Skip to main content
Viruses logoLink to Viruses
. 2022 Jun 23;14(7):1371. doi: 10.3390/v14071371

Antigenicity Alternations of Variant PEDV S Protein Disclosed by Linear B Cell Epitope Mapping

Ruisong Yu 1,, Shijuan Dong 1,, Bingqing Chen 1, Yingjie Liu 1,, Fengping Li 1,§, Fusheng Si 1, Chunfang Xie 1, Zhen Li 1,*
Editor: Pinghuang Liu1
PMCID: PMC9322158  PMID: 35891352

Abstract

The spike protein (S) plays a crucial role in porcine epidemic diarrhea virus (PEDV) infection and induces neutralizing antibodies. Mutations of the S protein are supposed to provide the main antigenic shift leading to the antigenic escape of PEDVs. It is therefore a significant question how much accumulation of antigenic shift could lead to the antigenic escape of the variant PEDV. To provide an answer in the study, B cell epitopes (BCEs) on the S protein of the PEDV vaccine strain CV777 (SCV777) and variant strain SD2014 (SSD2014) were mapped using biosynthetic peptides and rabbit anti-PEDV S serum. Seventy-nine and 68 linear BCEs were identified from SCV777 and SSD2014, respectively. While 66.2% of the BCEs of SSD2014 could be recognized by anti-SCV777 serum and 67.1% of SCV777 BCEs could be recognized by anti-SSD2014 serum, more than 40% of the BCEs identified using anti-SCV777 serum on SCV777 could not be recognized by anti-SSD2014 serum and vice versa. The completely shared BCEs took low percentages of 29.4% and 25.3% for SSD2014 and SCV777, respectively. These results indicate a low conservation of antigenicity of the S protein compared to a relatively high amino acid sequence similarity of 92.2% between the two strains. The study provided a BCE shift reference of PEDV antigenic escape and surveillance control.

Keywords: porcine epidemic diarrhea virus, spike protein, epitope mapping, antigenic alteration

1. Introduction

Porcine epidemic diarrhea virus (PEDV), a member of Alphacoronavirus in the family Coronaviridae, causes acute and highly contagious enteric disease in pigs and is designated as porcine epidemic diarrhea (PED). The pathogen was first detected in Europe in the early 1970s [1,2]. Since the 1980s, PED has become a severe problem in pig-producing countries in Europe and Asia, especially in Asia, including China, Korea, Japan, and Thailand [1,3]. In late 2010, a novel variant of PEDV emerged in Asia and became prevalent in swine herds worldwide [2,4,5]. Variants of PEDV caused failure of vaccination, which employed traditional vaccine technology and classical PEDV strains and brought great economic loss to the livestock industry.

Among the structural proteins of PEDV, the spike (S) protein plays pivotal roles in PEDV attachment, receptor binding, and virus–cell membrane fusion during PEDV invasion into host cells [6]. The PEDV S protein is also involved in the induction of neutralizing antibodies in the host [7], so for this reason the S protein also represents one of the most genetically unstable structural proteins of PEDV. In addition to the typical amino acid (aa) “deletion and insertion”, many aa substitutions are found scattered across the S protein of field strains as compared to the classical strain CV777 [3,8]. Given the important role in the induction of neutralizing antibodies, there is a high probability that the variations of the S protein contribute to the main antigenicity shift and antigenic escape of the PEDV field strain.

Important neutralizing regions had been screened out from the PEDV S protein, such as the N-terminal domain [9,10], CO-26K equivalent (COE) epitope [7,9,10], S1D epitope [11,12], and C-terminal epitope [13,14]. These regions, however, also carry the most mutations in circulating PEDVs due to high immune pressure [15,16,17,18]. The comparison of antigenicity contour and composition between vaccine and wild-type PEDV was important for understanding the emergence of virulent strains and the mechanisms of unsuccessful vaccination. Such studies would also be of great importance for vaccine development and antibody detection.

The highly virulent PEDV SD2014 strain was the etiology of a PED epidemic in a farm in Shandong Province of China in 2014. Whole-genome phylogenetic analysis showed that PEDV SD2014 belongs to the Genotype II subclass, clustered together with the re-emergent virulent variant PEDV strains, including US strains. Compared to the S protein of the classical strain (Genotype I), the S protein of SD2014 strain (SSD2014) has the typical insertion and deletion found in the S protein of current epidemic strains. In the present study, fragments of S proteins of the PEDV classical vaccine strains CV777 (SCV777) and SSD2014 were expressed and purified to immunize rabbits. Using the polyclonal sera acquired, the linear B cell epitopes (BCEs) were identified from serial glutathione S-transferase (GST)-fusion expressed 16-mers covering the entire sequences of SCV777 and SSD2014. Recognition efficiency of the anti-sera to the BCEs was analyzed on the two S proteins. The results confirm the low conservation of antigenicity of the S protein of the wild-type PEDV strain SD2014 compared with the classical strain CV777. The study provided a clear BCE comparison of the S proteins of the two PEDV strains, which laid a solid foundation for antigenicity variation and an antigenic escape analysis of wild-type PEDV.

2. Materials and Methods

2.1. B Cell Epitope Prediction

Sequence alignment of SCV777 (ALS35469.1) and SSD2014 (AND76936) was performed with Mega 7 (Temple University, Philadelphia, PA, USA). Online server IEDB (Immune Epitope Database and Analysis Resource, http://www.iedb.org/home_v3.php (accessed on 17 January 2022)) was used for BCE prediction. Seven residue-length epitopes were viewed as adequate to persuade defensive immune reaction. Only those epitopes predicted by no less than three algorithms were chosen. VaxiJen 2.0 server (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html (accessed on 24 January 2022)) was utilized for antigenicity analysis of chosen epitopes.

2.2. Preparation of Recombinant PEDV S Protein

Recombinant S protein (SCV777 or SSD2014) employed as the immunization antigen was prepared as described previously [19]. Briefly, the codon-optimized S gene was synthesized, cloned into pET-28a or pET-32a in three segments (sf1, 1 to 1488 nt; sf2, 1441 to 2928 nt; and sf3, 2881 nt to the end), and expressed in Escherichia coli (E. coli) BL21. After separation of the expressed protein by SDS-PAGE and purification by electro-elution of the excised gel band, the protein segment was concentrated with PEG 8000 and stored at −80 °C prior to use.

2.3. Immunization of Animals

Nineteen female New Zealand white rabbits (~2 kg body weight) were purchased from the Shanghai SLAC Laboratory Animal Co. Ltd. (Shanghai, China). The trial was approved by the Institutional Animal Care and Use Committee of Shanghai Academy of Agricultural Sciences (SAAS, Shanghai, China) (protocol code: SAASPZ0521023, 21 February 2021), and animals were treated in accordance with the regulations and guidelines of the committee. Eighteen rabbits were used for the immunization with the six S protein fragments (SFs) prepared as in 2.2 (3 fragments per S protein, SF1 to SF3 and 3 rabbits for each SF). Three rabbits were injected intramuscularly with 0.5 mg of each purified recombinant SF (SF1, SF2, or SF3) emulsified in complete Freund’s adjuvant (CFA) (Sigma_Aldrich, San Francisco, CA, USA) at multiple sites on the back of each animal. Three booster injections of 0.25 mg of the same antigen per injection in incomplete Freund’s adjuvant were administered at two-week intervals. Animals were bled 7 days after the third booster, and the serum was separated and stored at −80 °C until use. The mixed sera from 3 rabbits immunized with each SF were used in the following-up tests. Non-immune serum from the remaining one rabbit that received only CFA was used as the negative control.

