data show that the single mutation G215C causes significantly altered secondary structure; gross differences in hydrodynamic shape indicate altered subunit arrangements; and strongly enhanced protein–protein interactions modulate the formation of quaternary structure. More extended studies are required to elucidate the expected impact of mutations in N-protein, for example, on host protein interactions, interactions with other viral proteins, and on phase boundaries for condensation and NA coassembly. This plasticity poses significant challenges to identify the essential functions and mechanisms that may serve as therapeutic targets in N-protein.
Earlier examinations of emerging mutations in N proteins (6, 16, 62–64), going back to June 2020, were necessarily more limited in scope, and while sufficient to examine hot spots and identify key replacements such as R203K/G204R (6, 10, 16, 65), it was not yet possible to draw conclusions from a survey of the entire mutational landscape. Due to the orders of magnitude larger coverage that has become available through the global genomic epidemiology efforts since then, we believe that the observed data now approaches the limits of possible mutations for functioning N-protein, and therefore, reflects its biophysical properties.
The study of the constraints in the mutational landscape appears very useful to complement structural biophysical tools, particularly to examine intrinsically disordered regions. These generally are permissive for a wide range of amino acid substitutions (66) and, in fact, harbor three of the four persistent N-protein mutations characteristic of the Delta variant, and all of the Omicron mutations in N-protein. However, the mutational landscape of N-protein reveals several islands within these regions that are highly protected and therefore appear to have critical functions.
One of these is in the central linker adjacent to the G215 position, where the G215C mutation has quickly outcompeted all other variants in 2021. It appeared alongside ORF1a (A1306S, V2930L, T3255I, and T3646A), ORF1b (A1918V), and ORF7b (T40I) mutations, and two synonymous mutation C8986T and A11332G, but no additional spike protein mutations in the Delta variant. While the roles of the accompanying mutations and potential contributions to viral fitness are unknown, our data show the G215C mutation in the N-protein can be related to viral assembly functions.
NMR and MD studies have reported distinct α-helical propensity flanking position 215 in the SR-rich region (64) and in the leucine-rich region (40, 47). The latter was proposed to provide interfaces for oligomerization (40, 47). Most recently, NMR experiments showed formation of an α-helix 219 to 230 when in complex with nsp3a, which binds to N-protein competitively with RNA (67). In the present work, we found this region highly protected against mutation. We propose that these helices may be essential for higher-order assembly of N-protein, and are either stabilized or exposed in the emerging G215C mutant. Indeed, our simulations show a stable helix spanning residues G215 to S235 exhibiting an extended hydrophobic surface on one side. Mutation to C215 repositions the downstream sequence relative to the helix, which renders the hydrophobic surface more accessible for protein–protein interactions.
The potential introduction of disulfide bonds in the N:G215C mutant stabilizing dimer–dimer cross-links in the linker region would constitute an even more drastic change in the assembly pathway. It is uncertain, however, whether these disulfide bonds are formed in vivo. Disulfide bonds are absent in N-proteins of related betacoronaviruses, but assist oligomerization of N-proteins of other RNA viruses at least transiently (68, 69). However, even without disulfide bonds, we found a 200-fold enhancement of dimer–dimer self-association in N:G215C, accompanied by augmented coassembly with NA, which we hypothesize profoundly alters the coassembly kinetics of ribonucleoprotein particles. This may contribute to the clinical phenotype of strongly increased viral load and infectivity of the Delta variant, and the overwhelming dominance of the 21J Delta clade relative to the 21I Delta clade despite the lack of additional changes in the spike protein.
After writing of this manuscript, the 21J Delta variant of SARS-CoV-2 has been replaced by the Omicron variant as the worldwide dominant variant. Interestingly, the latter has none of the N-protein mutations defining for the Delta variant, but it exhibits deletions and new mutations that may impact viral fitness, in addition to the characteristic spike protein mutations. While this development does not impact our conclusions on the mutational landscape of N-protein and its relation to its biophysical properties and assembly functions, it will be interesting to examine to which extent Omicron will explore, on a global population level, a similar N-protein sequence space as Delta and prior variants.
