Skip to main content
Springer Nature - PMC COVID-19 Collection logoLink to Springer Nature - PMC COVID-19 Collection
. 2022 Nov 11;15(1):44–62. doi: 10.1007/s12602-022-10004-y

Milk-Derived Antimicrobial Peptides: Overview, Applications, and Future Perspectives

Anamika Singh 1, Rachael Terumbur Duche 1,2, Arundhati Ganesh Wandhare 1, Jaspreet Kaur Sian 1,3, Brij Pal Singh 4, Manvesh Kumar Sihag 5, Kumar Siddharth Singh 6, Vikas Sangwan 1, Shreya Talan 7, Harsh Panwar 1,✉
PMCID: PMC9649404  PMID: 36357656

Abstract

The growing consumer awareness towards healthy and safe food has reformed food processing strategies. Nowadays, food processors are aiming at natural, effective, safe, and low-cost substitutes for enhancing the shelf life of food products. Milk, besides being a rich source of nutrition for infants and adults, serves as a readily available source of precious functional peptides. Due to the existence of high genetic variability in milk proteins, there is a great possibility to get bioactive peptides with varied properties. Among other bioactive agents, milk-originated antimicrobial peptides (AMPs) are gaining interest as attractive and safe additive conferring extended shelf life to minimally processed foods. These peptides display broad-spectrum antagonistic activity against bacteria, fungi, viruses, and protozoans. Microbial proteolytic activity, extracellular peptidases, food-grade enzymes, and recombinant DNA technology application are among few strategies to tailor specific peptides from milk and enhance their production. These bioprotective agents have a promising future in addressing the global concern of food safety along with the possibility to be incorporated into the food matrix without compromising overall consumer acceptance. Additionally, in conformity to the current consumer demands, these AMPs also possess functional properties needed for value addition. This review attempts to present the basic properties, synthesis approaches, action mechanism, current status, and prospects of antimicrobial peptide application in food, dairy, and pharma industry along with their role in ensuring the safety and health of consumers.

Keywords: Antimicrobial peptides, Antibiotic resistance, Bacteriocins, Dairy, Food preservation, Lactic acid bacteria, Milk, Probiotics

Introduction

Good and safe food has always been a priority for humans and numerous strategies have been employed over the years to achieve it. This includes various food preservation processes and techniques to increase the shelf life and usability of the food items. Most preservation processes aim at decreasing the growth of microbes by limiting their vital life requirements of moisture, temperature, pH, osmolarity, etc. Some processes also include use of preservatives using chemical additives which act as antioxidants or as growth limiters to the microbes. This has been very successful in increasing shelf life of food items and we see a humongous increase in number of processed and canned foods in the past decades. Lately, some of these chemical preservatives are being identified as carcinogenic and public awareness against it has increased [1, 2]. Now, research has gained attention towards developing safer food preservatives while maintaining food quality, shelf life, and palatability using novel bioactive agents. One of such agents are antimicrobial peptides (AMPs) which are gaining interest as broad-spectrum antimicrobials with activity at micromolar concentration, and microorganisms are less likely to develop resistance against them. Predominantly, AMPs are a family of small peptides found throughout nature and plays an important role in organisms’ innate immune system. Apart from that, AMPs can be produced from a variety of protein sources such as milk via enzymatic hydrolysis or microbial fermentation. AMPs have found application in food and pharmaceutical industry. Primarily, they can be used as bio-preservatives in food products and have no appreciable effect on applicability across different food matrices.

In the modern world, foodborne infections have emerged as one of the most common public health concerns which are caused by either live pathogenic organisms or their toxins. Owing to their negative impact on the health and economic condition of the individuals, assurance of microbiologically safe food is very important. Also, the food recalls due to foodborne disease outbreaks and food spoilage are decreasing the consumer confidence leading to significant food and economic losses. Adoption of food preservation techniques using the natural substances is very crucial to prevent food losses and diseases spread to consumers. AMPs present an interesting alternative to chemical preservatives used for food preservation. Also, AMPs have potential to replace conventional antibiotics employed in animal welfare as prophylactic or therapeutic. AMPs are unique in the sense that they target the cell membrane of microorganisms, while conventional antibiotics target specific cellular activities such as DNA, protein, or cell wall synthesis. AMPs are more advantageous compared to conventional antibiotics owing to their ability to bypass common resistance mechanisms, thereby limiting microbial resistance [3]. AMPs are amphipathic molecules composed of 6 to 100 amino acids with a net positive charge of + 2 to + 9. This net positive charge guides them towards negatively charged bacterial cell membranes and promotes their ability to rupture and destabilize the cell membranes [4]. After the discovery of lysozyme, the scientific community shifted attention towards the detection, isolation, purification, and characterization of AMPs. AMPs combat low and high-affinity pathogen targets which confer them with the ability to overcome pathogen resistance leading to their prominence in the new era of antimicrobials [5].