2.4. Biosynthesis of 16-Mer Peptides

The truncated glutathione S-transferase (the initial 188 aa, GST188) was used as carrier for the expression of 16-mer peptides. One hundred and seventy-one 16-mer peptides and one 14-mer peptide with an overlap of 8 aa residues covering the entire SCV777 (or 172 16-mers and one 10-mer for SSD2014) were expressed as fusion protein as described earlier [19]. Briefly, the synthesized and then annealed DNA fragments encoding each a 16-mer or 14-mer or 10-mer peptide, incorporated with BamH I and TAA-Sal I cohesive ends on their 5′- and 3′-terminals, respectively, were inserted into the BamH I and Sal I sites of plasmid pXXGST-1. The confirmed recombinant plasmids were transformed into E. coli BL21 and temperature-induced to express the fusion peptides. Positive clones were selected by SDS-PAGE. Cell pellets containing each fusion peptide were stored at −20 °C until BCE mapping by Western blot (WB).

2.5. SDS-PAGE and WB

Cell pellets were resolved by SDS-PAGE using 15% gels. Gels were either stained with Coomassie Brilliant Blue G-250 (Sigma_Aldrich, San Francisco, CA, USA) for confirming the bands of fusion proteins or processed for WB by electro-transferring the proteins onto 0.2 μm polyvinylidene difluoride (PVDF) membrane (Immobilon®-PSQ, Merck Millipore Ltd., Darmstadt, Germany). Membranes were then blocked with 5% (w/v) skimmed milk powder in tris-buffered saline with 0.1% tween 20 (TBST), incubated sequentially with anti-S serum (dilution, 1:4000 in TBST) and goat anti-rabbit IgG conjugated to horseradish peroxidase (dilution, 1:80,000 in TBST) (Protein Tech Group, Inc., Chicago, IL, USA), and visualized by enhanced chemiluminescence using ECL plus Western blot detection reagent (PierceTM, Rockford, IL, USA) according to the manufacturer’s instructions.

2.6. Immunofluorescence Assay (IFA)

Vero cells were seeded in a 24-well plate and infected with attenuated PEDV DR13 (belonging to the GI subclass, kept in our laboratory) when the cells reached approximately 80% confluence. At 18 h post infection, the cells were fixed with 4% paraformaldehyde for 15 min and then permeabilized with 0.1% Triton X-100 for 15 min at room temperature. After being washed three times in phosphate-buffered saline (PBS), the cells were blocked with 5% goat serum in PBS for 1 h at 37 °C and then incubated with rabbit anti-SFs serum (harvested in Section 2.3; dilution, 1:2000 in 5% goat serum) for 50 min. After three washes with PBS, cells were incubated with Alexa Fluor 647 goat anti-rabbit IgG (H + L) antibody (Beyotime Biotech Inc., Shanghai, China) in the dark for 45 min at 37 °C. Following several washes, cells were stained with 4′, 6-diamidion-2-phenylindole (DAPI, Merck, Darmstadt, Germany), and the fluorescence was visualized with Zeiss Axio Scope A1 microscope (Carl Zeiss, Oberkochen, Germany).

2.7. Immunohistochemistry Assay (IHC)

For IHC, Vero cells grown in 24-well plate were infected with attenuated PEDV DR13. At 18 h post infection, the cells were fixed and permeabilized and then air dried and incubated with rabbit anti-SF polyclonal antibody (harvested in Section 2.3) at a dilution of 1:50 in a humidified chamber at 37 °C for 60 min. After three washes with PBST (PBS with 0.1% Tween-20), the cells were incubated for 50 min at 37 °C with the Horseradish peroxidase (HRP)-labeled goat anti-rabbit IgG (Beyotime Biotech Inc., Shanghai, China) at a dilution of 1:200 in PBST. The cells were again washed 3 times with PBST, followed by incubation for 4–5 min at room temperature in diaminobenzidine solution (Solarbio, Beijing, China). Cell staining was examined using Nikon light microscope (Nikon corporation, Tokyo, Japan).

3. Results

3.1. Prediction of BCEs on SCV777 and SSD2014

As in other alphacoronaviruses, the PEDV S protein can be divided into S1 and S2 subunits, and each subunit is composed of several functional domains (Figure 1). The aa sequence identity of SCV777 and SSD2014 was 92.21%. Compared to SCV777, SSD2014 has 108 differential residues including the insertion of 59QGVN62 and 140N and the deletion of 160G typically found in the S protein of variant PEDV strains. Most of the differential residues in the S1 subunit are in the S10 domain (46/80) and S1A domain (23/80), while the 28 differential residues in the S2 subunit scatter over different functional domains except fusion peptide (FP) and transmembrane domain (TM) (Figure 2).

Figure 1.

Figure 1

Schematic diagram of porcine epidemic diarrhea virus (PEDV) spike (S) protein. Different domains of S protein of PEDV CV777 (SCV777) (ALS35469.1) are colored. SP, signal peptide; 0, S10; A, S1A; B, S1B; CD, S1CD; FP, fusion peptide; HR1, heptapeptide repeat 1; HR2, heptapeptide repeat 2; and TM, transmembrane domain. Numbers shown below the long bar denote the beginning and end amino acids of each domain.

Figure 2.

Figure 2

Amino acid sequence comparison of SCV777 and S protein of PEDV SD2014 (SSD2014). Amino acid sequences of SCV777 and SSD2014 (AND76936) were aligned with Mega 7. Differential amino acids were shaded with grey. The identical amino acid in the sequence of SSD2014 was substituted with a “.”; The amino acid in rectangle was the insertion/deletion site.

Thirty-five and 34 BCEs were predicted on SCV777 and SSD2014, respectively (Table 1). Among the predicted epitopes, 15 BCEs on SCV777 and 19 BCEs on SSD2014 have an antigenicity value greater than 0.4, which is the default threshold for viral antigen by Vaxijen 2.0, and were coined as dominant BCEs. E7 was predicted to have the highest antigenicity at position 186 to 192 aa of SCV777 (2.1198), while the strongest antigenicity on SSD2014 was predicted at position 133 to 146 aa with an antigenic value of 1.0705 (Table 1). No epitope was predicted on the signal peptide (SP), FP, and TM domains of the two S proteins.

Table 1.

Predicted epitopes on S protein of PEDV CV777 (SCV777) and that of PEDV SD2014 (SSD2014).

