Abstract
The sculpting of germ layers during gastrulation relies on the coordinated migration of progenitor cells, yet the cues controlling these long-range directed movements remain largely unknown. While directional migration often relies on a chemokine gradient generated from a localized source, we find that zebrafish ventrolateral mesoderm is guided by a self-generated gradient of the initially uniformly expressed and secreted protein Toddler/ELABELA/Apela. We show that the Apelin receptor, which is specifically expressed in mesodermal cells, has a dual role during gastrulation, acting as a scavenger receptor to generate a Toddler gradient, and as a chemokine receptor to sense this guidance cue. Thus, we uncover a single receptor–based self-generated gradient as the enigmatic guidance cue that can robustly steer the directional migration of mesoderm through the complex and continuously changing environment of the gastrulating embryo.
Aplnr has a dual role to self-generate and sense a Toddler gradient directing mesodermal cells during zebrafish gastrulation.
INTRODUCTION
An animal’s body plan is first laid out during gastrulation, which assembles the three germ layers—mesoderm, endoderm, and ectoderm—through the combination of cell migration and differentiation (1–3). While research throughout the past few decades has provided fundamental insights into how the germ layers are specified (3–6), our knowledge of the molecular mechanisms that direct their spatial organization is very limited.
In zebrafish embryos, gastrulation starts with Nodal-induced specification and internalization of mesendodermal progenitor cells at the blastoderm margin (1, 7, 8). Internalized cells subsequently migrate toward the animal pole, giving rise to the mesodermal and endodermal germ layers (3, 9). The molecular guidance, particularly of ventrolateral mesoderm migration, has remained largely unknown across vertebrates. The only factor currently known to be required for this process is the secreted protein Toddler/ELABELA/Apela (10, 11). Toddler is required primarily for mesoderm migration, acting through the Apelin receptor (in zebrafish, Apelin receptor a and b, collectively referred to as Aplnr), a heterotrimeric guanine nucleotide–binding protein (G protein)–coupled receptor (GPCR) specifically expressed in mesodermal cells (10–12). However, how Toddler establishes directional migration during gastrulation has remained unclear.
Here, we show that mesodermal cells provide a dynamic sink to self-generate a Toddler gradient that acts as their elusive guidance cue. We find that the Aplnr is the sole mediator of both Toddler gradient formation and sensing, which unveils a previously unknown mode of gradient self-generation in an in vivo system. Altogether, our study uncovers a simple yet robust mechanism that guides mesodermal cells through the dynamic and complex environment of a gastrulating embryo.
RESULTS
Toddler acts cell non-autonomously to attract Aplnr-expressing cells
We had previously shown that ventrolateral mesendoderm fails to migrate to the animal pole in toddler−/− embryos (10), yet the underlying cause remained unclear. To unveil the role of Toddler in mesendodermal cell migration, we first assessed the migratory behavior of mesendodermal progenitors. To this end, we transplanted between one and five marginal cells from a LifeAct–green fluorescent protein (GFP)–expressing wild-type or toddler−/− donor embryo to an unlabeled, stage- and genotype-matched host embryo and tracked cells after internalization using either light sheet (Fig. 1, A to C; fig. S1; and movies S1 to S3) or confocal microscopy (Fig. 1, D to I; fig. S2; and movies S4 and S5). Consistent with previous observations (2, 10, 13, 14), wild-type cells migrated in a directional manner from the margin toward the animal pole, were polarized, and extended actin-rich protrusions toward the animal pole (Fig. 1, A and D to I; fig. S1; and movies S1 and S4). In contrast, internalized toddler−/− cells in toddler−/− embryos displayed nondirectional migration and were often dragged along with epiboly movements because of reduced and randomly oriented polarity and lamellipodia formation, concomitant with an increased frequency of cell blebbing (Fig. 1, B to I; figs. S1 and S2; and movies S2, S3, and S5). Given that higher cell density can increase the frequency of blebbing (15–17), this transition from actin- to bleb-based protrusions is likely a secondary effect that can be attributed to the increased cell density at the margin in toddler−/− mutant embryos. Together, these results reveal that, while toddler−/− cells are able to migrate in the absence of Toddler, they lack directionality toward the animal pole.
Given that Toddler is a secreted protein (10, 11), we hypothesized that it regulates directional migration of mesodermal progenitors via a cell non-autonomous mechanism. To distinguish cell-intrinsic from cell-extrinsic effects, we transplanted marginal cells from wild-type or toddler−/− donor embryos into unlabeled, stage-matched host embryos of the opposite genotype. Toddler−/− cells placed into a wild-type host embryo were able to migrate directionally, polarize, and extend actin-rich protrusions toward the animal pole (Fig. 1, D to I, and movie S6). Wild-type cells in a Toddler-deficient environment, on the other hand, displayed the toddler−/− phenotype and failed to migrate directionally away from the margin (Fig. 1, D to I; fig. S2; and movie S7). Combined, these results confirm that Toddler acts cell non-autonomously to mediate the migration of mesendodermal progenitors.
A cell non-autonomous signaling mechanism, as well as the loss of directional migration and polarity in the absence of Toddler, indicates that Toddler could act as a chemokine to guide mesodermal cells to the animal pole. As previous efforts to unravel the role of Toddler have led to contradictory results, providing support for both a chemoattractant (18) and a motogen (10) function, we revisited this question and assessed the ability of Toddler to attract Aplnrb-expressing cells. Aplnrb-sfGFP–expressing cells from a toddler−/− donor embryo transplanted next to a source of Toddler at the animal pole of a stage-matched toddler−/− host embryo (Fig. 2, A and B) displayed directional migration toward a Toddler-expressing source until they made initial contact with and attached to Toddler-expressing cells (Fig. 2, B to E; fig. S3; and movie S8). This cellular behavior is similar to the one described for the previously reported chemokine receptor/ligand pair Cxcr4b/Cxcl12a (19). Directional migration was induced robustly over a distance of 100 μm (Fig. 2C) and required both the ligand and receptor to be present because the lack of either Toddler in the source or Aplnr in the migrating cells (knockdown using aplnra/b morpholinos) led to the loss of directional migration (Fig. 2, B to E, and movie S8) and reduced contacts between Aplnrb-sfGFP–expressing and Toddler-expressing cells (fig. S3B and movie S8). Together, these results indicate that Toddler can provide a chemoattractant signal and that Aplnr is necessary as a chemokine receptor to receive the signal.
Mesodermal cells are guided by a self-generated Toddler gradient
Our results so far indicate that Toddler can act as a guidance cue that attracts mesodermal cells. In support of this, placing a cluster of Toddler-expressing cells at the animal pole is sufficient to restore animal pole–directed mesoderm migration in toddler−/− embryos (Fig. 3). However, in line with previous results (10), expression of Toddler throughout the embryo cap, leading to its homogeneous distribution, or from the margin [toddler mRNA injection into the yolk syncytial layer (YSL) before the onset of gastrulation], causing Toddler to be graded in the opposite direction, is also able to rescue animal pole–directed mesoderm migration in toddler−/− embryos (Fig. 3). These results are contrary to typical chemokine models based on concentration gradients formed by a fixed source or sink and suggest that mesoderm migration during gastrulation requires Toddler but is largely independent of Toddler’s expression site.
Studies in the zebrafish lateral line (20, 21) and Dictyostelium (22, 23) have shown that migrating cells can “self-generate” chemokine gradients by locally taking up the chemokine, making them independent of a localized source. To assess quantitatively whether mesodermal cells could self-polarize by locally shaping a Toddler gradient, we turned to computational modeling (see Supplementary Materials). We simulated the one-dimensional migration of mesodermal cells along the animal-vegetal axis x with local cell density c(x,t) over time (Fig. 4A, see also fig. S4, A to E, for a sensitivity analysis and Supplementary Materials for details). Cells internalize at the margin (x = 0), can randomly diffuse (random movements with diffusion coefficient Dc), and migrate directionally according to the local gradient of the Toddler concentration profile T(x,t). Simulation of the Toddler concentration T(x,t) along the animal-vegetal axis factored in random Toddler diffusion (with coefficient DT), baseline degradation (with time scale τT), and a sink to remove Toddler that is proportional to the local density of mesodermal cells (under the simplifying assumption that each cell has a constant capacity to remove Toddler, see Supplementary Materials for details and extensions of the model to more general situations). We also took into consideration that the quantity of available Toddler is not a fixed value, as in typical in vitro assays of self-generated gradients (22, 23). Based on single-cell RNA sequencing (scRNA-seq) data (24), toddler mRNA is expressed ubiquitously throughout the embryo at the onset of gastrulation (Fig. 4B) and becomes restricted to nonmesodermal cells during gastrulation [indicated by the mutually exclusive expression patterns of toddler and aplnrb (Fig. 4, B and C)]. On the basis of these observations, we infer that Toddler is continuously and homogeneously expressed along the animal-margin axis (e.g., by the overlying ectodermal tissue) throughout gastrulation.