Materials and Methods
Sequence analysis
Mutation data were based on consensus sequences of SARS-CoV-2 isolates submitted to the GISAID, and downloaded on 2021 November 29 as preprocessed file by the Nextstrain team (nextstrain.org) (11) containing 2.49 million sequences. 49.7% of all sequences included the N:G215C mutation characteristic for the dominant Delta clade, using the Wuhan-Hu-1 isolate (GenBank QHD43423) (70) as the ancestral reference. Only high quality sequences based on multiple criteria evaluated in Nextstrain analysis (71) were included. Additionally, a threshold for sequence errors was bootstrapped by inspecting the time–course of mutation events in positions that are strictly conserved across coronaviruses. While seven exhibited no mutations at all since January 2020, and six only a single event, those that were mutated in excess of 10 times exhibited clusters of two or more closely spaced events as would be expected from transmission chains. For positions with more than 20 total mutation events, clusters occurred frequently to approach a virtually continuous accumulation of their total count. Thus, a threshold of 10 observations was set as a lower limit for any mutations to be considered in the present work.
Alignment of SARS and related sequences was carried out with COBALT at NLM (72), and highlights for similar residues were taken from ESPript (73), plotted with MATLAB (Natick, MA). Similarity scores were calculated using the EMPAR matrix (74). Propensity of residues to promote LLPS were calculated by FuzDrop (75).
Molecular modeling and dynamics simulations
3D models of the sequence 210MAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTV246 were obtained from three independent servers that use different assumptions and algorithms (76–78). The model used here was obtained with AlphaFold2 after extracting the predicted coordinates of the above sequence from the modeled full-length N-protein. All the models predict modest helical content, except for the N- and C-term segments, which are disordered. Structures of the C-term helix were also obtained with the three prediction methods based on the sequence 390QTVTLLPAADLDDFSKQLQQSMSSADSTQA419.
MD simulations were carried out in the NPT ensemble, at 25 and 37° and 1 atm, in a cubic cell with PBC and PME summations, using the all-atom CHARMM (param36) force field (79, 80). The peptides were capped (acetylated N- and amidated C-) to minimize potential electrostatic artifacts of the termini. All bond lengths involving hydrogen atoms were constrained with the SHAKE algorithm, and an integration step of 2 fs was used. The pressure was maintained with the Langevin piston method, with mass and collision frequency of 400 amu and 20 ps−1. The temperature was maintained with the Hoover thermostat, using a mass of 103 kcal mol−1ps2. The side length of the simulation box was initially set at ∼9.3 nm and filled with ∼27,000 TIP3P water molecules, yielding an average density of ∼0.993 g cm−3 at 37°C after equilibration. Assuming Asp– and Glu– unprotonated and Arg+ and Lys+ protonated at neutral pH, the peptides are electroneutral; 74 K+ and 74 Cl− ions were added to mimic near-physiological [KCl] ∼150 mM concentration. The ions were randomly distributed in the water phase after the peptides were solvated and the overlapping water molecules removed. After standard protocols of heating and equilibration, a productive phase of 100 ns was conducted, and analysis performed over the last 80 ns. Structural and dynamic analyses were based on the calculations of average values and standard deviations of the ϕ and ψ dihedral angles per residue.
Protein and oligonucleotides
SARS-CoV-2 nucleocapsid protein # YP_009724397 with quadruple D63G, R203M, G215C, and D377Y mutations including 6His with TEV cleavage site was synthesized and cloned into the pET-29a(+) expression vector by GenScript (Pisctaway, NJ). The plasmid was transformed into BL21(DE3)pLysS E. coli (ThermoFisher catalog # C606010), and grown in LB kanamycin at 37°C to 0.8 OD. Protein expression was induced with 0.5 mM IPTG overnight at 18°C. Cells were harvested and then lysed in 20 mM Na2PO4 pH 7.5, 1.5 M NaCl with 1 tab of protease inhibitor cocktail (SIGMAFAST, Sigma-Aldrich, St. Louis, MO; catalog #S8830) passing twice through an Emulsiflex-C5 extruder (Avestin Inc., Ottawa, ON, Canada) followed centrifugation at 4°C to remove cell debris. A Ni2+ affinity column (HisTrap FF Crude 5 ml, Cytiva, Marlborough, MA) was equilibrated in 20 mM Na2PO4 pH 7.5, 1.5 M NaCl and cell lysate was added at a flow rate of 0.5 mL min−1. The column was washed in the same buffer supplemented with 20 mM imidazole. Following a modified unfolding/refolding protocol (42) to remove residual protein–bound bacterial NA, the captured protein was denatured in 50 mM HEPES pH 7.5, 500 mM NaCl, 6 M urea, 10% glycerol for at least 20 column volumes at 1 mL min−1, and then renatured in an overnight gradient wash with 40 column volumes at a flow rate of 0.2 mL min−1 to a final buffer 50 mM HEPES pH 7.5, 500 mM NaCl, 10% glycerol. Protein was eluted in a gradient to 50 mM HEPES pH 7.5, 500 mM NaCl, 10% glycerol, 500 mM imidazole at 0.2 mL min−1. For cleavage of the 6His tag, peak fractions were quickly dialyzed against cleavage buffer of 20 mM Na2PO4, 250 mM NaCl, 1 mM DTT, and pH 7.5 to remove imidazole, and then incubated overnight with TEV protease in cleavage buffer supplemented with 0.5 mM EDTA. Reaction products were dialyzed in 50 mM HEPES, 500 mM NaCl, and pH 7.5 and then purified by elution through Ni2+ affinity column. Protein concentration was measured by UV/VIS spectrophotometry, and an absorbance ratio at 260 to 280 nm of ∼0.55 was observed, confirming the absence of NA. Protein purity was confirmed by SDS-PAGE.