SCV777 SSD2014
No. Position Sequences Antigenicity a No. Position Sequences Antigenicity
E1 19–30 LPQDVTRCQSTIN 0.0361 E1 21–28 QDVTRCSA −0.0665
E2 52–62 AVVVLGGYLPSMNSSSWY 0.1657 E2 55–64 IGENQGVNST 0.3703
E3 65–72 TGIETDSG 0.3072 E3 70–76 QHPTASG 0.9738
E4 91–100 ISQEPFDPSG 0.6991 E4 95–105 ISQEPFDPSGY 0.6324
E5 102–110 QLYLHKATN −0.3804
E5 111–120 KATNGNTNAT 0.4115
E6 125–142 QLYLHKATNGNTSAIARLRICQFPDNKTLGPTVNDVTTGRN 0.3121 E6 133–146 TLGPTANNDVTTGR 1.0705
E7 186–192 SRVATRC 2.1198 E7 188–194 DWSRVAT 0.5834
E8 195–202 KRSCAMQY 0.2537
E9 215–223 SAGEDGIYY −0.0055 E8 219–233 SAGEDGISYQPCTAN 0.0702
E10 226–232 CTANCSG −0.4497
E11 238–248 FATDSNGHIPE −0.7913 E9 244–253 TEPNGHIPEG −0.7045
E12 297–310 QTMDGVCNGAAAQR 0.4745 E10 301–307 QTIDGVC 1.0282
E13 347–353 NSSDPHK 0.2269 E11 350–356 SNSSNPH 0.4187
E14 372–378 KVDTYKS −1.422
E15 423–432 TGHGTDDDVS 0.5537 E12 427–436 TGHGTDDDVS 0.5537
E16 461–475 DDPVSQLKCSQVSFD 0.8676 E13 465–473 DDPVSQLKC 0.4517
E17 483–490 ISSRNLLS 0.4671
E14 520–526 SFGGHSG 0.4737
E18 528–535 SDTTINGF −0.3571 E15 530–539 IASDTTINGF −0.4022
E19 555–573 NSYGYVSKSQDSNCPFTLQ 0.8752 E16 559–575 NSYGYVSKSQDSNCPFT 0.7085
E17 608–613 EFGSGV 0.6906
E20 622–634 ELITGTPKPLQGV 0.1569 E18 627–640 LITGTPKPLEGVTD 0.2387
E21 688–694 GAVYSVT 0.0153
E22 716–728 LSNSTFNNTRELP 0.4482 E19 720–732 LSSSTFNSTRELP 0.2311
E23 734–744 SNDGSNCTEPV 0.3639 E20 738–747 SNDGSNCTEP 0.4006
E21 762–775 IGYVPSQSGQVKIA 0.8513
E24 800–817 VSVDCVTYVCNGNSRCKQ 0.8176 E22 803–819 PVSVDCATYVCNGNSRC 0.5376
E25 860–869 ISSFNGDGYN −0.77 E23 865–873 SSFNGDGYN −0.7927
E26 875–887 GVSVYDPASGRVV 0.5215 E24 879–893 GVSVYDPASGRVVQR 0.6336
E27 904–921 NGLGTVDEDYKRCSNGRS 0.2071 E25 906–925 VTNGLGTVDEDYKRCSNGRS 0.2239
E28 1013–1024 VKEAISQTSNGL 0.0891 E26 1017–1030 VKEAISQTSKGLNT 0.3561
E29 1037–1043 VVNSQGS −0.0001
E27 1064–1070 SSSIDDI 0.4527
E30 1118–1131 CVKSQSQRYGFCGG 0.6518 E28 1101–1135 TLTKYTEVQASRKLAQQKVNECVKSQSQRYGFCGG 0.2232
E31 1205–1214 MFEPRKPTVS 0.4124 E29 1194–1218 LQNHTATEYFVSSRRMFEPRKPTVS 0.0433
E32 1230–1243 TSDQLPDVIPDYID 0.4996 E30 1233–1246 LTRDQLPDVIPDYI 0.3167
E33 1256–1262 PNRIGPS 1.1446 E31 1259–1267 LPNRTGPSL 0.9542
E34 1280–1297 ADLEQRSESLRNTTEELR 0.615 E32 1284–1300 ADLEQRSESLRNTTEEL 0.5571
E35 1348–1373 TGCCGCCGCCGACFSGCCRGPRLQPY −0.2869 E33 1351–1361 STGCCGCCGCC −0.5985
E34 1364–1376 CFSGCCRGPRLQP 0.1851

Note: a, Epitopes with antigenicity that scored higher than 0.4 were coined as dominant B cell epitopes (BCEs) and are shown in bold italics.

Compared to SCV777, amino acid variations on SSD2014 led to the generation of five new BCEs located on the S10 (E5), S1B (E14 and E17), ahead of FP (E21), and heptapeptide repeat 1 (HR1) (E27) domains, respectively, and elimination of six previous BCEs, which were distributed on the S10 (E5 and E8), S1A (E14 and E17), S1CD (E21), and HR1 (E29) domains. Similarly, amino acid variation on SSD2014 generated nine new dominant epitopes, distributed on the S10 (E3, E5, and E6), S1A (E11), S1B (E14 and E17), ahead of FP (E20 and E21), and HR1 (E27) domains and eliminated five previous dominant BCEs, which were distributed on the S1A (E17), S1CD (E22), and ahead of heptapeptide repeat 2 (HR2) (E30 to E32) domains.

3.2. Reactivity of Acquired Anti-S Sera with PEDV DR13

Before identifying linear BCEs on the S protein with the prepared rabbit anti-S sera, IFA and IHC were firstly performed to investigate whether the six anti-S segment sera could react with PEDV DR13. As shown in Figure 3A,B, all the six anti-S fragment sera could specifically recognize the PEDV DR13 strain. The negative control serum could not stain PEDV DR13 (Figure 3A,B). These results show that the acquired sera could bind to PEDV specifically. Although the results of IHC show that there is no obvious difference among the three anti-SF (SF1, SF2, and SF3) sera in the reactivity with the attenuated DR13 strain (Figure 3A), the IFA intensities with the anti-SF2 serum and anti-SF3 serum as the primary antibodies were obviously stronger than that with anti-SF1 serum as the primary antibodies (Figure 3B).

Figure 3.

Figure 3

Reactivity of anti-S sera with attenuated PEDV DR13 detected by immunohistochemistry assay (IHC) (A) and immunofluorescence assay (IFA) (B). Cells were infected with PEDV DR13 at multiplicities of infection (MOI) of 0.1, and at 18 h postinfection (h.p.i.), cells were fixed and stained with anti-S sera. For IHC, Horseradish Peroxidase (HRP)-labeled goat anti-rabbit IgG was used as the secondary antibody. Then cells were incubated with diaminobenzidine before visualization with a light microscope. For IFA, Alexa Flur 647 goat anti-rabbit IgG (H + L) was used as the secondary antibody, and 4’,6-diamidino-2’-phenylindole (DAPI) was used to visualize the cell nuclei.

3.3. Reactivity of Anti-S Sera with SCV777 and SSD2014

To test the binding ability of the prepared rabbit sera with SCV777 and SSD2014, the purified S protein segments were separated through SDS-PAGE and transferred onto PVDF film for WB with the sera, respectively. As shown in Figure 4, the sera could bind to the corresponding protein segments from both strains, indicating that co-recognized epitopes exist in all the three fragments of the PEDV S protein.

Figure 4.

Figure 4

Reactivity of anti-S protein fragment 1 (SF1) sera with SF1 (A), anti-SF2 serum with SF2 (B), and anti-SF3 serum with SF3 (C). (a). SDS-PAGE analysis of purified SFs. (b,c). Western blot analysis with anti-SFs of PEDV CV777 (SFsCV777) and anti-SFs of PEDV SD2014 (SFsSD2014) sera as the primary antibody, respectively. Lane M: Protein marker; lane 1 and 2: Purified SFsCV777 and SFsSD2014, respectively.

3.4. Identification of Positive 16-Mers on SCV777

To identify linear BCEs on SCV777, serial 16-mers and a 14-mer overlapping 8 aa were GST-fusion expressed in E. coli. Among the 171 16-mers and the single 14-mer segments covering the entire SCV777, four 16-mers (P166, P167, P169, and P170) in TM domain and cytoplasmic tail (CT) could not be expressed. A little surprisingly, P168 (1337–1352 aa) at the junction of TM and CT was efficiently expressed. The GST-fusion 16-mers were expressed in size about 22.4 kD (Figure 5A,D,G,J).

Figure 5.

Figure 5

SDS-PAGE and Western blotting analysis of 16-mer- and 14-mer SCV777-derived peptides. One hundred and seventy-one 16-mer peptides and one 14-mer peptide covering the entire SCV777 were glutathione S-transferase (the initial 188 aa, GST)-fusion expressed in Escherichia coli (E. coli) BL21. After induction, cells were harvested by centrifugation, and cell pellets were resolved by SAS-PAGE using 15% gels. Gels were either stained or processed for Western blots. Polyvinylidene difluoride (PVDF) membranes were first blocked with 5% (w/v) skimmed milk, incubated sequentially with anti-S serum and goat anti-rabbit IgG, and then visualized by enhance chemiluminescence. (A,D,G,J): SDS-PAGE analysis of 171 GST-fusion expressed 16-mers and one 14-mer. (B,E,H,K): Western blot analysis of 171 GST-fusion expressed 16-mers and one 14-mer with anti-SCV777serum. (C,F,I,L): Western blot analysis of 171 GST-fusion expressed 16-mers and one 14-mer with anti-SSD2014 serum. 1–172: GST-fusion expressed 16-mers (P1–P171) and 14-mer (P172).