To test the core assumptions of the model and constrain its parameters, we first measured the baseline degradation time τT of Toddler. To this end, we injected in vitro–synthesized Toddler peptide into toddler−/−, MZoep−/− double-mutant embryos deficient for both Toddler production (toddler−/−) and the proposed mesodermal Toddler sink (MZoep−/−) (25, 26). We found that a single time scale can describe Toddler degradation kinetics in MZoep−/−, toddler−/− double mutants, from which we can extract the parameter τT ≈ 2h (fig. S4, F and G). Given the known molecular weight of Toddler, we could also estimate its random diffusion to be DT ≈ 3.103μm2/min [a typical value for small diffusible molecules, see (27) and Supplementary Materials]. On the basis of these calculations, locally produced Toddler can propagate up to length scales of (the typical size of a zebrafish embryo) in the absence of a mesoderm sink. Together, these measurements provided estimates for the key parameters of Toddler dynamics, which we used to make predictions on spatiotemporal dynamics of mesoderm migration.
We simulated wild-type migration in the presence or absence of the mesodermal Toddler sink. The simulation predicted that animal pole–directed migration of mesodermal cells would be abolished in the absence of the sink function if the Toddler gradient was absent (ubiquitous Toddler expression or toddler−/−) or reversed (preferential Toddler expression at the margin from the YSL; Fig. 4D). With sink function in mesodermal cells, the dynamics depended on one rescaled parameter, namely, the product of mesodermal Toddler consumption rate (α) and the coupling between the local slope of the Toddler gradient and the corresponding active mesodermal migration speed (β) (compare fig. S4, A and C; see Supplementary Materials). Introduction of this parameter resulted in local depletion of Toddler at the margin, where mesodermal cells internalize, thus forming a Toddler concentration gradient (Fig. 4, E and F). The resulting animal pole–directed migration of mesodermal cells sustains the Toddler gradient, with stronger sink function resulting in proportionally faster migration and higher independence of the location of the Toddler source. Thus, in agreement with our experimental findings, the self-generated gradient model suggests that mesodermal cells can shape a gradient from uniform Toddler concentrations (or even from an inverse Toddler gradient, as long as the sink function is strong enough) to direct their migration to the animal pole (Fig. 4E). The resulting Toddler gradient can be sustained even close to the margin (far from the migratory leading edge; Fig. 4F) because of the continuous production of Toddler.
This model further predicts a distinct pattern of velocities across mesodermal cells, in which cell velocities increase as a function of the distance from the margin but decrease overall as a function of time (Fig. 4G). To test this prediction experimentally, we used light sheet microscopy to image transgenic zebrafish embryos expressing drl:GFP (draculin promoter driving GFP expression), which specifically labels ventrolateral mesoderm during gastrulation (12, 28), injected with h2b-RFP mRNA to label all nuclei. This reporter allowed us to identify and track ventrolateral mesodermal cells and their progenitors (see Supplementary Materials for details). We found that the experimentally measured average mesodermal cell velocity was indeed highest at the leading edge of the mesodermal cells and decreased overall with the progression of gastrulation (Fig. 4H). Therefore, with a single fitting parameter (strength of self-generated directionality as mentioned above; see Supplementary Materials for details), theoretical predictions could recapitulate the experimental kymographs (Fig. 4H). Moreover, the shape of the mesodermal cell density profile along the animal-vegetal axis in wild-type and toddler−/− embryos predicted by the model (fig. S4H) was also consistent with experimental data (fig. S4, I and J).
Next, we simulated mesodermal migration dynamics in the absence of Toddler. In this case, the only mode of mesodermal cell movements is random cell motility (with coefficient Dc estimated from short-term measurements of transplanted cell displacements in toddler−/− embryos; see fig. S4, K and L). The model predicted that mesodermal cells migrate approximately half the distance in toddler−/− embryos compared to that in wild-type embryos, and that animal pole–directed migration rapidly decreased over time (Fig. 4, G and H), as expected from a random migration process. We found that the migration front of mesodermal cells in toddler−/− tg(drl:GFP) embryos did not progress as far as in wild-type tg(drl:GFP) embryos and had nearly zero net velocity 4 hours after the onset of internalization (Fig. 4H). In summary, our theoretical predictions, supported by experimental measurements in wild-type and toddler−/− embryos, strongly suggest that mesodermal cells are being guided to the animal pole by a self-generated Toddler gradient.
Aplnr-mediated removal of Toddler at the margin self-generates a Toddler gradient
Our hypothesis that mesodermal cells self-generate a Toddler gradient that guides their own migration to the animal pole makes four predictions: First, mesodermal cells are required to locally remove Toddler and thereby mediate the directed migration of individual cells to the animal pole; second, there is a maximal threshold of ligand concentration the system can compensate for; third, Toddler levels in wild-type embryos are highest at the animal pole and lowest at the margin; and fourth, the animal pole-directed migration of mesodermal cells is a phenomenon of collective rather than individual cell migration.
To test the requirement of mesodermal cells as a sink, we transplanted LifeAct-GFP–labeled cells from the margin of a wild-type embryo to the margin of stage-matched host embryos that either have (wild type) or lack (MZoep−/−) the proposed mesodermal sink (Fig. 5A). The reporter cells showed directional migration in the wild-type host but lost their directionality and polarity in the MZoep−/− host (Fig. 5, B to D; fig. S5, A to D; and movie S9), where they formed multiple actin-rich protrusions in various directions (Fig. 5C; fig. S5, A to D; and movie S9), in line with excessive chemokine stimulation from all directions (29). To confirm that the absence of a Toddler gradient causes this loss of directional migration, we engineered a Toddler gradient in MZoep−/−, toddler−/− double mutant embryos by transplanting a cluster of Toddler-expressing cells to the animal pole to establish a local source of Toddler (Fig. 5A). This ectopically induced Toddler gradient was indeed able to rescue directional polarization, protrusion formation, and migration of wild-type reporter cells toward the animal pole in embryos lacking mesendodermal cells (Fig. 5, B to D; fig. S5, A to D; and movie S9). Therefore, mesendodermal cells are required to establish a Toddler gradient, which guides them toward the animal pole.
Although only a few examples of self-generated gradients have been described, different mechanisms have been observed to mediate their formation, such as enzymatic chemokine digestion at the cell surface (22) or chemokine internalization via a scavenger receptor (20, 21). It has previously been reported that Toddler binds Aplnr-expressing cells (11) and induces Aplnr internalization (fig. S6, A to C) (10), which, based on the general mechanism of GPCR-ligand interaction and signaling (30), should lead to the concomitant endocytosis and degradation of Toddler, making Aplnr an excellent candidate for the local uptake and thus removal of Toddler. To test this possibility we transplanted individual LifeAct-GFP–labeled wild-type reporter cells to the margin of a sphere-stage aplnr MO host embryo, which lacks Aplnr expression (Fig. 5A). The reporter cells lost their ability to polarize, lacked the typical animal pole-directed bias in protrusion formation, and failed to migrate toward the animal pole in the aplnr MO host, phenocopying their behavior in the MZoep−/− host (Fig. 5, B and C; fig. S5, A to D; and movie S10). These results, together with the chemokine assays presented in Fig. 2, establish a dual role for Aplnr in mesodermal cells during zebrafish gastrulation as (i) a scavenger receptor to generate the Toddler gradient by removing it from the environment and (ii) a chemokine receptor to sense the Toddler gradient and direct cell migration.