Milk serves as a readily available source of precious bioactive peptides with diverse biological activities such as antimicrobial, antihypertensive, anti-oxidative, antithrombotic, and immunomodulatory [6, 7]. Fermented dairy products including yogurt, sour milk, and cheese include a variety of naturally produced bioactive peptides. Milk-derived AMPs, in particular, are an important component of the innate defense, especially on mucosal surfaces such as the lungs and small intestine, which are constantly exposed to a wide range of pathogens [8]. Lactoferrin, among other milk proteins, exhibits bacteriostatic and bactericidal activity against a variety of bacteria by binding to iron [9]. Infant milk lactalbumin has previously been shown to have antagonistic effect against Escherichia coli O127, and also a reduction in the incidence of diarrhea [10]. In a series of successive clinical trials, half (1–11) displayed antibacterial activity against antibiotic-resistant Staphylococcus aureus [11–14]. Moreover, CAMP211-225, a milk-derived peptide, was recently found to have antibacterial action against E. coli and Yersinia enterocolitica [15]. As an outcome of these research findings, milk-derived AMPs are gaining attraction as a safe and effective alternative to antibiotics, with the added benefits of application in food targeting shelf life extension. Therefore, this review aims to delineate the recent developments in milk protein-derived AMPs and their potential application in food, dairy, and pharma sector with reference to emerging antibiotic resistance. An attempt has also been made to present reader with an overview of production, characterization, and mode of action of AMPs.

Food Chain and Antibiotic Resistance

For almost a century, antibiotics and other antimicrobial formulations remain a prominent weapon to deal with infections both in humans and other animals. Over some time period, microbes started developing resistance against these antimicrobials, leading to decreased efficacy of drugs and a burden on the global economy. AMR is prevalent across both species and geographical boundaries due to the food chain web, relaxation in international trade barriers, and lack of dose accuracy acquaintance. Animal husbandry and dairy sector are also reeled into this as the animals reared for milk and meats are frequently exposed to these antimicrobials. The possible factors responsible for emerging antibiotic resistance in the dairy sector include unrestricted availability of drugs, unchecked usage, improper diagnosis of disease, poor infection prevention and control measures, and lack of adequate surveillance and monitoring system [3]. There is an estimate of about a 67% increase in usage of antimicrobial compounds in the dairy sector by 2030 [16] especially in developing countries such as India due to increasing population, the gap in demand and supply, and greater chances of bacterial growth and survival due to tropical environmental conditions. Preservatives are usually added to keep the food protected from spoilage. Milk and milk products being a rich source of proteins, sugar, and vitamins are an excellent medium for growth of microbes. In countries with tropical climate with temperature exceeding 30 °C and where refrigeration or cold chain facilities are limited, milk is often preserved using chemicals [17]. However, their use in milk is debatable due to the reported bad effects on health. A comparative list of common chemical preservatives used for milk and milk products preservation is presented in Table 1. Available reports have raised hopes of overcoming the menace of antibiotic resistance and adverse health effects of other chemical preservatives via application of AMPs considering their high propensity towards resistant bacteria. The use of AMPs as therapeutic adjuncts due to least chances of resistance development offers a promising policy in the pharmaceutical industry as well [28].

Table 1.

Common preservatives used in milk and milk products

Name of preservative Effective against Legal safe amount Adverse health effects of overdose References
Hydrogen peroxide Pathogens, aflatoxins Maximum 0.05% Irritation to GI track, nausea, vomiting, etc [18]
Salicylic acid More effective against fungi and yeast compared to bacteria Not defined due to its heat instability Gastric irritation, bleeding, diarrhea etc [19]
Benzoic acid Bacteria, yeast, and fungi 300 mg/kg in dairy based desserts and 1000 mg/kg in dairy fat spreads Asthma, urticaria, metabolic acidosis, convulsions, and pseudo-allergy [20, 21]
Sorbic acid Bacteria, yeast and molds 1000 mg/kg in dairy based drinks, 3000 mg/kg in cheese Metabolic acidosis, convulsions and hyperpnoea [21, 22]
Boric acid Pathogens Declared unsafe by FAO/WHO Nausea, vomiting, bloody diarrhea, severe colic, renal failure [23]
Sodium carbonate/bicarbonate Neutralizes bacterially developed acidity Less than 0.3% as stabilizer in condensed, evaporated and powdered milk Gastrointestinal problems [24]
CO2 Bacteriostatic effect against Gram-negative bacteria - May reduce body mineral density [25]
Formaldehyde/formalin Antiseptic nature Not allowed Potent carcinogenic, vomiting, diarrhea [26]
Bronopol Lowers somatic cell count Not defined Irritant reactions and allergic contact dermatitis
Potassium dichromate Bacteriostatic effect - Carcinogenic, skin irritation, rhinitis, and allergic contact dermatitis [27]