In order to comprehensively study the BCE distribution on SCV777, anti-SCV777 serum and anti-SSD2014 serum were used to screen positive peptides from the serial GST-fusion expressed 16-mers (or 14-mers) by WB. Among 168 16/14-mers screened, 60 positive 16-mers and 1 positive 14-mer were identified by rabbit anti-SCV777 serum (Figure 5B,E,H,K), while 53 16-mers could be recognized by rabbit anti-SSD2014 serum (Figure 5C,F,I,L). In total, 78 positive reactive 16-mers and 1 14-mer were identified by WB using the two kinds of anti-sera, among which 35 16-mers (P4–P5, P13, P17, P24, P26–P28, P30–P31, P50, P57–P61, P71, P75, P88–P89, P91, P110, P112–P114, P117–P118, P122, P134, P136, P154–P156, and P158–P159) could be recognized by both anti-SCV777 serum and anti-SSD2014 serum and were coined as Co-RecoMers. Of the remaining positive 16-mers or 14-mer, 26 (P8–P9, P16, P32–P33, P38, P43–P45, P53–P54, P56, P62, P78–P79, P90, P102, P107, P111, P115–P116, P120–P121, P157, and P171–P172) and 18 (P18, P36–P37, P39–P40, P50, P55, P96–P98, P123, P133, P138, P148–P152, and P160) were specific for the anti-SCV777 serum and the anti-SSD2014 serum, respectively. Therefore, 77.2% of the 79 positive 16/14-mers of SCV777could be bound by its anti-serum, and 67.1% could be bound by anti-SSD2014 serum, indicating an obvious overlapping of antigenicity between the two S proteins.

Eleven (P4–P5, P8–P9, P13, P16–P18, P24, and P26–P27) out of the 79 positive 16/14-mers were located in the S10 domain, including three anti-SCV777 serum-specific (P8–P9 and P16) and one anti-SSD2014 serum-specific (P18) (Figure 6A). Twenty-four positive 16-mers were in the S1A domain, among which 10 (P32–P33, P38, P43–P45, P53–P54, P56, and P62) and 5 (P36–P37, P39–P40, and P55) were anti-SCV777 and anti-SSD2014 sera-specific, respectively. The other nine (P28, P30–P31, P50, and P57–P61) were Co-RecoMers (Figure 6A,B). Four positive 16-mers were in the S1B domain; P71 and P75 were Co-RecoMers, and P78 and P79 were specific for the anti-SCV777serum (Figure 6B). Four positive 16-mers were in the S1CD domain, among which P90 was anti-SCV777 serum-specific, and the other three (P88–P89 and P91) were Co-Recomers (Figure 6B). Six positive 16-mers were located in the region ahead of the FP domain of the S2 subunit, which included two anti-SCV777 serum-specific (P102 and P107) and three anti-SSD2014-specific (P96–P98) 16-mers and one Co-RecoMer (P110) (Figure 6B). Four positive 16-mers were identified on the FP domain, among which P111 was anti-SCV777 serum-specific, and P112–P114 were Co-RecoMers (Figure 6B). Six positive 16-mers were identified between FP and HR1, of which four (P115–P116 and P120–P121) were anti-SCV777serum-specific; the other two (P117–P118) were Co-RecoMers (Figure 6B,C). Six positive 16-mers were identified on the HR1 domain, of which three (P123, P133, and P138) were anti-SSD2014 serum-specific, and the other three (P122, P134, and P136) were Co-RecoMers (Figure 6C). Ten 16-mers were located ahead of HR2, of which one (P157) and five (P148–P152) were specific for the anti-SCV777 and anti-SSD2014 sera, respectively, and the remaining four (P154–P156 and P158) were Co-RecoMers (Figure 6C). Two 16-mers, one Co-RecoMers (P159) and one specific for the anti-SSD2014 serum (P160), were identified in HR2 domain (Figure 6C). One 16-mer (P171) and one 14-mer (P172) were in CT, both of which were specifically recognized by the anti-SCV777 serum (Figure 6C). No positive 16-mer was identified in the SP and TM domains as expected.

Figure 6.

Figure 6

Figure 6

Distribution of positive peptides on SF1CV777 (A), SF2CV777 (B), and SF2CV777 (C). The horizontal bar represents the primary structure of SCV777 protein, of which the functional domains are framed as Figure 1A. Numbers assigned to the 16-mer or 14-mer peptides are the same as in Figure 5. Numbers underlined mark the peptides that are anti-SCV777 serum-positive; Numbers in boxes mark peptides that are anti-SSD2014 serum-positive; Numbers with “*” mark peptides recognized by both anti-SCV777 serum and anti-SSD2014 serum (Co-RecoMers). The positions of each peptide in the SCV777 protein were indicated with superscripts. The arrow showed the boundary of S1/S2.

3.5. Identification of Positive 16-Mers on SSD2014

Using the same strategy as in 3.4 to identify linear BCEs on SCD2014, both anti-SCV777 and anti-SSD2014 sera were used to screen the positive peptides fusion-expressed with GST tags. Except for the 4 16-mers (P167–P170), which span part of the TM domain and its immediate downstream, the other 168 GST-fusion 16-mers or one 10-mer were successfully expressed (Figure 7). From the 169 expressed peptides, 56 and 45 positive 16-mers were identified by anti-SSD2014 and anti-SCV777 sera, respectively (Figure 7). Among the positive 16-mers identified, 33 (P4–P5, P13–P14, P17–P18, P22, P26–P28, P33, P60–P61, P89, P91–P92, P111–P114, P117–P118, P123, P135, P137, P149, P151, and P155–P160) were Co-RecoMers (Figure 7). Twelve positive 16-mers (P34, P54, P56, P62–P63, P76, P88, P107–P108, P116, P119, and P172) were anti-SCV777serum-specific, and 23 16-mers (P19, P30–P32, P35–P38, P40, P45, P50–P51, P71–P72, P93, P96–P98, P115, P125, P138–P139, and P150) were anti-SSD2014 serum-specific. Therefore, 68 positive 16-mer were totally identified on SSD2014, of which 66.2% could be recognized by anti-SCV777 serum, and 82.4% could be bound by their own anti-serum.

Figure 7.

Figure 7

SDS-PAGE and Western blotting analysis of 16-mer- and 10-mer SSD2014-derived peptides. One hundred and seventy-two 16-mer peptides and one 10-mer peptide covering the entire SSD2014 were GST-fusion expressed in E. coli BL21. After induction, cells were harvested by centrifugation, and cell pellets were resolved by SAS-PAGE using 15% gels. Gels were either stained or processed for Western blots. PVDF membranes were first blocked with 5% (w/v) skimmed milk, incubated sequentially with anti-S serum and goat anti-rabbit IgG, and then visualized by enhance chemiluminescence. (A,D,G,J): SDS-PAGE analysis of 172 GST-fusion expressed 16-mers and one 10-mer. (B,E,H,K): Western blot analysis of 172 GST-fusion expressed 16-mers and one 10-mer with anti-SSD2014 serum. (C,F,I,L): Western blot analysis of 172 GST-fusion expressed 16-mers and one 10-mer with anti-SCV777 serum. 1–173: GST-fusion expressed 16-mers (P1–P172) and 10-mer (P173).