SARS-CoV-2 N-protein accession # YP_009724397, the N:G215C mutant, and the N:D63G mutant were acquired from EXONBIO (San Diego, CA; catalog# 19CoV-N150, 19Cov-N180, and 19Cov-N170). These constructs have a C-terminal His-tag and were expressed in E. coli. Sequences and the absence of post-translational modifications were verified by LC-MS/MS. For Nref, based on amino acid composition the molar mass is 46981.06 Da, and the molar extinction coefficient at 280 nm is 43,890 M–1cm–1. For N:G215C, the MW is 47027.15 Da and for N:D63G it is 46,923 Da. All have a predicted partial-specific volume of 0.717 mL g−1 at 20°C. The protein was formulated in phosphate buffer pH 7.4, 250 mM NaCl and stored in frozen form. The ratio of absorbance at 260 to 280 nm of Nref, N:D63G and N:G215C was 0.52, 0.56, and 0.56, respectively. Prior to biophysical characterization, the proteins were dialyzed exhaustively the working buffer (Na2PO4 10.1 mM, KH2PO4 1.8 mM, KCl 2.7 mM, NaCl 10 mM, and pH 7.40). Final protein concentrations were determined by spectrophotometry or refractometry.
The oligonucleotides T6 (TTTTTT), T10 (TTTTTTTTTT), and T20 (TTTTTTTTTT TTTTTTTTTT) were purchased from Integrated DNA Technologies (Skokie, IL), purified by HPLC and lyophilized. They were dialyzed in the working buffer and their concentration measured by absorption spectrophotometry as previously described (39).
Analytical ultracentrifugation
SV experiments were carried out in a ProteomeLab XL-I analytical ultracentrifuge (Beckman Coulter, Indianapolis, IN) as previously described (81). Protein samples were loaded in cell assemblies comprising charcoal-filled Epon double-sector centerpieces of 3 or 12 mm pathlength and sapphire windows. The samples were temperature equilibrated at 20°C in an AN-50 TI rotor, followed by acceleration to 50,000 rpm. Depending on the solution composition of the samples, data were acquired with Rayleigh interference optics and absorbance optics at 230, 260, and/or 280 nm. Standard protocols were followed to calculate the sedimentation coefficient distribution c(s) for each data set using the software SEDFIT (82). For the concentration series of N:G215C, the integrated weight-average sedimentation coefficients, sw were assembled into sw isotherms and modeled with a monomer–dimer equilibrium in the software SEDPHAT (54).
Dynamic light scattering
Autocorrelation data were collected in a NanoStar instrument (Wyatt Technology, Santa Barbara, CA). 100 µL samples at 3 µM N-protein in the presence or absence of oligonucleotides were inserted into a 1 µL quartz cuvette (WNQC01-00, Wyatt Instruments), using excess sample to minimize impact of evaporation in the observation chamber. Laser light scattering was measured at 658 nm at a detection angle of 90°. For the temperature scans, a ramp rate of 1° min−1 was applied with 5 sec data acquisitions and averaging three replicates for each temperature point. Data were collected and processed by using software Dynamics 7.4 (Wyatt Instruments) or SEDFIT.
Mass photometry
The mass distribution of N:G215C was determined using a Refeyn One instrument (Refeyn, Oxford, UK). The measurements followed the standard protocol (83). Briefly, 10 µL of freshly filtered buffer was loaded in a well of a gasket (CultureWell, GBL103250, Sigma, MO) for image focusing, and then 10 µL of protein solution was added to a final concentration of 10 nM and mixed by pipetting. Immediately after the mixing, a 1-minute video was recorded using the AcquireMP software (Refeyn, UK). The video was processed by using the DiscoverMP software (Refeyn, UK) and the contrast value of each protein molecule was converted to mass with calibration obtained from an unstained protein ladder (LC0725, Thermofisher, Wattham, MA).