Self-generated gradients are known to be robust to fluctuations in chemokine levels. However, the limited availability and turnover of the receptor predicts a maximal threshold of ligand concentration the system can compensate for and maintain the balance between ligand and receptor. In light of the dual role of Aplnr, we expanded the computational model described above to account for the Aplnr turnover during Toddler removal. Because of the finite capacity of Aplnr to remove Toddler, the model predicts that, above a threshold level of Toddler, mesodermal migration would become nondirectional, resembling toddler−/− embryos (fig. S7A). It further predicts that these migration defects at high Toddler levels can be rescued by simultaneous overexpression of Aplnr (fig. S7B). We confirmed both of these predictions experimentally. Overexpression of Toddler in wild-type embryos caused mesodermal mis-migration phenotypes mimicking toddler−/− embryos (fig. S7C), as previously observed (10). However, simultaneously increasing the number of mesodermal cells (and thereby the level of Aplnr expression in these embryos) by blocking the expression of the Nodal inhibitor Lefty2 (31) restored mesoderm migration in embryos with intermediate levels of Toddler overexpression (5 pg of toddler mRNA; fig. S7C). Together, these observations provide independent evidence for Aplnr acting as a scavenger receptor for Toddler and support the model of a self-generated gradient.
Our model of a self-generated gradient predicts Toddler levels to be high at the animal pole and low at the margin because of the local uptake through Aplnr-expressing mesodermal cells. To experimentally confirm this prediction, we aimed at detecting local differences in Toddler levels. Because fluorescently or multi-epitope tagged Toddler is not functional, and because available Toddler antibodies (11) are not sensitive enough to detect endogenous Toddler, a direct visualization of the Toddler gradient is currently not feasible, prompting us to use Aplnr internalization (fig. S6) as a read-out for the local Toddler concentration. To establish the feasibility of this approach, we first determined the maximal difference that could be expected between the animal pole and margin in wild-type embryos. We assessed maximal and minimal Aplnr internalization levels by measuring the ratio of membrane-localized versus internalized Aplnr in transplanted Aplnrb-GFP–expressing toddler−/− cells in the presence of uniformly high Toddler levels (aplnrMO host embryos) and in the absence of Toddler (toddler−/− host embryos; Fig. 6, A to C, and fig. S6, D to G). This revealed a relatively small yet significant increase in Aplnr-GFP internalization in aplnrMO versus toddler−/− host embryos. To confirm the presence of a Toddler gradient in wild-type embryos, we transplanted Aplnrb-GFP–expressing cells from a sphere-stage toddler−/− host embryo either to margin or to the animal pole at the ventral side of a shield-stage wild-type host embryo. Consistent with higher levels of Toddler at the animal pole, the level of Aplnr internalization was increased at the animal pole compared to the margin (Fig. 6, A to C, and fig. S6, D to G). This local difference in Toddler levels between the animal pole and margin was not detected in either toddler−/− or aplnr MO host embryos (Fig. 6, A to C, and fig. S6, D to G). Together, these results confirm the existence of a Toddler gradient that depends on the sink activity of Aplnr-expressing mesodermal cells.
Last, a critical number of cells is required to establish a self-generated gradient. Accordingly, the formation of the Toddler gradient is predicted to require a sufficient number of cells to locally remove enough chemokine (32), as seen by a decrease of animal pole–directed migration in simulations with a reduced number of mesodermal cells (fig. S5E). Therefore, we hypothesized that a cluster of Aplnr-expressing cells, but not a single Aplnr-expressing cell, would undergo directional migration in a uniform Toddler environment when transplanted to the margin. To test this hypothesis, we assessed the migratory ability of a small number (up to 10) of LifeAct-GFP–labeled wild-type reporter cells cotransplanted with a large number (more than 50) of Dextran–Alexa 568–labeled, Aplnr-expressing (sink+), or Aplnr-lacking (sink−) cells, to the margin of an aplnr MO host embryo (Fig. 5A). The reporter cells migrated randomly and failed to reach the animal pole when cotransplanted with cells that lacked Aplnr (Fig. 5, B and C; fig. S5, A to C; and movie S10). However, when the cotransplanted cells expressed Aplnr, the reporter cells displayed increased track straightness, reduced ectopic protrusion formation and increased directional, radial outward-directed polarization (Fig. 5, B and C; fig. S5, A to C; and movie S10), indicating the presence of a guidance cue. In summary, these results provide evidence that a cluster of Aplnr-expressing cells is sufficient to restore sink activity and directional migration of reporter cells, in line with the model of self-generated gradients.
DISCUSSION
This study describes a previously unknown, self-generated Toddler gradient that is formed and sensed by a single molecular mediator, the Apelin receptor, to guide the animal pole–directed migration of ventrolateral mesoderm during zebrafish gastrulation (Fig. 6D). Through the global production and local degradation of Toddler, the location of the mesoderm sink defines the directionality of cell migration toward the animal pole, as it both generates and senses a Toddler gradient that is self-sustained and inversely proportional to the mesodermal cell density (Fig. 6D).
Different types of self-generated gradients have recently been discovered as powerful guidance mechanisms (20–22, 33). Self-generated chemokine gradients are characterized by one shared feature: Both the function of chemokine gradient formation and sensing are found within the migrating unit at opposite poles of the tissue (20, 21) or even the same cell, as suggested by theoretical work and studies with cultured cells in vitro (22). Additional studies based on computational modeling (34, 35) or in vitro experiments (36) have further suggested that removal of the chemokine and sensing of the gradient could be mediated by the same receptor. We provide direct experimental in vivo evidence that a GPCR, namely, the Aplnr, indeed executes both scavenger and sensor roles, acting as the sole molecular player in generating and sensing the directional cue that guides mesodermal cells to the animal pole. A conceptually similar finding, namely, that signaling GPCRs modulate extracellular guidance cues, has been reported for immune cell migration while this study was under review (37). The chemokine receptor CCR7 was shown to both sense and self-generate functional CCL19 chemokine gradients in vitro, thereby collectively organizing the comigration of several immune cell types. Together with our study, this highlights the potentially broadly applicable concept of GPCR-mediated self-generated signal gradients in diverse biological contexts.
The use of a self-generated gradient, in particular those based on a single receptor, holds several advantages over a preexisting gradient for the migration of a dynamic tissue, like the arising mesoderm. First, self-generated gradients can robustly act over long distances (32), which is necessary for mesodermal cell migration, with the space from margin to animal pole spanning more than 500 μm during zebrafish gastrulation. Second, the simple two-component system (here: Aplnr and Toddler) of a single receptor–based self-generated gradient can be easily adjusted to a dynamically changing tissue and thus circumvents the need to establish stable domains with distinct functions. Instead, the shape of the gradient is determined by the position of the migrating cell front rather than the total size of the tissue. This is particularly beneficial during gastrulation, as the continuous internalization of mesodermal cells and the vegetal pole–directed movement of the margin causes a steady increase in cell number and expansion of tissue size. Last, while preexisting gradients require tight regulation of steepness and chemokine concentration along the gradient to ensure reliable cell guidance, self-generated gradients can compensate for changes in length scale (as described above) and chemokine levels by adjusting the rate of chemokine breakdown (38). Therefore, self-generated gradients may have evolved to accommodate different architectures of complex migrating tissues by providing the necessary flexibility to adjust to changing environments and migration modes.
Our computational simulations and experimental analyses of mesodermal cell migration patterns are consistent with the formation of an Aplnr-dependent Toddler gradient in wild-type embryos because in the absence of Toddler as a guidance cue, mesodermal cell migration was mostly driven by random cell motility. However, it is important to note that toddler−/− cells retained some residual bias for migration toward the animal pole (Figs. 1, 4, and 5). These findings suggest that—at least in the absence of a Toddler-based guidance cue—migration is aided by additional, Toddler-independent mechanisms, which could include contact inhibition of locomotion (39, 40) or biomechanical forces (41, 42).