Like the distribution of positive 16-mers on SCV777, no positive 16-mer was located at the SP and TM domain of SSD2014. Ten positive 16-mers (P4–P5, P13–P14, P17–P19, P22, and P26–P27) were in the S10 domain, among which P19 is anti-SSD2014-specific, and the other nine were Co-RecoMers (Figure 8A) (9/10). This finding was very special, as there was a high rate (90%) of Co-Recomers in this area. Twenty positive 16-mers were in the S1A domain, including 11 anti-SSD2014 serum-specific (P30–P32, P35–P38, P40, P45, and P50–P51), 5 (P34, P54, P56, and P62–P63) anti-SCV777 serum-specific, and 4 Co-RecoMers (P28, P33, and P60–P61) (Figure 8A,B). That means in the S1A segment, the anti-SCV777 serum-specific 16-mers take 42% of the positive 16-mers (9/21). Two (P71–P72) and one (P76) positive 16-mers in the S1B domain were specific for anti-SSD2014 and anti-SCV777 sera, respectively (Figure 8B) (1/3). One (P88) of the four positive 16-mers in the S1CD domain was anti-SCV777 serum-specific, and the other three (P89 and P91–P92) were Co-RecoMers (Figure 8B) (4/4). Eight positive 16-mers were in the region ahead of FP, among which four (P93 and P96–P98) and two (P107–P108) were anti-SSD2014 and anti-SCV777 sera-specific, respectively, and the other two (P111–P112) were Co-RecoMers (Figure 8B) (4/8). The two positive 16-mers (P113–P114) in FP were Co-RecoMers (Figure 8B) (2/2). Five positive 16-mers were located ahead of HR1, of which P115 was specific for anti-SSD2014 serum, and P116 and P119 were specific for anti-SCV777 serum, and the other two (P117–P118) were Co-RecoMers (Figure 8B) (4/5). Six positive 16-mers were in the HR1 domain, of which three (P125 and P138–P139) were specific for anti-SSD2014 serum, and the other three (P123, P135, and P137) were Co-RecoMers (Figure 8C) (3/6). Eight positive 16-mers located ahead of HR2, including 7 Co-RecoMers (P149, P151, and P155–P159) and one anti-SSD2014 serum-specific (P150) (Figure 8C) (7/8). One Co-RecoMer (P160) was identified in HR2 domain (Figure 8C) (1/1). In the CT of SSD2014, only one anti-SCV777 serum-specific 14-mer (P172) was identified (Figure 8C) (1/1).

Figure 8.

Figure 8

Figure 8

Distribution of positive peptides on SF1SD2014 (A), SF2SD2014 (B), and SF2SD2014 (C). The horizontal bar represents the primary structure of SSD2014 protein, of which the domains were framed as in Figure 1. Numbers assigned to the 16-mer or 10-mer peptides are the same in Figure 7. The numbers underlined mark peptides that are anti-SSD2014 serum-positive. The numbers in boxes mark the peptides that are anti-SCV777 serum-positive; Numbers with “*” mark peptides recognized by both anti-SCV777 serum and anti-SSD2014 serum (Co-RecoMers). The positions of each peptide in SSD2014 protein are indicated with superscripts. The arrow shows the boundary of S1/S2.

3.6. An Overview of Positive 16-Mers on SCV777 and SSD2014

Among the 68 Co-Recomers found in the two S proteins, only 20 (P4–P5, P13, P17, P26–P28, P60–P61, P89, P91, P112–P114, P117–P118, P155–P156, and P158–P159) were Co-Recomers on both S proteins (coined as Shared Co-RecoMers here) (Figure 5, Figure 7 and Figure 9). Nine of the Shared Co-Recomers resided in the high variant domains, S10 (5) and S1A (4).

Figure 9.

Figure 9

Comparative overview of positive 16-mers on SCV777 and SSD2014. The horizontal bar represents the primary structure of the S protein, of which the functional domains are framed as Figure 1. Numbers shown above the long bar denote the beginning and end amino acids of the S protein of PEDV. The short rectangles are positive 16-mers of SCV777 or SSD2014 (except P172, which was a 14-mer on SCV777). Short rectangles filled with red color are anti- SCV777 serum-specific 16-mers. Short rectangles filled with green color are anti-SSD201 serum-specific 16-mers. Short rectangles filled with blue color are Co-RecoMers. Numbers assigned to the 16-mer peptides are the same as in Figure 5 or Figure 7. The arrow show the boundary of S1/S2.

Some Co-RecoMers in one S protein had their corresponding positive 16-mers in the other S protein, but they could not be bound by both sera anymore. Five Co-RecoMers on SCV777 were no longer Co-RecoMers on SSD2014. These 16-mers on SSD2014 could only be bound by anti-SSD2014 serum (P30–P31, P50, and P71) or anti-SCV777 serum (P88). Likewise, eight Co-RecoMers on SSD2014 were not Co-RecoMers on SCV777. These 16-mers on SCV777 could only be recognized by anti-SCV777 serum (P33, P111, and P157) or anti-SSD2014 serum (P18, P123, P149, P151, and P160) (Figure 9).

There were 18 positive 16-mers, which appeared parallel on both proteins, but they were not Co-RecoMers. They could only be bound by one serum: Four positive 16-mers (P32, P38, P45, and P115) on the two S proteins could only be bound by their own anti-sera. Six positive 16-mers (P54, P56, P62, P107, P116, and P172) on the two proteins could only be bound by anti-SCV777 serum. On the opposite, eight 16-mers (P36–P37, P40, P96–P98, P138, and P150) on the two proteins could only be bound by anti-SSD2014 serum (Figure 9). Therefore, there were different kinds of 16-mers that existed parallel on the two S proteins: 20 Shared Co-RecoMers, 13 one-sided Co-RecoMers, and 18 non-Co-Recomers.

Among the positive 16-mers that resided in either of the two proteins, 28 16-mers were identified only on SCV777, which included 10 Co-RecoMers (P24, P57–P59, P75, P110, P122, P134, P136, and P154), 13 anti-SCV777 serum-specific (P8, P9, P16, P43–P44, P53, P78–P79, P90, P102, P120–P121, and P172), and 5 anti-SSD2014 serum-specific (P39, P55, P133, P148, and P152) (Figure 9). Meanwhile, 16 positive 16-mers were identified only on SSD2014, including 5 Co-RecoMers (P14, P22, P92, P135, and P137), 7 anti-SSD2014 serum-specific (P19, P35, P51, P72, P93, P125, and P139), and 5 anti-SCV777-specific (P34, P63, P76, P108, and P119) (Figure 9).

Collectively, among the 68 BCEs identified on SSD2014, only 13 (19.1%) Shared Co-Recomers in the S10 (5), S1A (2), S1CD (1), ahead of FP (1), FP (2), and ahead of HR2 (2) domains manifested the same antisera binding property as the corresponding Shared Co-Recomers on SCV777, which indicate that the incidence of exactly conserved BCE shared by the two S proteins was only 19.1%. The remaining 55 BCEs in the S10 (5), S1A (18), S1B (3), S1CD (3), ahead of FP (7), ahead of HR1 (5), HR1 (6), ahead of HR2 (6), HR2 (1), and CT (1) domains exhibited more or less difference in antisera binding ability compared with the corresponding 16-mers on SCV777, even with the other 7 Shared Co-Recomers. Furthermore, 28 BCEs on SCV777 (S10, 4; S1A, 8; S1B, 3; S1CD, 1; ahead of FP, 2; ahead of HR1, 2; HR1, 4; ahead of HR2, 3; and CT, 1) were missing on SSD2014, while 17 new BCEs formed on SSD2014 (S10, 3; S1A, 4; S1B, 2; S1CD, 1; ahead of FP, 2; ahead of HR1, 1; and HR1, 4). The above analysis demonstrates that the BCE conformity rate between the two strains was only 19.12% (13/68), albeit 66.2% of BCEs on SSD2014 could be recognized by anti-SCV777 serum. A total of 35.4% (28/79) of the BCEs distributed on nearly all functional domains (except FP and HR2) of SCV777 were obliterated from SSD2014, but at the same time, a quarter (17/68) of BCEs were newly formed on the latter

4. Discussion

Since late 2010, the highly virulent PEDV variants have led to heavy economic loss to the world swine industry due to the high mortality rate of infected newborn piglets [20,21]. The vaccination of sows with commercial vaccines based on classical strains, such as CV777, could not provide satisfactory protection in piglets [2,22]. Antigenic variations, especially variations in the S protein, between classical and emerging PEDV strains were proposed to be the reason for the failure of CV777 strain-based vaccines [8,22], but sufficient evidence for the theory was warranted. To address this issue, we compared the differences of linear BCEs on the S proteins of the CV777 vaccine strain (SCV777) and a virulent variant strain SD2014 (SSD2014) using a bioinformatics approach and experimental methods. We found that with a sequence similarity of 92.21% between SCV777 and SSD2014, only 66.2% polypeptides (16-mers) of SSD2014 could be recognized by the anti-SCV777 serum. The parallel existing Co-Recomers (shared Co-RecoMers) took percentages of 29.4 and 25.3 for SSD2014 and SCV777, respectively. The absolute BCE conformity rate between the two strains was only 19.12%. All these figures indicate a low conservation of antigenicity between the two S proteins and a considerate decrease in antigenicity if PEDV CV777 was the vaccine strain for wild-type PEDV prevention.