CD spectroscopy
CD spectra were acquired in a Chirascan Q100 (Applied Photophysics, UK). Samples were measured in 1 mm pathlength cells, with 1 nm steps, and 1 sec integration time. Results are averages of three acquisitions. Backgrounds of corresponding buffers (with or without oligonucleotides, respectively) were subtracted. For temperature scans, data were acquired in 1 nm intervals with integration times of 0.5 sec, without repeats, applying a temperature ramp rate of 1°C min−1. The Global3 software from Applied Photophysics was used to deconvoluted the multiwavelengths temperature scans.
Microscopy of in vitro liquid–liquid phase separated condensates
The in vitro phase separation assays were performed at 23°C. N protein was studied in the presence of oligonucleotides T10 or T20 at different concentrations in the working buffer (Na2PO4 10.1 mM, KH2PO4 1.8 mM, KCl 2.7 mM, NaCl 10 mM, and pH 7.40) or working buffer supplemented with 1 mM TCEP. Samples were mixed in 1.7 mL microcentrifuge tubes and then immediately transferred onto a glass-bottom 35 mm dish (catalog # part no: P35G-1.5–20-C, MatTek). Condensates from LLPS were imaged within 30 to 40 min. Images were acquired on a Nikon Ti-E microscope equipped with a Prime 95B camera (Teledyne Photometrics) with sensor dimensions of 1,200 × 1,200 pixels. Images were collected using a 100X, 1.49 NA oil objective lens with a pixel size of 110 nm. The transmitted light source was a collimated white light LED (Lumencor PEKA) passed through a green interference filter.
Differential scanning fluorometry
Thermal scans with measurement of the intrinsic fluorescence of the protein samples were carried out using a Tycho instrument (Nanotemper, Germany). 10 µL samples were loaded in capillaries (TY-C001, Nanotemper). The intrinsic protein fluorescence was measured at 350 and 330 nm, and the first derivative of the intensity ratio was calculated as a function of temperature. The temperature ramp rate was 30°C min−1 and data were acquired from 35 to 95°C.
Funding
This work was supported by the Intramural Research Programs of the National Institute of Biomedical Imaging and Bioengineering (ZIA EB000095-02), the National Institute of Allergy and Infectious Diseases, the National Heart, Lung, and Blood Institute, and the National Institute of Neurological Disorders and Stroke, National Institutes of Health.
Supplementary Material
ACKNOWLEDGEMENTS
We thank Drs Dominic Esposito, Myungwoon Lee, Robert Tycko, and Harshad Vishwasrao for the helpful discussions and sharing of resources. This work utilized the computational resources of the NIH HPC Biowulf cluster for sequence analyses and dynamics simulations.
Notes
Competing Interest: The authors declare no competing interest.
Contributor Information
Huaying Zhao, Laboratory of Dynamics of Macromolecular Assembly, National Institute of Biomedical Imaging and Bioengineering, National Institutes of Health, Bethesda, MD 20892, USA.
Ai Nguyen, Laboratory of Dynamics of Macromolecular Assembly, National Institute of Biomedical Imaging and Bioengineering, National Institutes of Health, Bethesda, MD 20892, USA.
Di Wu, Biophysics Core Facility, National Heart, Lung, and Blood Institute, National Institutes of Health, Bethesda, MD 20892, USA.
Yan Li, Proteomics Core Facility, National Institute of Neurological Disorders and Stroke, National Institutes of Health, Bethesda, MD 20892, USA.
Sergio A Hassan, Bioinformatics and Computational Biosciences Branch, National Institute of Allergy and Infectious Diseases, National Institutes of Health, Bethesda, MD 20892, USA.
Jiji Chen, Advanced Imaging and Microscopy Resource, National Institutes of Health, Bethesda, MD 20892, USA.
Hari Shroff, Advanced Imaging and Microscopy Resource, National Institutes of Health, Bethesda, MD 20892, USA; Laboratory of High Resolution Optical Imaging, National Institute of Biomedical Imaging and Bioengineering, National Institutes of Health, Bethesda, MD 20892, USA.