Morphogenetic movements during gastrulation across the animal kingdom share common principles. In amniotes, including mouse and human, mesodermal progenitors internalize at the primitive streak before migrating anteriorly as a noncoherent cell sheet (1). Previous studies have shown that, while conserved, Toddler and Apelin, the other ligand of Aplnr, are not essential for gastrulation movements in mice (43). However, based on the presented advantages and similar nature of morphogenetic movements across species, we hypothesize that self-generated gradients of different or redundant chemokine receptor-ligand pairs could present a universal mechanism underlying the anterior migration of mesodermal progenitor cells in gastrulation, as well as other cell migration events throughout development and physiology.
MATERIALS AND METHODS
Ethical statement
All fish experiments were conducted according to Austrian and European guidelines for animal research and approved by the Amt der Wiener Landesregierung, Magistratsabteilung 58 - Wasserrecht (animal protocols GZ: 342445/2016/12 and MA 58-221180-2021-16).
Zebrafish husbandry
Zebrafish (Danio rerio) were raised according to standard protocols (28°C water temperature, 14-hour light/10-hour dark cycle). TLAB fish were generated by crossing AB and natural variant TL (Tupfel Longfin) zebrafish and used as wild type for all experiments. MZoep−/− (26) and toddler−/− (10) double mutant, as well as tg(drl:gfp) (28), toddler−/− lines, and tg(gsc:CAAX-GFP) (44) wild-type lines were generated by crossing the two respective lines.
Injection of mRNAs and morpholinos into zebrafish embryos
Capped mRNAs for toddler, oep, aplnrb, aplnrb-sfgfp, lifeact-gfp, human h2b-bfp, human h2b-rfp, and f’bfp were transcribed from linearized plasmids using the SP6, T7, or T3 mMessage Machine Kit (Ambion), according to the manufacturer’s protocol. All mRNAs were injected into one-cell stage embryos unless indicated otherwise. All plasmids were previously described (table S1).
Double knockdown of aplnra and aplnrb and knockdown of lefty2 were performed using morpholino injection as previously described (10, 45–48). Briefly, 0.5 and 1 ng of MOs against aplnra (cggtgtattccggcgttggctccat; GeneTools) and aplnrb (cagagaagttgtttgtcatgtgctc; GeneTools), respectively, or 12.5 ng of MO against lefty2 (agctggatgaacagagccatgac; GeneTools) were injected into one-cell stage embryos. A control MO (cctcttacctcagttacaatttata; GeneTools) was used at equivalent concentrations.
Live cell imaging
Light sheet microscopy
For light sheet microscopy, four embryos were mounted in 0.6% low-melt agarose in 1× phosphate-buffered saline (PBS) in glass capillaries (Brand, 20 μl). The capillary was placed in the heated (27°C), fish water-filled sample chamber of a Zeiss Z1 light sheet microscope. The two most suitably oriented embryos were imaged.
To assess morphology and migration behavior of wild-type and toddler−/− cells, four successfully transplanted embryos (only one genotype per experiment) were mounted. The two embryos that had the best orientation (animal pole straight up or down + lateral orientation + transplanted cells in the center of the frame at the margin) were selected for imaging. Time-lapse series of Z-stacks were taken from both embryos over 5 hours (from sphere stage to end of gastrulation) with a 20× objective (table S3).
For global cell tracking experiments, wild-type tg(drl:gfp) or toddler−/− tg(drl:gfp) embryos were injected with 100 pg of h2b-rfp mRNA at the one-cell stage and mounted at sphere stage. The 0.6% low-melt agarose was supplemented with fluorescent beads (1:1000; TetraSpeck microspheres, 0.2 μm, fluorescent blue/green/orange/dark red, Invitrogen no. T7280) that were used to adjust the light sheet offset and stabilize the imaging sequence. Four embryos were mounted, and the two most ideally oriented embryos (animal pole up or down) were selected for imaging. Time-lapse series of Z-stacks were taken from both embryos over 8 hours with a 10× objective (table S3). At 24 hours post fertilization, z-stacks from four positions around the embryo were acquired (0°, 90°, 180°, and 270° in reference to the position of the time course imaging) to determine the location of dorsal and ventral sides within the embryo. Last, six z-stacks of 1000 z-slices were acquired with lasers turned off (used to remove background during subsequent data analysis). Raw light sheet data were converted to tiff files. For cell morphology analyses, the data were binned 4× in xy to allow for better data handling. The region of interest (internalizing migrating cell) was identified in binned images and automatically cropped (in x/y/z and time) in the raw data, using a custom-made app (https://drive.google.com/drive/folders/1183kxnarTEyb1-4Otzyh0RlQhEnHO8Oo?usp=sharing). Cropped imaging files were analyzed as described below.
Confocal microscopy
For confocal imaging, embryos were mounted in the desired orientation in a drop of 0.8% low-melt agarose in 1× PBS on round glass bottom dishes (ibidi). Agarose drops were left to harden before dishes were filled with E3 medium (5 mM NaCl, 0.17 mM KCl, 0.33 mM CaCl2, 0.33 mM MgSO4, 10−5% methylene blue). Time-lapse movies of z-stacks were acquired on an inverted LSM800 Axio Observer (Zeiss) with temperature incubation (27°C) for 6 hours. To assess Aplnrb-GFP internalization, z-stacks for each embryo were taken for only one time point at the sphere stage (fig. S6, A to C) or the shield stage (Fig. 4, E to G, and fig. S6, D to G).
Transplantation assays
Cellular phenotype
To assess the cell migration behavior of individual cells after internalization, donor embryos were injected with 100 pg of lifeact-gfp mRNA. For light sheet imaging experiments only, host embryos were injected with 100 pg of h2b-rfp mRNA. Between one and five cells were taken from the marginal region of donor embryos at the sphere stage and transplanted to the margin of stage- and genotype-matched host embryos. At the dome stage, embryos were mounted laterally with transplanted cells facing the glass dish and imaged on a confocal microscope or mounted in a glass capillary for light sheet microscopy and imaged as described above. For light sheet microscopy, individual frames were acquired in 1-min intervals, while for confocal microscopy, individual frames were acquired in 5-min intervals. Analysis of the cellular phenotype (see below for details) confirmed that, except for slight differences in cell speed, results were consistent between light sheet and confocal data. The differences in cell speed likely stem from the lower time resolution in confocal imaging that cannot fully resolve all fluctuations in the migratory tracks and, therefore, might lead to an underestimation of the actual distance traveled by the cell in 5 min.
Cell autonomy
To assess the cell autonomy of Toddler signaling, embryos were prepared, and transplantations were performed as described above. Donor and host embryos were stage-matched but of opposite genotypes (transplantation of wild type into toddler−/− and vice versa). Imaging and subsequent analysis were performed blindly.
Chemokine assay
All embryos used for the chemokine assay were toddler−/−. Donorreceptor embryos were injected at the one-cell stage with 150 pg of lifeact-rfp mRNA only (control) or in combination with 200 pg of aplnrb-sfGFP mRNA. Donorligand embryos were injected at the one-cell stage with 100 pg of Dextran–Alexa Fluor 488 only (control) or in combination with 100 pg of toddler mRNA. Host embryos were injected at the one-cell stage with 150 pg of h2b-bfp mRNA. Embryos were left to develop until sphere stage. A total of 50 to 100 cells were taken from donorligand embryos and transplanted to the animal pole of stage-matched host embryos. One to ten cells were taken from donorreceptor embryos and transplanted to the host embryo at positions surrounding the animal pole. Embryos were mounted on the animal pole and imaged as described above.
Localized Toddler source
Animal pole expression of Toddler was achieved by transplantation assays. Donor embryos were injected at the one-cell stage with 100 pg of Dextrane–Alexa Fluor 488 only (controls) or in combination with 200 pg of toddler mRNA. Dextrane–Alexa Fluor 488 was used to trace successful injection and transplantation. At the sphere stage, 50 to 100 cells were taken from donor embryos and transplanted to the animal pole of stage-matched toddler−/− host embryos. For uniform expression of Toddler, 100 pg of Dextran–Alexa Fluor 488 only (controls) or in combination with 2 pg of toddler mRNA was injected into one-cell stage toddler−/− embryos. To achieve marginal expression, 100 pg of Dextrane–Alexa Fluor 488 only (controls) or in combination with 10 pg of toddler mRNA was injected into the YSL of 1k-cell stage embryos. Embryos were collected for in situ hybridization (see below) at 75% epiboly.