The prediction of B-cell epitopes by the in silico method has obvious advantages including faster outputs and lower costs. However, the process relies heavily on a combination of multiple methods based on different algorithms and experimental validation techniques [23,24,25,26]. A recent study also found that most of the predicted epitopes on the PEDV S protein could not be recognized by all the sera selected. This inconsistency was related not only to the prediction method itself but also to the background of the sera selected [26]. Although the BCEs were predicted with strict condition, positive 16-mers were identified only from 68.6% (24/35) of the predicted BCEs on SCV777 and 52.9% (18/34) of the predicted BCEs on SSD2014, and more than half of positive 16-mers were identified from non-predicted BCE locations of both proteins (43/79 on SCV777 and 36/68 on SSD2014). Even the 16-mers containing sequences of some of the top five antigenic epitopes (antigenicity > 0.8) predicted on SCV777 (P23, P24, P70, and P71) or on SSD2014 (P9, P96, and P158) were negative or weakly positive (Table 1 and Figure 5 and Figure 7). The results provide more evidence that bioinformation methods in predicting immunogenic and potentially protective epitopes were not reliable and needed experimental verification.

Although genetic variation leads to the formation of two genotypes of PEDV (GI and GII), and each genotype can be further divided into different subtypes, cross-protection between GI and GII was widely reported in previous studies [27,28,29,30]. For this reason, it is generally agreed that there is only one serotype of PEDV, and different genotypes share antigenic epitopes. While several cross-reactive monoclonal antibodies and their corresponding epitopes or binding regions were reported on the S protein [9,31,32,33,34], the positions of the shared epitopes on the S protein are poorly defined. In this study, we found that all sera prepared by immunizing rabbits with each of the three segments (SF1 to SF3) of SCV777 and SSD2014 could recognize the attenuated PEDV DR13 as analyzed by both IHC and IFA techniques (Figure 3). WB results also indicate that each anti-serum of the segments could recognize both the corresponding segments of SCV777 and the segments of SSD2014 as well (Figure 4). All these results demonstrate that shared epitopes exist in all three segments of the S protein. Positive 16-mers that could be bound by both anti-SCV777 and anti-SSD2014 sera were indeed identified on each of the three segments of the S protein in the study (Figure 9). In addition, the 20 shared Co-Recomers were distributed over all three segments of the S protein (Figure 9). A comparison of full-length PEDV spike sequences from field isolates showed that most sequence variation was found in the S1 subunit, but several cross-reactive (neutralizing) mAbs binding regions were also localized in the same area [9,31,32,34]. Eleven shared Co-Recomers overlapped with the binding regions of these mAbs suggesting that these shared 16-mers might be cross-reactivity epitopes recognized by these mAbs. In addition, nine new shared epitopes were identified in the S2 subunit, which were located within the FP (P112–P114), in the upstream region of the HR1 (P117–P118), and in the upstream region of the HR2 (P155–P156 and P157–P158), respectively. As the coronavirus S2 subunit plays important roles in the membrane fusion process [26], antibodies binding to these shared epitopes may result in inhibition of membrane fusion processes during viral cell entry of both genotype PEDVs. The identification of cross-reactive epitopes on the S protein not only provides epitope evidence for the serological cross-reaction and mutual neutralization between the GI and GII PEDV strains found in clinical trials, but also provides candidates for the development of a multi-epitope universal vaccine as well as for antibody detection.

The PEDV S protein contains different domains, whose roles in virus infection have been elucidated to varying degrees. The S10 domain was shown to bind sialic acid to facilitate virus infection [9,35]. While the S1A domain was speculated to interact with cell surface heparan sulfate as an attachment factor based on its structural similarity with the other alphacoronavirus S1A domain, the S1B domain was known as a receptor binding domain [9,26,36,37]. The S2 subunit, consisting of FP and two heptad repeats (HR1 and HR2) mediate virus-virus and virus–cell membrane fusion [27,36]. Antibodies binding to any of the functional domains of the S protein can interfere with the infection process of the viruses; therefore, potential antigenic epitopes contained in these domains have been drawing the attention of PEDV researchers. Neutralizing antibodies recognizing different domains of S1 or the region spanning the S1–S2 border of the PEDV S protein were reported [7,10,11,12,13]. Several linear epitopes were also identified in domains of the S1 subunit [11,12,31,33,38,39]. However, information of BCEs in the S2 subunit is limited, with only one neutralizing epitope identified [11,13,14]. In the present study, epitopes were predicted and identified by IEDB and WB, respectively, distributing in nearly all the functional domains of the S proteins of CV777 and SD2014, but the contour and composition of the epitopes on these two S proteins varied considerably (Table 1 and Figure 6, Figure 8 and Figure 9). On SCV777, 13 (16.5%) of the 79 BCEs were not bound by anti-SSD2014 serum, and 28 (35.4%) BCEs did not have counterparts on SSD2014. On the side of SSD2014, 16 (23.5%) of the 68 BCEs cannot be bound by anti-SCV777 serum, and 17 (25%) BCEs were newly formed compared with SCV777. The missed or non-bound BCEs scattered in different functional domains of the PEDV S protein except HR2. Especially in the receptor binding domain S1B where the core neutralizing epitope is located, there was no shared Co-RecoMer in this domain. Furthermore, three out of the four BCEs of SCV777 were missing on SSD2014. Likewise, two out of the three BCEs in the S1B domain of SSD2014 do not exist on SCV777. It is well known that change or deletion of antigenic epitopes in the neutralizing epitope region might lead to the immune escape of the variant strain against the classical strain-based vaccine [27,28,29]. The differential epitopes in multiple functional domains, especially in the neutralizing epitope-containing domains of the two PEDV S proteins, mean that the variant PEDV strain can escape the monitoring of antibodies in multiple steps of virus infection, such as receptor binding, S1/S2 cleavage, or membrane fusion process, to achieve the final immune escape.

BCEs are generally divided into linear BCEs and conformational BCEs [25]. Linear BCEs are continuous aa motifs in a protein, while conformational BCEs are aa clusters that are discontinuous in the primary structure but brought adjacent upon protein folding [40]. Although most neutralizing epitopes are conformational BCEs, and conformational BCEs require correct conformation to interact with their target antibody, short linear peptides (which can also be called linear BCEs) within the long conformational BCEs can be recognized by antibodies, and binding of these short linear BCEs to the antibody is sufficient to interfere with the neutralizing activity of the antibody [26]. On the other hand, neutralizing linear BCEs have also been identified on the S protein of PEDV [11,14,26]. In addition, accumulating evidence proves that cooperation among non-neutralizing antibodies can neutralize the virus, and non-neutralizing antibodies can strengthen the neutralization by a neutralizing antibody [33]. A previous study demonstrated that a non-neutralizing epitope peptide could significantly inhibit adsorption of PEDV to Vero cell surfaces [39]. Non-neutralizing antibodies have also been shown to play important roles in antiviral responses via antibody-dependent cellular cytotoxicity or Fc gamma receptor- and complement-dependent effector mechanisms in vivo [31]. The linear BCEs identified in this study will be the focus of future studies that evaluate their relevance to host antiviral responses.