Grzegorz Piszczek, Biophysics Core Facility, National Heart, Lung, and Blood Institute, National Institutes of Health, Bethesda, MD 20892, USA.
Peter Schuck, Laboratory of Dynamics of Macromolecular Assembly, National Institute of Biomedical Imaging and Bioengineering, National Institutes of Health, Bethesda, MD 20892, USA.
Authors' Contributions
H.Z. and P.S. conceived the study; H.Z., A.N., D.W., and Y.L. performed most of the experiments; S.A.H. carried out the MD simulations; H.Z. and P.S. performed the sequence analyses and biophysical modeling; H.Z., D.W., Y.L., J.C., H.S., G.P., and P.S. designed the experiments; H.Z. and P.S. wrote the initial drafts for the manuscript and made the figures. All authors read and approved the final manuscript.
Data availability
Detailed sequence variation data are contained in the figures and Supplementary Material. Raw data of the biophysical experiments are available from the authors (H.Z. and P.S.) on request.
References
- 1. McDonald I, Murray SM, Reynolds CJ, Altmann DM, Boyton RJ. 2021. Comparative systematic review and meta-analysis of reactogenicity, immunogenicity and efficacy of vaccines against SARS-CoV-2. npj Vaccines. 6(1). DOI: 10.1038/s41541-021-00336-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2. Li D, Sempowski GD, Saunders KO, Acharya P, Haynes BF. 2022. SARS-CoV-2 neutralizing antibodies for COVID-19 prevention and treatment. Annu Rev Med. 73(1):1–16. [DOI] [PubMed] [Google Scholar]
- 3. Cox RM, Wolf JD, Plemper RK. 2021. Therapeutically administered ribonucleoside analogue MK-4482/EIDD-2801 blocks SARS-CoV-2 transmission in ferrets. Nat Microbiol. 6(1):11–18. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4. Pruijssers AJ, et al. 2020. Remdesivir inhibits SARS-CoV-2 in human lung cells and chimeric SARS-CoV expressing the SARS-CoV-2 RNA polymerase in mice. Cell Rep. 32(3):107940. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5. Xiong M, et al. 2021. What coronavirus 3C-like protease tells us: from structure, substrate selectivity, to inhibitor design. Med Res Rev. 41(4):1965–1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6. Zhao M, et al. 2021. GCG inhibits SARS-CoV-2 replication by disrupting the liquid phase condensation of its nucleocapsid protein. Nat Commun. 12(1):2114. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7. Planas D, et al. 2021. Reduced sensitivity of SARS-CoV-2 variant Delta to antibody neutralization. Nature. 596(7871):276–280. [DOI] [PubMed] [Google Scholar]
- 8. Syed AM, et al. 2021. Rapid assessment of SARS-CoV-2 evolved variants using virus-like particles. Science. 374:1626–1632.. 6184:2021.08.05.455082. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9. Syed AM, et al. 2022. Omicron mutations enhance infectivity and reduce antibody neutralization of SARS-CoV-2 virus-like particles. medRxiv Prepr Serv Heal Sci. DOI: 10.1101/2021.12.20.21268048. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10. Mourier T, et al. 2022. SARS-CoV-2 genomes from Saudi Arabia implicate nucleocapsid mutations in host response and increased viral load. Nat Commun. 13(1):601. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11. Hadfield J, et al. 2018. NextStrain: real-time tracking of pathogen evolution. Bioinformatics. 34(23):4121–4123. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12. Marchitelli V, et al. 2021. Evidence for the dependence of the SARS-Cov-2 Delta high diffusivity on the associated N : G215C nucleocapsid mutation. Res Sq. 1–9. [Google Scholar]
- 13. Stern A, et al. 2021. The unique evolutionary dynamics of the SARS-CoV-2 Delta variant Israel Consortium of SARS-CoV-2 sequencing. medRxiv. DOI: 10.1101/2021.08.05.21261642. [DOI] [Google Scholar]
- 14. Elbe S, Buckland-Merrett G. 2017. Data, disease and diplomacy: GISAID's innovative contribution to global health. Glob Challenges. 1(1):33–46. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15. Munis AM, Andersson M, Mobbs A, Hyde SC, Gill DR. 2021. Genomic diversity of SARS-CoV-2 in Oxford during United Kingdom's first national lockdown. Sci Rep. 11(1):1–10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16. Ye Q, West AMV, Silletti S, Corbett KD. 2020. Architecture and self-assembly of the SARS-CoV-2 nucleocapsid protein. Protein Sci. 29(9):1890–1901. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17. Rochman ND, et al. 2021. Ongoing global and regional adaptive evolution of SARS-CoV-2. Proc Natl Acad Sci USA. 118(29):1–10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18. Popa A, et al. 2020. Genomic epidemiology of superspreading events in Austria reveals mutational dynamics and transmission properties of SARS-CoV-2. Sci Transl Med. 12(573):1–14. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19. Holland JJ, Domingo E. 1997. RNA virus mutations and fitness for survival. Annu Rev Microbiol. 51:151–178. [DOI] [PubMed] [Google Scholar]