Sink removal
To test for sink function of mesendodermal cells and scavenger function of Aplnr, wild-type donor embryos were injected with 100 pg of lifeact-gfp mRNA at the one-cell stage. Host embryos were either untreated (MZoep−/−) or injected with aplnr MOs to inhibit aplnr mRNA translation in wild-type embryos. One to five donor cells were taken from the margin at sphere stage and transplanted to the margin of a stage-matched host embryo. Transplantations of more than 10 cells were excluded from analysis to avoid the possibility of sink reintroduction. Embryos were mounted laterally with transplanted cells facing the objective and imaged using confocal microscopy as described above.
Toddler gradient
To assess the sufficiency of a Toddler gradient to guide cell migration in the absence of mesendodermal cells, transplantations were performed using MZoep−/−, toddler−/− double-mutant host embryos. Wild-type donorreporter embryos were injected with 100 pg of lifeact-GFP mRNA at the one-cell stage. MZoep−/−, toddler−/− double-mutant donorsource embryos were injected at the one-cell stage with 200 pg of Dextran–Alexa Fluor 568 only (controls) or in combination with 200 pg of toddler mRNA. A total of 50 to 100 donorsource cells were transplanted to the animal pole of a sphere stage host embryo. Subsequently, one to five LifeAct-GFP–positive donorreporter cells were transplanted to the margin of the same host. Embryos were mounted laterally with transplanted cells facing the objective and imaged using confocal microscopy as described above.
Single versus collective cell migration
To generate a sink of Aplnr-expressing cells by transplantation, donorreporter wild-type embryos were injected with 100 pg of lifeact-gfp mRNA at the one-cell stage. For donorsink, tg(gsc:caax-gfp) embryos were injected with 100 pg of Dextran–Alexa Fluor 568 at the one-cell stage. These embryos were used because they allow the identification and exclusion of the dorsal region at transplantation. Host and donorsink embryos were injected with 0.5 ng of aplnra MO and 1 ng of aplnrb MO. At the late dome stage, 50 cells from the ventral margin of donorsink embryos followed by 5 to 10 cells from the margin of donorreporter embryos were taken into the same needle and transplanted to the margin of stage-matched host embryos. Embryos were mounted laterally with transplanted cells facing the objective and imaged as described above. Imaging and subsequent analysis were performed blindly.
Detection of Toddler gradient through Aplnrb-sfGFP internalization levels
To assess Aplnrb-sfGFP internalization levels depending on the cell position along the animal-vegetal axis within the embryo, host embryos (wild type or toddler−/−) were either left untreated or injected with 0.5 ng of aplnra MO and 1 ng of aplnrb MO, as indicated. Donor toddler−/− embryos were laid 2 hours after host embryos and injected with 200 pg of Aplnrb-sfGFP mRNA and 200 pg of Dextrane. Once the host embryos reached the shield stage, up to 20 cells were transplanted from the sphere-staged donor embryo to two positions within a single host embryo, the ventral margin and the animal pole. Embryos were left to recover for 15 min before being mounted laterally in 0.8% low-melt agarose with transplanted cells facing the objective and imaged as described above.
Imaging analysis
Protrusions and polarity
Cells of interest for analysis were identified in the time-lapse movies based on several criteria:
1) Ventral or lateral position in the host embryo: Cells that were transplanted to the dorsal side (as indicated by visible convergence and extension movements as well as the formation of somites at the end of the time lapse) were excluded from the analysis.
2) Only internalized cells were analyzed. Internalization was identified by a cell’s position in the z-dimension (lower cell layer) and a change in direction that indicates the transition from vegetally directed epiblast to animally directed hypoblast cell movement.
3) Sufficiently long cell tracks: Analysis of a cell had to be possible for at least 15 (light sheet; ≙30 min) or 12 (confocal; ≙1 hour) time frames. Every cell that divided, moved out of frame, or overlapped with another transplanted cell within this time window was excluded from analysis.
4) Analysis was performed before ~70% epiboly (before the onset of convergence and extension movements).
Protrusions were distinguished based on the LifeAct-GFP signal of polymerized actin and defined by the following characteristics:
1) Lamellipodia: actin-mesh that expands several micrometers in width; wide protrusion that extends beyond the cell body.
2) Filopodia: thin actin strings that extend from the cell body.
3) Bleb: actin-free (marked by cytoplasmic, dispersed LifeAct-GFP), round membrane extension with polymerized actin at its base.
Each cell was analyzed from the time of internalization until one of the four criteria above was no longer applicable. In some cases, a cell divided shortly after internalization; therefore, analysis was started 10 (light sheet) or 2 (confocal) time frames (≙10 min) after division to exclude mitosis-induced cell rounding and loss of polarity. Length and angle (in reference to animal pole) of protrusions were measured in ImageJ. A straight line through the center of the protrusion was drawn from the base (border to cell body) to the tip of the protrusion. A cell was counted as polarized if it was elongated and actin polymerization and protrusion formation were restricted to one side only, with additional protrusions (filopodia only) allowed within a 45° angle to either side. Protrusions were measured and counted for every cell in each time frame. Protrusion rate (protrusion/min) was calculated by normalizing the sum of all protrusions for one cell to the length of the time course (for light sheet) or the number of time frames (for confocal). To quantify orientation of polarization and protrusions, the numbers of angles within every 30° were counted and normalized to the total number of the same protrusion/polarity within the same genotype. As the position of dorsal and ventral in these embryos was not specifically determined, the left and right side of the resulting 360° rose plot were combined to be collectively counted as dorsal/ventral orientation.
Cell tracks
Cell tracks were obtained from maximum intensity projections of the cell of interest using tracking tools in Imaris (Imaris x64 9.7.2). First, time-lapse movies were corrected for epiboly movements to represent the cell movement relative to epiboly in the final cell tracks. In all confocal imaging datasets except for the Toddler/Aplnr chemokine assay (Fig. 2 and fig. S3), epiboly movement was determined by manually tracking the vegetal pole–directed progression of the margin in the bright-field images. The cell tracks were then corrected based on the resulting “epiboly track.” In the light sheet datasets (fig. S1) and the chemokine assay (Fig. 2 and fig. S3), epiboly movements were determined by automatically tracking (Imaris) H2B-RFP or H2B-BFP–labeled cell nuclei, respectively. The tracks of three to five nuclei that were successfully tracked throughout the entire time course were used as a reference for correction of the datasets. Cells of interest in all confocal data (Figs. 1, 2, and 5; and figs. S2, S3, S5, and S6) and light sheet data in Fig. 1 and fig. S1 were manually tracked. Final tracks were exported and assembled using Adobe Illustrator. Average speed was calculated by dividing track length by track duration. Track straightness was calculated by dividing displacement by track length. Net displacement to the source was determined by measuring the vertical distance between start and end point of the track. The end point of the track was either the point at which the cell first made contact with the source, or, if no contact was made, after 2 hours of imaging.
Global cell tracking
Global cell tracking of all nuclei in the acquired light sheet microscopy data (Fig. 4 and fig. S4) was based on the approach of Jaqaman et al. (49). To this end, detected nuclei were greedily interconnected into short tracklets, which were then merged to form the final tracks. The interconnection of both the detected nuclei and tracklets was computed by solving a linear assignment problem using LAPMOD, a sparse variant of the Jonker & Volgenant linear assignment solver (50). Very short tracklets of less than three time points were pruned. New tracklets were not allowed to form within a sphere with a radius of 10 μm. Maximum allowed displacement between consecutive time points was set to 10 μm. Gaps between tracklets no longer than three time points were closed if the maximum displacement per time point stayed below a threshold of 10 μm.