In this study, rabbits instead of pigs were selected to generate antibodies because clean rabbits are easier to obtain than clean pigs, and rabbits were suitable for immune experiments to prepare a certain amount of serum based on economic consideration. As the natural host of PEDV, the sera from pigs immunized with PEDV S protein or more ideally, convalescent pigs infected with PEDV are theoretically preferred for BCE identification on the S protein. Future experiments will focus on identifying BCEs of the S protein by using high-quality porcine serum and check the possible bias from the findings using rabbit-generated antibodies.

5. Conclusions

Seventy-nine and sixty-eight linear BCEs (positive 16/14-mers) were identified on SCV777 and SSD2014, respectively, among which 20 BCEs were shared Co-Recomers. More than 40% of the BCEs recognized by anti-SCV777 serum on SCV777 cannot be recognized by anti-SSD2014 serum and vice versa. Therefore, compared with that of the classical vaccine strain CV777, antigenicity and immunity of S protein of variant PEDV strain SD2014 had changed significantly. Epitopes identified in this study provided a solid foundation for the rational design of multi-epitope-based vaccines and diagnostic techniques.

Acknowledgments

We are grateful to Wanxiang Xu, Shanghai Institute of Planned Parenthood Research, for kindly providing plasmid pXXGST-1.

Author Contributions

Conceptualization, R.Y. and Z.L.; Methodology, B.C.; Formal analysis, Y.L. and F.L.; Investigation, S.D., Y.L. and F.L.; Supervision, Z.L.; Validation, R.Y.; Visualization, F.S. and C.X.; Writing—original draft, R.Y. and S.D.; Writing—review and editing, Z.L.; Funding acquisition, R.Y. All authors have read and agreed to the published version of the manuscript.

Institutional Review Board Statement

The animal study protocol was approved by the ethics and animal welfare committee of Shanghai Academy of Agricultural Sciences, China (protocol code: SAASPZ0521023).

Informed Consent Statement

Not applicable.

Data Availability Statement

Not applicable.

Conflicts of Interest

The authors declare no conflict of interest.

Funding Statement

This work was supported by the National Key Research and Development Program of China (2016YFD0500101), the National Natural Science Foundation of China (32072838), Shanghai Key Project on Agricultural Development (2020-02-08-0012-F01478), and the Shanghai Academy of Agricultural Sciences (SAAS) Program for Excellent Research Team ([2022]-012).

Footnotes

Publisher’s Note: MDPI stays neutral with regard to jurisdictional claims in published maps and institutional affiliations.