- 20. Graudenzi A, Maspero D, Angaroni F, Piazza R, Ramazzotti D. 2021. Mutational signatures and heterogeneous host response revealed via large-scale characterization of SARS-CoV-2 genomic diversity. iScience. 24(2):102116. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21. Domingo E, Perales C. 2019. Viral quasispecies. PLos Genet. 15(10):1–20. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22. Domingo E, Garcia-Crespo C, Perales C. 2021. Historical perspective on the discovery of the quasispecies concept. Annu Rev Virol. 8:51–72. [DOI] [PubMed] [Google Scholar]
- 23. Acevedo A, Brodsky L, Andino R. 2014. Mutational and fitness landscapes of an RNA virus revealed through population sequencing. Nature. 505(7485):686–690. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24. Wylie CS, Shakhnovich EI. 2011. A biophysical protein folding model accounts for most mutational fitness effects in viruses. Proc Natl Acad Sci USA. 108(24):9916–9921. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25. Braun KM, et al. 2021. Acute SARS-CoV-2 infections harbor limited within-host diversity and transmit via tight transmission bottlenecks. PLoS Pathog. 17(8):1–26. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26. Chertow D, et al. 2021. SARS-CoV-2 infection and persistence throughout the human body and brain National Institutes of Health. Res Sq. DOI: 10.21203/rs.3.rs-1139035/v1. [DOI] [Google Scholar]
- 27. Tokuriki N, Oldfield CJ, Uversky VN, Berezovsky IN, Tawfik DS. 2009. Do viral proteins possess unique biophysical features?. Trends Biochem Sci. 34(2):53–59. [DOI] [PubMed] [Google Scholar]
- 28. Starr TN, et al. 2020. Deep mutational scanning of SARS-CoV-2 receptor binding domain reveals constraints on folding and ACE2 binding. Cell. 182(5):1295–1310.e20. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29. Garvin MR, et al. 2021. Rapid expansion of SARS-CoV-2 variants of concern is a result of adaptive epistasis. BioRxiv. 1–54. [Google Scholar]
- 30. Klein S, et al. 2020. SARS-CoV-2 structure and replication characterized by in situ cryo-electron tomography. Nat Commun. 11(1):5885. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31. Yao H, et al. 2020. Molecular architecture of the SARS-CoV-2 virus. Cell. 183(3):730–738.e13. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32. Tao K, et al. 2021. The biological and clinical significance of emerging SARS-CoV-2 variants. Nat Rev Genet. 22:757–773. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33. Li B, et al. 2021. Viral infection and transmission in a large, well-traced outbreak caused by the SARS-CoV-2 Delta variant. Nat Commun. 13:460. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 34. Teyssou E, et al. 2021. The Delta SARS-CoV-2 variant has a higher viral load than the Beta and the historical variants in nasopharyngeal samples from newly diagnosed COVID-19 patients. J Infect. 83(4):e1–e3. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35. Eyre DW, et al. 2021. The impact of SARS-CoV-2 vaccination on Alpha and Delta variant transmission. medRxiv. DOI: 10.1101/2021.09.28.21264260. [DOI] [Google Scholar]
- 36. Dinesh DC, et al. 2020. Structural basis of RNA recognition by the SARS-CoV-2 nucleocapsid phosphoprotein. PLoS Pathog. 16(12):e1009100. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37. Zinzula L, et al. 2021. High-resolution structure and biophysical characterization of the nucleocapsid phosphoprotein dimerization domain from the Covid-19 severe acute respiratory syndrome coronavirus 2. Biochem Biophys Res Commun. 538:54–62. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38. Chang CK, Hou MH, Chang CF, Hsiao CD, Huang TH. 2014. The SARS coronavirus nucleocapsid protein - forms and functions. Antiviral Res. 103(1):39–50. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39. Zhao H, et al. 2021. Energetic and structural features of SARS-CoV-2 N-protein co-assemblies with nucleic acids. iScience. 24(6):102523. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40. Cubuk J, et al. 2021. The SARS-CoV-2 nucleocapsid protein is dynamic, disordered, and phase separates with RNA. Nat Commun. 12(1):1936. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41. Lu S, et al. 2021. The SARS-CoV-2 nucleocapsid phosphoprotein forms mutually exclusive condensates with RNA and the membrane-associated M protein. Nat Commun. 12(1):502. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 42. Carlson CR, et al. 2020. Phosphoregulation of phase separation by the SARS-CoV-2 N protein suggests a biophysical basis for its dual functions. Mol Cell. 80(6):1092–1103.e4. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43. Iserman C, et al. 2020. Genomic RNA elements drive phase separation of the SARS-CoV-2 nucleocapsid. Mol Cell. 80:1078–1091. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44. Masters PS. 2019. Coronavirus genomic RNA packaging. Virology. 537(August):198–207. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45. Gussow AB, et al. 2020. Genomic determinants of pathogenicity in SARS-CoV-2 and other human coronaviruses. Proc Natl Acad Sci. 117(26):202008176. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46. Poran A, et al. 2020. Sequence-based prediction of SARS-CoV-2 vaccine targets using a mass spectrometry-based bioinformatics predictor identifies immunogenic T cell epitopes. Genome Med. 12(1):1–15. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 47. Guseva S, et al. 2021. 1H, 13C and 15N backbone chemical shift assignments of the n-terminal and central intrinsically disordered domains of SARS-CoV-2 nucleoprotein. Biomol NMR Assign. 15(2):255–260. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48. Koetzner CA, Hurst-Hess KR, Kuo L, Masters PS. 2022. Analysis of a crucial interaction between the coronavirus nucleocapsid protein and the major membrane-bound subunit of the viral replicase-transcriptase complex. Virology. 567:1–14. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49. Wu CH, et al. 2009. Glycogen synthase kinase-3 regulates the phosphorylation of severe acute respiratory syndrome coronavirus mucleocapsid protein and viral replication. J Biol Chem. 284(8):5229–5239. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50. Bouhaddou M, et al. 2020. The global phosphorylation landscape of SARS-CoV-2 infection. Cell. 182(3):685–712.e19. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51. Tugaeva K V., et al. 2021. The mechanism of SARS-CoV-2 nucleocapsid protein recognition by the human 14-3-3 proteins. J Mol Biol. 433(8):166875. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 52. Quayum ST, Hasan S. 2021. Analysing the impact of the two most common SARS-CoV-2 nucleocapsid protein variants on interactions with membrane protein in silico. J Genet Eng Biotechnol. 19(1):138. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53. Azad GK. 2021. The molecular assessment of SARS-CoV-2 nucleocapsid phosphoprotein variants among Indian isolates. Heliyon. 7(September 2020):e06167. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 54. Schuck P, Zhao H. 2017. Sedimentation velocity analytical ultracentrifugation: interacting systems. Boca Raton (FL): CRC Press. [Google Scholar]
- 55. Alberti S, Dormann D. 2019. Liquid–liquid phase separation in disease. Annu Rev Genet. 53(1):171–194. [DOI] [PubMed] [Google Scholar]
- 56. Kim TH, et al. 2021. Interaction hot spots for phase separation revealed by NMR studies of a CAPRIN1 condensed phase. Proc Natl Acad Sci USA. 118(23):1–11. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 57. Lin Y-H, Wu H, Jia B, Zhang M, Chan HS. 2021. Assembly of model postsynaptic densities involves interactions auxiliary to stoichiometric binding. Biophys J. 121: 157–171. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58. Wu C, et al. 2021. Characterization of SARS-CoV-2 nucleocapsid protein reveals multiple functional consequences of the C-terminal domain. iScience. 24(6):102681. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59. Peng Y, et al. 2020. Structures of the SARS-CoV-2 nucleocapsid and their perspectives for drug design. EMBO J. 39(20):e105938. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60. Zhou R, Zeng R, von Brunn A, Lei J. 2020. Structural characterization of the C-terminal domain of SARS-CoV-2 nucleocapsid protein. Mol Biomed. 1(1):2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 61. Schiavina M, Pontoriero L, Uversky VN, Felli IC, Pierattelli R. 2021. The highly flexible disordered regions of the SARS-CoV-2 nucleocapsid N protein within the 1–248 residue construct: sequence-specific resonance assignments through NMR. Biomol NMR Assign. 15(1):219–227. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62. Rubayet Ul Alam ASM, et al. 2022. Dominant clade-featured SARS-CoV-2 co-occurring mutations reveals plausible epistasis: an in silico based hypothetical model. 94(3):J Med Virol. 1035–1049. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63. Del Veliz S, Rivera L, Bustos DM, Uhart M. 2021. Analysis of SARS-CoV-2 nucleocapsid phosphoprotein N variations in the binding site to human 14-3-3 proteins. Biochem Biophys Res Commun. 569:154–160. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64. Savastano A, Ibáñez de Opakua A, Rankovic M, Zweckstetter M. 2020. Nucleocapsid protein of SARS-CoV-2 phase separates into RNA-rich polymerase-containing condensates. Nat Commun. 11(1):6041. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65. Wu H, et al. 2021. Nucleocapsid mutation R203K/G204R increases the infectivity, fitness and virulence of SARS-CoV-2. Cell Host Microbe. 29: 1788–1801.e6. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66. Zarin T, et al. 2019. Proteome-wide signatures of function in highly diverged intrinsically disordered regions. Elife. 8:1–26. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67. Bessa LM, et al. 2022. The intrinsically disordered SARS-CoV-2 nucleoprotein in dynamic complex with its viral partner nsp3a. Sci Adv. 8(3):eabm4034. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68. Wootton SK, Yoo D. 2003. Homo-oligomerization of the porcine reproductive and respiratory syndrome virus nucleocapsid protein and the role of disulfide linkages. J Virol. 77(8):4546–4557. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 69. Prokudina EN, Semenova NP, Chumakov VM, Rudneva IA. 2004. Transient disulfide bonds formation in conformational maturation of influenza virus nucleocapsid protein (NP). Virus Res. 99(2):169–175. [DOI] [PubMed] [Google Scholar]
- 70. Wu F, et al. 2020. A new coronavirus associated with human respiratory disease in China. Nature. 579(7798):265–269. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 71. Nextstrain.org Quality Control. https://docs.nextstrain.org/projects/nextclade/en/latest/user/algorithm/07-quality-control.html. (last accessed May 9, 2022). [Google Scholar]
- 72. Papadopoulos JS, Agarwala R. 2007. COBALT: constraint-based alignment tool for multiple protein sequences. Bioinformatics. 23(9):1073–1079. [DOI] [PubMed] [Google Scholar]
- 73. Robert X, Gouet P. 2014. Deciphering key features in protein structures with the new ENDscript server. Nucleic Acids Res. 42(W1):W320–W324. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 74. Rao JKM. 2009. New scoring matrix for amino acid residue exchanges based on residue characteristic physical parameters. Int J Pept Protein Res. 29(2):276–281. [DOI] [PubMed] [Google Scholar]
- 75. Hardenberg M, Horvath A, Ambrus V, Fuxreiter M, Vendruscolo M. 2020. Widespread occurrence of the droplet state of proteins in the human proteome. Proc Natl Acad Sci. 117:33254–33262. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 76. Jumper J, et al. 2021. Highly accurate protein structure prediction with AlphaFold. Nature. 596(7873):583–589. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 77. Yang J, et al. 2015. The I-TASSER suite: protein structure and function prediction. Nat Methods. 12(1):7–8. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 78. Kelley LA, Mezulis S, Yates CM, Wass MN, Sternberg MJE. 2015. The Phyre2 web portal for protein modeling, prediction and analysis. Nat Protoc. 10(6):845–858. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 79. Brooks BR, et al. 2009. CHARMM: The biomolecular simulation program. J Comput Chem. 30(10):1545–1614. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 80. Huang J, et al. 2017. CHARMM36m: an improved force field for folded and intrinsically disordered proteins. Nat Methods. 14(1):71–73. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 81. Schuck P, Zhao H, Brautigam CA, Ghirlando R. 2015. Basic principles of analytical ultracentrifugation. Boca Raton (FL): CRC Press. [Google Scholar]
- 82. Schuck P. 2016. Sedimentation velocity analytical ultracentrifugation: discrete species and size-distributions of macromolecules and particles. Boca Raton (FL): CRC Press. [Google Scholar]
- 83. Wu D, Piszczek G. 2021. Standard protocol for mass photometry experiments. Eur Biophys J. 50(3–4):403–409. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
Detailed sequence variation data are contained in the figures and Supplementary Material. Raw data of the biophysical experiments are available from the authors (H.Z. and P.S.) on request.