The nuclei were detected using a multiscale Laplacian of Gaussian filter (five scales between 1 and 2.5 μm) after preprocessing the imaging data using the following operations: (i) A per-pixel mean image was computed and used for background subtraction to simplify cell tracking; noise and outliers were removed below and above the 50th and 99.99th percentile of intensity. (ii) Working in the log domain, the volumes were downsampled 2× along x and y coordinates to obtain close-to-isotropic spacing; a 7 × 7 pixel median filter was applied for all z planes independently. (iii) Furthermore, to simplify the tracking, the sequence was stabilized using a translation transformation that was estimated at each time point from the locations of the beads around the embryo using RANSAC. In particular, aligning was started at a reference point, and bead locations were always prealigned at the current time point using past transformation; the bead locations fed into RANSAC estimation were selected as mutual nearest neighbors after this prealignment.
The global cell tracking was implemented in Python (https://drive.google.com/drive/folders/12Q36RQGpzItsEP4bC3OKYiWuM53ZC7sv?usp=sharing) using OpenCV, scikit-image, and scikit-learn (51, 52). The tracker was optimized to take advantage of a SLURM-based computation cluster; however, the implementation also allows running locally on a single computer, but the runtime might be prohibitive.
For visualization and analysis of the trajectories (https://drive.google.com/drive/folders/1GRgfTBL03aOvJ6FsMxBItVcMB6h2_cZc?usp=sharing), a sphere was fitted to the extracted nuclei locations (53), with latitude and longitude coordinates and the radial distance from the center of the embryo. The reference sphere was aligned with the animal and vegetal pole matching the north and south pole, respectively. Afterwards, the animal-vegetal axis and the dorsoventral axis were interactively recovered. This brought all the experiments into a common reference frame and allowed for simpler interpretation.
Cell internalization was determined by calculating each cell’s frame-by-frame difference in radius at the margin. The minimum of the average changes indicated a peak of internalization movements, which occurred between 30 and 50% epiboly in all datasets. This was used to align the recordings in developmental timing.
To isolate the tracks of mesodermal cells, nuclei colocalizing with the Drl:GFP signal were identified. In relation to the background fluorescence, a cell was considered Drl:GFP marker positive with a green fluorescence level higher than 96% of all measurements (z score 1.8) for at least 50 frames.
The animal-to-vegetal pole velocity was measured specifically for ventrolateral mesoderm cells. This was calculated by the change in distance relative to the margin over a moving window of 10 min (14 frames). The distance to margin is the difference in latitude between the position of the cell and the position of the margin at the corresponding time point.
Detection of a Toddler gradient via Aplnrb-sfGFP internalization levels
Using Fiji, a mask was generated for each Aplnrb-sfGFP–positive cell, encompassing the entire cell area (including cytoplasm and membrane) by manually outlining the cells (maskfull). Each mask was than reduced by 1.25 μm around the entire circumference. The resulting reduced mask represented the cytoplasmic area (maskcyto). Maskcyto was then subtracted from maskfull, resulting in a consistently 1.25-μm-thick band as a mask for the membrane (maskmembr). The mean fluorescent intensity was measured within maskmembr and maskcyto, and the ratio (maskmembr/maskcyto) was calculated as a proxy for Aplnrb-sfGFP internalization levels in each cell.
Compensation of Toddler overexpression
Overexpression of Toddler was achieved at different levels by injecting 0 pg (water control), 5 pg, or 10 pg of toddler mRNA into one-cell stage wild-type embryos. Half of the embryos of each batch were additionally injected with lefty2 MO to enhance Nodal signaling and thus increase the number of mesodermal cells. Embryos were collected for in situ hybridization at 75% epiboly (see below).
In situ hybridization
In situ hybridization was performed as previously described (54). Briefly, wild-type and toddler−/− embryos were fixed at 75% epiboly in 3.7% FA overnight and hybridized with a DIG-labeled antisense probe against aplnrb (10). After BCIP/NBT/Alkaline-phosphatase–staining, embryos were dehydrated in methanol and imaged in BB/BA on a Stemi 305 steromicroscope (Zeiss).
To quantify the mesoderm migration phenotype, embryos were imaged laterally at 75% epiboly. The spread of aplnrb-positive cells was measured in ImageJ on the ventral side and normalized to the distance between margin and animal pole to account for differences in epiboly progression between individual embryos. Data were normalized to the average spread in wild-type embryos.
To assess the mesodermal cell density profile of embryos, the gray values for a 100-pixel wide rectangle from animal pole to margin were measured using ImageJ and inverted (0 = white, 255 = black). Values for all 100 pixels in one row were averaged. The lowest value measured along the animal-margin axis was subtracted as background, and measurements were normalized to the highest value (= 1). All background-subtracted pixel values were plotted as position along the animal-margin axis (margin = 0, animal pole = 1).
Internalization of Aplnr
To assess Aplnrb-GFP internalization in the absence of Toddler or upon Toddler overexpression (fig. S6, A to C), toddler−/− embryos were injected at the one-cell stage with 100 pg of f’bfp mRNA and 50 pg of aplnrb-sfgfp mRNA. At the 32-cell stage, 100 pg of Dextrane–Alexa Fluor 568 only (controls) or in combination with 100 pg of toddler mRNA was injected into a single blastomere. Embryos were left to develop until the sphere stage and then mounted on the animal pole and imaged as described above. To quantify Aplnrb-GFP internalization, cell outlines were manually traced in ImageJ based on the f’BFP signal. Mean fluorescence intensity of Aplnrb-GFP was measured for membrane and cytoplasm and multiplied with the membrane and cytoplasmic area, respectively. The ratio of total membrane and cytoplasmic signal was used as a measure of the internalization rate.
Toddler half-life assessment
To measure the half-life time of Toddler protein, MZoep−/−, toddler−/− embryos were collected and left to develop until 30% epiboly. At 30% epiboly, 1 μg of Toddler peptide [GL Biochem: DKHGTKHDFLNLRRKYRRHNCPKKRCLPLHSRVPFP, cysteine residues in bold were cross-linked according to (55)] was injected into the cell cap. Ten cell caps were collected every 30 min for 3 hours through manual removal of yolk and flash-frozen in liquid nitrogen.
Western blotting was performed according to standard protocols. Briefly, embryo caps were supplemented with 10 μl of 2× Laemmli buffer and boiled for 5 min at 95°C. SDS–polyacrylamide gel electrophoresis was performed using Any kD Mini-PROTEAN TGX Precast Protein Gels (Bio-Rad), loading 10 embryo caps per lane. Blotting was performed using a wet-blot system (Bio-Rad). Protein detection was achieved using the following antibodies: anti-Toddler [rabbit, 1:500; provided by the Reversade Lab (11)] and anti-tubulin (mouse, 1:10,000; Sigma-Aldrich T6074).
Acknowledgments
We thank K. Aumayer and the team of the biooptics facility at the Vienna Biocenter, particularly P. Pasierbek and T. Müller, for support with microscopy; K. Panser, C. Pribitzer, and the animal facility personnel for taking care of zebrafish; M. Binner and A. Bandura for help with genotyping; M. Codina Tobias for help with establishing the conditions for the Toddler overexpression compensation experiment; T. Lubiana Alves for sharing the code for scRNA-Seq analyses; the Heisenberg laboratory, particularly D. Pinheiro, for joint laboratory meetings, discussions on the project, and providing the tg(gsc:CAAX-GFP) fish line; the Raz laboratory for providing the Lifeact-GFP plasmid; A. Andersen, A. Schier, C.-P. Heisenberg, and E. Tanaka for comments on the manuscript; and the entire Pauli laboratory, particularly K. Gert and V. Deneke, for valuable discussions and feedback on the manuscript.
Funding: Work in A.P.’s laboratory has been supported by the IMP, which receives institutional funding from Boehringer Ingelheim and the Austrian Research Promotion Agency (Headquarter grant FFG-852936), as well as the FWF START program (Y 1031-B28 to A.P.), the Human Frontier Science Program (HFSP) Career Development Award (CDA00066/2015 to A.P.) and Young Investigator Grant (RGY0079/2020 to A.P.), the SFB RNA-Deco (project number F 80 to A.P.), a Whitman Center Fellowship from the Marine Biological Laboratory (to A.P.), and EMBO-YIP funds (to A.P.). This work was supported by the European Union (European Research Council Starting Grant 851288 to E.H.). For the purpose of Open Access, the authors have applied a CC BY public copyright license to any Author Accepted Manuscript (AAM) version arising from this submission.