References

  • 1.Antas M., Wozniakowski G. Current status of porcine epidemic diarrhoea (PED) in European pigs. J. Vet. Res. 2019;63:465–470. doi: 10.2478/jvetres-2019-0064. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Li W., Li H., Liu Y., Pan Y., Deng F., Song Y., Tang X., He Q. New variants of porcine epidemic diarrhea virus, China, 2011. Emerg. Infect. Dis. 2012;18:1350–1353. doi: 10.3201/eid1803.120002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Lin C.M., Saif L.J., Marthaler D., Wang Q. Evolution, antigenicity and pathogenicity of global porcine epidemic diarrhea virus strains. Virus Res. 2016;226:20–39. doi: 10.1016/j.virusres.2016.05.023. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Stevenson G.W., Hoang H., Schwartz K.J., Burrough E.R., Sun D., Madson D., Cooper V.L., Pillatzki A., Gauger P., Schmitt B.J., et al. Emergence of porcine epidemic diarrhea virus in the United States: Clinical signs, lesions, and viral genomic sequences. J. Vet. Diag. Invest. 2013;25:649–654. doi: 10.1177/1040638713501675. [DOI] [PubMed] [Google Scholar]
  • 5.Islam M.T., Kubota T., Ujike M., Yahara Y., Taguchi F. Phylogenetic and antigenic characterization of newly isolated porcine epidemic diarrhea viruses in Japan. Virus Res. 2016;222:113–119. doi: 10.1016/j.virusres.2016.06.006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Li D., Li Y., Liu Y., Chen Y., Jiao W., Feng H., Wei Q., Wang J., Zhang Y., Zhang G. Isolation and identification of a recombinant porcine epidemic diarrhea virus with a novel insertion in S1 domain. Front. Microbiol. 2021;12:667084. doi: 10.3389/fmicb.2021.667084. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Chang S.H., Bae J.L., Kang T.J., Kim J., Chung G.H., Lim C.W., Laude H., Yang M.S., Jang Y.S. Identification of the epitope region capable of inducing neutralizing antibodies against the porcine epidemic diarrhea virus. Mol. Cells. 2002;14:295–299. [PubMed] [Google Scholar]
  • 8.Wang D., Fang L., Xiao S. Porcine epidemic diarrhea in China. Virus Res. 2016;226:7–13. doi: 10.1016/j.virusres.2016.05.026. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Li C., Li W., Lucio de Esesarte E., Guo H., van den Elzen P., Aarts E., van den Born E., Rottier P.J.M., Bosch B.J. Cell attachment domains of the porcine epidemic diarrhea virus spike protein are key targets of neutralizing antibodies. J. Virol. 2017;91:e00273-17. doi: 10.1128/JVI.00273-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Chang C.Y., Cheng I.C., Chang Y.C., Tsai P.S., Lai S.Y., Huang Y.L., Jeng C.R., Pang V.F., Chang H.W. Identification of neutralizing monoclonal antibodies targeting novel conformational epitopes of the porcine epidemic diarrhoea virus spike protein. Sci. Rep. 2019;9:2529. doi: 10.1038/s41598-019-39844-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Okda F.A., Lawson S., Singrey A., Nelson J., Hain K.S., Joshi L.R., Christopher-Hennings J., Nelson E.A., Diel D.G. The S2 glycoprotein subunit of porcine epidemic diarrhea virus contains immunodominant neutralizing epitopes. Virology. 2017;509:185–194. doi: 10.1016/j.virol.2017.06.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Sun D., Li F., Shi H., Chen J., Cui X., Chen H., Liu S., Tong Y., Wang Y., Tong G. Identification of two novel B cell epitopes on porcine epidemic diarrhea virus spike protein. Vet. Microbiol. 2008;131:73–81. doi: 10.1016/j.vetmic.2008.02.022. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Cruz D.J., Kim C.J., Shin H.J. Phage-displayed peptides having antigenic similarities with porcine epidemic diarrhea virus (PEDV) neutralizing epitopes. Virology. 2006;354:28–34. doi: 10.1016/j.virol.2006.04.027. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Cruz D.J.M., Kim C.J., Shin H.J. The GPRLQPY motif located at the carboxy-terminal of the spike protein induces antibodies that neutralize Porcine epidemic diarrhea virus. Virus Res. 2008;132:192–196. doi: 10.1016/j.virusres.2007.10.015. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Zhao X., Li Z., Zeng X., Zhang G., Niu J., Sun B., Ma J. Sequence analysis of the spike gene of Porcine epidemic diarrhea virus isolated from South China during 2011–2015. J. Vet. Sci. 2017;18:237–243. doi: 10.4142/jvs.2017.18.2.237. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Zhang F., Luo S., Gu J., Li Z., Li K., Yuan W., Ye Y., Li H., Ding Z., Song D., et al. Prevalence and phylogenetic analysis of porcine diarrhea associated viruses in southern China from 2012 to 2018. BMC Vet. Res. 2019;15:470. doi: 10.1186/s12917-019-2212-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Than V.T., Choe S.E., Vu T.T.H., Do T.D., Nguyen T.L., Bui T.T.N., Mai T.N., Cha R.M., Song D., An D.J., et al. Genetic characterization of the spike gene of porcine epidemic diarrhea viruses (PEDVs) circulating in Vietnam from 2015 to 2016. Vet. Med. Sci. 2020;6:535–542. doi: 10.1002/vms3.256. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Kim S.H., Lee J.M., Jung J., Kim I.J., Hyun B.H., Kim H.I., Park C.K., Oem J.K., Kim Y.H., Lee M.H., et al. Genetic characterization of porcine epidemic diarrhea virus in Korea from 1998 to 2013. Arch. Virol. 2015;160:1055–1064. doi: 10.1007/s00705-015-2353-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Yu R., Zhu R., Gao W., Zhang M., Dong S., Chen B., Yu L., Xie C., Jiang F., Li Z. Fine mapping and conservation analysis of linear B-cell epitopes of peste des petits ruminants virus hemagglutinin protein. Vet. Microbiol. 2017;208:110–117. doi: 10.1016/j.vetmic.2017.07.008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Jung K., Saif L.J., Wang Q. Porcine epidemic diarrhea virus (PEDV): An update on etiology, transmission, pathogenesis, and prevention and control. Virus Res. 2020;286:198045. doi: 10.1016/j.virusres.2020.198045. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Sun Y., Chen Y., Han X., Yu Z., Wei Y., Zhang G. Porcine epidemic diarrhea virus in Asia: An alarming threat to the global pig industry. Infect. Genet. Evol. 2019;70:24–26. doi: 10.1016/j.meegid.2019.02.013. [DOI] [PubMed] [Google Scholar]
  • 22.Li Z., Ma Z., Li Y., Gao S., Xiao S. Porcine epidemic diarrhea virus: Molecular mechanisms of attenuation and vaccines. Microb. Pathog. 2020;149:104553. doi: 10.1016/j.micpath.2020.104553. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Abbott W.M., Damschroder M.M., Lowe D.C. Current approaches to fine mapping of antigen-antibody interactions. Immunology. 2014;142:526–535. doi: 10.1111/imm.12284. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Cherryholmes G.A., Stanton S.E., Disis M.L. Current methods of epitope identification for cancer vaccine design. Vaccine. 2015;33:7408–7414. doi: 10.1016/j.vaccine.2015.06.116. [DOI] [PubMed] [Google Scholar]
  • 25.Potocnakova L., Bhide M., Pulzova L.B. An Introduction to B-Cell Epitope Mapping and In Silico Epitope Prediction. J. Immunol. Res. 2016;2016:6760830. doi: 10.1155/2016/6760830. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Polyiam K., Ruengjitchatchawalya M., Mekvichitsaeng P., Kaeoket K., Hoonsuwan T., Joiphaeng P., Roshorm Y.M. Immunodominant and Neutralizing Linear B-Cell Epitopes Spanning the Spike and Membrane Proteins of Porcine Epidemic Diarrhea Virus. Front. Immunol. 2022;12:785293. doi: 10.3389/fimmu.2021.785293. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Opriessnig T., Gerber P.F., Shen H., de Castro A., Zhang J., Chen Q., Halbur P. Evaluation of the efficacy of a commercial inactivated genogroup 2b-based porcine epidemic diarrhea virus (PEDV) vaccine and experimental live genogroup 1b exposure against 2b challenge. Vet. Res. 2017;48:69. doi: 10.1186/s13567-017-0472-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Sato T., Oroku K., Ohshima Y., Furuya Y., Sasakawa C. Efficacy of genogroup 1 based porcine epidemic diarrhea live vaccine against genogroup 2 field strain in Japan. Virol. J. 2018;15:28. doi: 10.1186/s12985-018-0940-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Zhang Y., Chen Y., Yuan W., Peng Q., Zhang F., Ye Y., Huang D., Ding Z., Lin L., He H., et al. Evaluation of Cross–Protection between G1a and G2a-Genotype Porcine Epidemic Diarrhea Viruses in Suckling Piglets. Animals. 2020;10:1674. doi: 10.3390/ani10091674. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Lin C.M., Gao X., Oka T., Vlasova A.N., Esseili M.A., Wang Q., Saif L.J. Antigenic relationships among porcine epidemic diarrhea virus and transmissible gastroenteritis virus strains. J. Virol. 2015;89:3332–3342. doi: 10.1128/JVI.03196-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Sun Y.G., Li R., Xie S., Qiao S., Li Q., Chen X.X., Deng R., Zhang G. Identification of a novel linear B-cell epitope within the collagenase equivalent domain of porcine epidemic diarrhea virus spike glycoprotein. Virus Res. 2019;266:34–42. doi: 10.1016/j.virusres.2019.04.003. [DOI] [PubMed] [Google Scholar]
  • 32.Liu J., Cong G., Shi H., Wang Y., Gao R., Chen J., Zhang X., Shi D., Cao L., Wang X., et al. Neutralizing monoclonal antibody fails to recognize porcine epidemic diarrhea virus with two regions deleted in spike protein. Vet. Microbiol. 2020;251:108917. doi: 10.1016/j.vetmic.2020.108917. [DOI] [PubMed] [Google Scholar]
  • 33.Gong L., Gong Y., Lin Y., Qin J., Liu Y., Qian X., Xue C., Cao Y. Identification and characterization of a novel linear epitope in the spike protein of the porcine epidemic diarrhea virus. Acta Virol. 2019;63:88–95. doi: 10.4149/av_2019_111. [DOI] [PubMed] [Google Scholar]
  • 34.Lei X., Zhao J., Wang X., Zhao Y., Wang C. Development of a hybridoma cell line secreting monoclonal antibody against S protein of a Chinese variant of PEDV. Monoclon. Antib. Immunodiagn. Immunother. 2015;34:12–16. doi: 10.1089/mab.2014.0063. [DOI] [PubMed] [Google Scholar]
  • 35.Li W., van Kuppeveld F.J.M., He Q., Rottier P.J.M., Bosch B.J. Cellular entry of the porcine epidemic diarrhea virus. Virus Res. 2016;226:117–127. doi: 10.1016/j.virusres.2016.05.031. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Huan C.C., Wang Y., Ni B., Wang R., Huang L., Ren X.F., Tong G.Z., Ding C., Fan H.J., Mao X. Porcine epidemic diarrhea virus uses cell-surface heparan sulfate as an attachment factor. Arch. Virol. 2015;160:1621–1628. doi: 10.1007/s00705-015-2408-0. [DOI] [PubMed] [Google Scholar]
  • 37.Kirchdoerfer R.N., Bhandari M., Martini O., Sewall L.M., Bangaru S., Yoon K.J., Ward A.B. Structure and immune recognition of the porcine epidemic diarrhea virus spike protein. Structure. 2021;29:385–392. doi: 10.1016/j.str.2020.12.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Kong N., Meng Q., Jiao Y., Wu Y., Zuo Y., Wang H., Sun D., Dong S., Zhai H., Tong W., et al. Identification of a novel B-cell epitope in the spike protein of porcine epidemic diarrhea virus. Virol. J. 2020;17:46. doi: 10.1186/s12985-020-01305-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Cao L., Ge X., Gao Y., Zarlenga D.S., Wang K., Li X., Qin Z., Yin X., Liu J., Ren X., et al. Putative phage-display epitopes of the porcine epidemic diarrhea virus S1 protein and their anti-viral activity. Virus Genes. 2015;51:217–224. doi: 10.1007/s11262-015-1234-5. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Burton D.R. Antibodies, viruses and vaccines. Nat. Rev. Immunol. 2002;2:706–713. doi: 10.1038/nri891. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

Not applicable.


Articles from Viruses are provided here courtesy of Multidisciplinary Digital Publishing Institute (MDPI)

RESOURCES