Author contributions: Conceptualization: J.S., E.H., and A.P. Methodology: J.S. Data analysis: J.S. Cell tracking analysis: T.K. and F.S. Computational modeling: E.H. Funding acquisition: E.H. and A.P. Supervision: A.P. Writing—original draft: J.S. Writing—review and editing: J.S., E.H., and A.P.
Competing interests: The authors declare that they have no competing interests.
Data and materials availability: All data needed to evaluate the conclusions in the paper are present in the paper and/or the Supplementary Materials. Light sheet imaging data of wild-type and toddler mutant embryos for global cell tracking analysis have been deposited to EBI (BioStudies accession number S-BIAD499, accessible at www.ebi.ac.uk/biostudies/studies/S-BIAD499).
Supplementary Materials
This PDF file includes:
Other Supplementary Material for this manuscript includes the following:
REFERENCES AND NOTES
- 1.Solnica-Krezel L., Sepich D. S., Gastrulation: Making and shaping germ layers. Annu. Rev. Cell Dev. Biol. 28, 687–717 (2012). [DOI] [PubMed] [Google Scholar]
- 2.Solnica-Krezel L., Conserved patterns of cell movements during vertebrate gastrulation. Curr. Biol. 15, R213–R228 (2005). [DOI] [PubMed] [Google Scholar]
- 3.Rohde L. A., Heisenberg C. P., Zebrafish gastrulation: Cell movements, signals, and mechanisms. Int. Rev. Cyt. 261, 159–192 (2007). [DOI] [PubMed] [Google Scholar]
- 4.D. Pinheiro, C. P. Heisenberg, in Current Topics in Developmental Biology (Academic Press Inc., 2020), vol. 136, pp. 343–375. [DOI] [PubMed] [Google Scholar]
- 5.Feldman B., Gates M. A., Egan E. S., Dougan S. T., Rennebeck G., Sirotkin H. I., Schier A. F., Talbot W. S., Zebrafish organizer development and germ-layer formation require nodal-related signals. Nature 395, 181–185 (1998). [DOI] [PubMed] [Google Scholar]
- 6.Schier A. F., Nodal morphogens. Cold Spring Harb. Perspect. Biol. 1, a003459 (2009). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Schier A. F., Talbot W. S., Molecular genetics of axis formation in zebrafish. Annu. Rev. Genet. 39, 561–613 (2005). [DOI] [PubMed] [Google Scholar]
- 8.Williams M. L., Solnica-Krezel L., Regulation of gastrulation movements by emergent cell and tissue interactions. Curr. Opin. Cell Biol. 48, 33–39 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Kimmel C. B., Ballard W. W., Kimmel S. R., Ullmann B., Schilling T. F., Stages of embryonic development of the zebrafish. Dev. Dyn. 203, 253–310 (1995). [DOI] [PubMed] [Google Scholar]
- 10.Pauli A., Norris M. L., Valen E., Chew G. L., Gagnon J. A., Zimmerman S., Mitchell A., Ma J., Dubrulle J., Reyon D., Tsai S. Q., Joung J. K., Saghatelian A., Schier A. F., Toddler: An embryonic signal that promotes cell movement via apelin receptors. Science 343, 1248636 (2014). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Chng S. C., Ho L., Tian J., Reversade B., ELABELA: A hormone essential for heart development signals via the apelin receptor. Dev. Cell 27, 672–680 (2013). [DOI] [PubMed] [Google Scholar]
- 12.Norris M. L., Pauli A., Gagnon J. A., Lord N. D., Rogers K. W., Mosimann C., Zon L. I., Schier A. F., Toddler signaling regulates mesodermal cell migration downstream of Nodal signaling. eLife 6, e22626 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 13.Keller P. J., Schmidt A. D., Wittbrodt J., Stelzer E. H. K., Reconstruction of zebrafish early embryonic development by scanned light sheet microscopy. Science 322, 1065–1069 (2008). [DOI] [PubMed] [Google Scholar]
- 14.Row R. H., Maître J. L., Martin B. L., Stockinger P., Heisenberg C. P., Kimelman D., Completion of the epithelial to mesenchymal transition in zebrafish mesoderm requires Spadetail. Dev. Biol. 354, 102–110 (2011). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Belotti Y., McGloin D., Weijer C. J., Effects of spatial confinement on migratory properties of Dictyostelium discoideum cells. Commun. Integr. Biol. 14, 5–14 (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Bergert M., Chandradoss S. D., Desai R. A., Paluch E., Cell mechanics control rapid transitions between blebs and lamellipodia during migration. Proc. Natl. Acad. Sci. U.S.A. 109, 14434–14439 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Venturini V., Pezzano F., Castro F. C., Häkkinen H. M., Jiménez-Delgado S., Colomer-Rosell M., Marro M., Tolosa-Ramon Q., Paz-López S., Valverde M. A., Weghuber J., Loza-Alvarez P., Krieg M., Wieser S., Ruprecht V., The nucleus measures shape changes for cellular proprioception to control dynamic cell behavior. Science 370, eaba2644 (2020). [DOI] [PubMed] [Google Scholar]
- 18.Helker C. S., Schuermann A., Pollmann C., Chng S. C., Kiefer F., Reversade B., Herzog W., The hormonal peptide Elabela guides angioblasts to the midline during vasculogenesis. eLife 4, e06726 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Blaser H., Eisenbeiss S., Neumann M., Reichman-Fried M., Thisse B., Thisse C., Raz E., Transition from non-motile behaviour to directed migration during early PGC development in zebrafish. J. Cell Sci. 118, 4027–4038 (2005). [DOI] [PubMed] [Google Scholar]
- 20.Venkiteswaran G., Lewellis S. W., Wang J., Reynolds E., Nicholson C., Knaut H., Generation and dynamics of an endogenous, self-generated signaling gradient across a migrating tissue. Cell 155, 674–687 (2013). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Donà E., Barry J. D., Valentin G., Quirin C., Khmelinskii A., Kunze A., Durdu S., Newton L. R., Fernandez-Minan A., Huber W., Knop M., Gilmour D., Directional tissue migration through a self-generated chemokine gradient. Nature 503, 285–289 (2013). [DOI] [PubMed] [Google Scholar]
- 22.Tweedy L., Knecht D. A., Mackay G. M., Insall R. H., Self-generated chemoattractant gradients: Attractant depletion extends the range and robustness of chemotaxis. PLoS Biol. 14, e1002404 (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Tweedy L., Susanto O., Insall R. H., Self-generated chemotactic gradients—Cells steering themselves. Curr. Opin. Cell Biol. 42, 46–51 (2016). [DOI] [PubMed] [Google Scholar]
- 24.Farrell J. A., Wang Y., Riesenfeld S. J., Shekhar K., Regev A., Schier A. F., Single-cell reconstruction of developmental trajectories during zebrafish embryogenesis. Science 360, eaar3131 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Schier A. F., Neuhauss S. C., Helde K. A., Talbot W. S., Driever W., The one-eyed pinhead gene functions in mesoderm and endoderm formation in zebrafish and interacts with no tail. Development 124, 327–342 (1997). [DOI] [PubMed] [Google Scholar]
- 26.Gritsman K., Zhang J., Cheng S., Heckscher E., Talbot W. S., Schier A. F., The EGF-CFC protein one-eyed pinhead is essential for nodal signaling. Cell 97, 121–132 (1999). [DOI] [PubMed] [Google Scholar]
- 27.Müller P., Rogers K. W., Jordan B. M., Lee J. S., Robson D., Ramanathan S., Schier A. F., Differential diffusivity of nodal and lefty underlies a reaction-diffusion patterning system. Science 336, 721–724 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Mosimann C., Panáková D., Werdich A. A., Musso G., Burger A., Lawson K. L., Carr L. A., Nevis K. R., Sabeh M. K., Zhou Y., Davidson A. J., Dibiase A., Burns C. E., Burns C. G., Macrae C. A., Zon L. I., Chamber identity programs drive early functional partitioning of the heart. Nat. Commun. 6, 1–10 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Devreotes P., Horwitz A. R., Signaling networks that regulate cell migration. Cold Spring Harb. Perspect. Biol. 7, a005959 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Pavlos N. J., Friedman P. A., GPCR signaling and trafficking: The long and short of it. Trends Endocrinol. Metab. 28, 213–226 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.van Boxtel A. L., Chesebro J. E., Heliot C., Ramel M. C., Stone R. K., Hill C. S., A temporal window for signal activation dictates the dimensions of a nodal signaling domain. Dev. Cell 35, 175–185 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Tweedy L., Insall R. H., Self-generated gradients yield exceptionally robust steering cues. Front. Cell Dev. Biol. 8, 133 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Shellard A., Mayor R., Collective durotaxis along a self-generated stiffness gradient in vivo. Nature 600, 690–694 (2021). [DOI] [PubMed] [Google Scholar]
- 34.Haugh J. M., Deterministic model of dermal wound invasion incorporating receptor-mediated signal transduction and spatial gradient sensing. Biophys. J. 90, 2297–2308 (2006). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Streichan S. J., Valentin G., Gilmour D., Hufnagel L., Collective cell migration guided by dynamically maintained gradients. Phys. Biol. 8, 045004 (2011). [DOI] [PubMed] [Google Scholar]
- 36.Scherber C., Aranyosi A. J., Kulemann B., Thayer S. P., Toner M., Iliopoulos O., Irimia D., Epithelial cell guidance by self-generated EGF gradients. Integr. Biol. (Camb). 4, 259–269 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.J. Alanko, M. C. Ucar, N. Canigova, J. Stopp, J. Schwarz, J. Merrin, E. Hannezo, M. Sixt, Sinking the way: A dual role for CCR7 in collective leukocyte migration. bioRxiv 2022.02.22.481445 (2022).
- 38.Wong M., Newton L. R., Hartmann J., Hennrich M. L., Wachsmuth M., Ronchi P., Guzmán-Herrera A., Schwab Y., Gavin A. C., Gilmour D., Dynamic buffering of extracellular chemokine by a dedicated scavenger pathway enables robust adaptation during directed tissue migration. Dev. Cell 52, 492–508.e10 (2020). [DOI] [PubMed] [Google Scholar]
- 39.Carmona-Fontaine C., Matthews H. K., Kuriyama S., Moreno M., Dunn G. A., Parsons M., Stern C. D., Mayor R., Contact inhibition of locomotion in vivo controls neural crest directional migration. Nature 456, 957–961 (2008). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 40.Roycroft A., Mayor R., Molecular basis of contact inhibition of locomotion. Cell. Mol. Life Sci. 73, 1119–1130 (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 41.Hannezo E., Heisenberg C. P., Mechanochemical feedback loops in development and disease. Cell 178, 12–25 (2019). [DOI] [PubMed] [Google Scholar]
- 42.Heisenberg C. P., Bellaïche Y., Forces in tissue morphogenesis and patterning. Cell 153, 948–962 (2013). [DOI] [PubMed] [Google Scholar]
- 43.Freyer L., Hsu C. W., Nowotschin S., Pauli A., Ishida J., Kuba K., Fukamizu A., Schier A. F., Hoodless P. A., Dickinson M. E., Hadjantonakis A. K., Loss of apela peptide in mice causes low penetrance embryonic lethality and defects in early mesodermal derivatives. Cell Rep. 20, 2116–2130 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Smutny M., Ákos Z., Grigolon S., Shamipour S., Ruprecht V., Čapek D., Behrndt M., Papusheva E., Tada M., Hof B., Vicsek T., Salbreux G., Heisenberg C. P., Friction forces position the neural anlage. Nat. Cell Biol. 19, 306–317 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Zeng X. X. I., Wilm T. P., Sepich D. S., Solnica-Krezel L., Apelin and its receptor control heart field formation during zebrafish gastrulation. Dev. Cell 12, 391–402 (2007). [DOI] [PubMed] [Google Scholar]
- 46.Scott I. C., Masri B., D’Amico L. A., Jin S. W., Jungblut B., Wehman A. M., Baier H., Audigier Y., Stainier D. Y. R., The G protein-coupled receptor Agtrl1b regulates early development of myocardial progenitors. Dev. Cell 12, 403–413 (2007). [DOI] [PubMed] [Google Scholar]
- 47.Agathon A., Thisse B., Thisse C., Morpholino knock-down of Antivin1 and Antivin2 upregulates nodal signaling. Genesis 30, 178–182 (2001). [DOI] [PubMed] [Google Scholar]
- 48.Paskaradevan S., Scott I. C., The Aplnr GPCR regulates myocardial progenitor development via a novel cell-non-autonomous, Gαi/o protein-independent pathway. Biol. Open 1, 275–285 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Jaqaman K., Loerke D., Mettlen M., Kuwata H., Grinstein S., Schmid S. L., Danuser G., Robust single-particle tracking in live-cell time-lapse sequences. Nat. Methods 5, 695–702 (2008). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Jonker R., Volgenant A., A shortest augmenting path algorithm for dense and sparse linear assignment problems. Comput. Secur. 38, 325–340 (1987). [Google Scholar]
- 51.Pedregosa F., Varoquaux G., Gramfort A., Michel V., Thirion B., Grisel O., Blondel M., Prettenhofer P., Weiss R., Dubourg V., Vanderplas J., Passos A., Cournapeau D., Brucher M., Perrot M., Duchesnay É., Scikit-learn: Machine learning in python. J. Mach. Learn. Res. 12, 2825–2830 (2011). [Google Scholar]
- 52.van der Walt S., Schönberger J. L., Nunez-Iglesias J., Boulogne F., Warner J. D., Yager N., Gouillart E., Yu T.; scikit-image contributors , Scikit-image: Image processing in python. PeerJ. 2014, e453 (2014). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Kasa I., A circle fitting procedure and its error analysis. IEEE Trans. Instrum. Meas. IM–25, 8–14 (1976). [Google Scholar]
- 54.Thisse C., Thisse B., High-resolution in situ hybridization to whole-mount zebrafish embryos. Nat. Protoc. 3, 59–69 (2008). [DOI] [PubMed] [Google Scholar]
- 55.Ho L., Tan S. Y. X., Wee S., Wu Y., Tan S. J. C., Ramakrishna N. B., Chng S. C., Nama S., Szczerbinska I., Chan Y. S., Avery S., Tsuneyoshi N., Ng H. H., Gunaratne J., Dunn N. R., Reversade B., ELABELA is an endogenous growth factor that sustains hESC self-renewal via the PI3K/AKT pathway. Cell Stem Cell 17, 435–447 (2015). [DOI] [PubMed] [Google Scholar]
- 56.Jin T., Gradient sensing during chemotaxis. Curr. Opin. Cell Biol. 25, 532–537 (2013). [DOI] [PubMed] [Google Scholar]
- 57.Hill N. A., Häder D. P., A biased random walk model for the trajectories of swimming micro-organisms. J. Theor. Biol. 186, 503–526 (1997). [DOI] [PubMed] [Google Scholar]
- 58.Recho P., Hallou A., Hannezo E., Theory of mechanochemical patterning in biphasic biological tissues. Proc. Natl. Acad. Sci. U.S.A. 116, 5344–5349 (2019). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Tweedy L., Thomason P. A., Paschke P. I., Martin K., Machesky L. M., Zagnoni M., Insall R. H., Seeing around corners: Cells solve mazes and respond at a distance using attractant breakdown. Science 369, eaay9792 (2020). [DOI] [PubMed] [Google Scholar]
- 60.Zhang J., Talbot W. S., Schier A. F., Positional cloning identifies zebrafish one-eyed pinhead as a permissive EGF-related ligand required during gastrulation. Cell 92, 241–251 (1998). [DOI] [PubMed] [Google Scholar]
- 61.Tsai T. Y. C., Sikora M., Xia P., Colak-Champollion T., Knaut H., Heisenberg C. P., Megason S. G., An adhesion code ensures robust pattern formation during tissue morphogenesis. Science 370, 113–116 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Shindo A., Audrey A., Takagishi M., Takahashi M., Wallingford J. B., Kinoshita M., Septin-dependent remodeling of cortical microtubule drives cell reshaping during epithelial wound healing. J. Cell Sci. 131, jcs212647 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.