Milk and Whey-Derived Antimicrobial Peptides

Antimicrobial peptides can be classified based on their origin, activity, structural characteristics, and synthesis process. Antimicrobial peptides can be isolated from microbes, amphibians, and insects. Various microorganisms such as bacteria and fungi can serve as a source of AMPs [5]. Nisin and gramicidin are classic examples of AMPs originating from Lactococcus lactis, Bacillus subtilis, and Bacillus brevis. The relatively high cost involved in chemical synthesis of AMPs leads to more interest in microbial origin peptides. Mammalian milk is a very potent source of antimicrobial peptides. α-Lactalbumin, β-lactoglobulin, lactoferrin, and other casein fractions are the major identified AMPs of milk origin [29]. On the basis of their activity, AMPs can be classified into 18 major categories (in light of ADP3 database). These categories include antimicrobial (antibacterial, antiviral, antifungal), antiparasitic, anti-human immunodeficiency virus, and antitumor peptides. A significant number of AMPs have antibacterial activity against common pathogenic bacteria (Table 2). Number of synthetic antimicrobial peptides display inhibitory activity against both Gram-positive and Gram-negative pathogens. In an in silico study, goat milk proteins were highlighted as a potential source of AMPs having application in food sector. Different online tools were used to predict the physiochemical properties, toxicity, and allergenicity of peptides [44].

Table 2.

Milk-derived AMPs and their activities

Antimicrobial peptide Amino acid sequence No. of amino acids Biological role and mode of action Reference
β-Casein211-225 from human milk YPVTQPLAPVHNPIS 15

Effective against E. coli and Y. enterocolitica

Effectively reduced ileal mucosa damage in an experimental necrotizing enterocolitis mice model

[16]
α-s2-casein peptides from camel milk IKEVESPAE, VPTENKISQ, AEVPTENKISQ, NIKEVESPAE, AVRNIKEVESPAE, VESPAEVPTENKISQ, VAIHPSKED 9–15 Effective against Strep. faecalis, Sh. dysenteriae, Staph. aureus, and E. coli [33]
PDC213 (derived from β-casein213-226 of human milk) VTQPLAPVHNPISV 14

Effective against Staph. aureus and Y. enterocolitica

Permeabilize bacterial membranes and cell wall leading to cell death

[34]
Bovine β-casein YQEPVLGPVRGPFPIIV, YQEPVLGPVRGPFPI 15–17 Antimicrobial activity against E. coli DH5 α [35]

Bovine k-casein

Kappacin A106-169

AIPPKKNQDKTEIPTINTIA-SGEPTSTPTTE AVESTVATLEDSPEVIESP-PEINTVQVTSTAV 63 Antibacterial against Gram-positive and Gram-negative pathogens [31]

Isracidin1-23

(α-casein)

RPKHPIKHQGLPQEVLNENLLRF 23 Broad-spectrum activity displayed under in vitro and in vivo conditions [36]

Caseicin A 21–29

(α-casein)

IKHQGLPQE 9 Effective against Gram-negative bacteria [30]

Caseicin B 30–37

(α-casein)

VLNENLLR 8 Effective against Gram-negative bacteria [30]
Casocidin-I150-188 (α-casein) KTKLTEEEKNRLNF-LKKISQRYQKFALPQYLKTVYQHQK 39 Antimicrobial activity against Gram-positive and Gram-negative bacteria, and yeast [37]
Bovine isracidin RPKHPIKHQGLPQEVLNENLLRF 23 Antimicrobial activity against E. coli DH5 α [35]
Bovine lactoferrin (LF) FKCRRWQWRM KKLGAPSITCVRRAF 25 Displays antibacterial, antiviral, antifungal, and anti-parasitic activity [38]
Lactophorin camel milk IYMESPQPTDTSPAQ, FRNTATQSEETKE, VIMSNHQVSPSED, SSFRNTATQSEETKE, LHPVPQESS, SSFRNTATQSEE 9–15 Effective against Strep. faecalis, Sh. dysenteriae, Staph. aureus, and E. coli [33]
Lactoferrampin bovine LF WKLLSKAQEKFGKNKSR 17 Bacterial membrane disruption [32, 39]
Peptide from yak milk RVMFKWA 7 Antimicrobial activity against B. subtilis, Staph. aureus, L. innocua, E. coli, E. cloacae, and Salm. paratyphi [40]
Sheep αs2-casein LKKISQ, LKKISQYYQKFAWPQYL, PYVRYL, VDQHQKAMKPWTQPKTNAIPYVRYL 6–25 Antimicrobial [41]
Cow β-lactoglobulin ALPM, LKP, VAGTWY 3–6
Cow β-casein GPIHNS, GPVRGPFPIIV, KIHPFAQT, MPIQAFLL, PVLGPVRGPFPIIV, YQEPVLGPVRGPFPIIV 6–17 Antimicrobial [42]
Cow κ-casein TVQVTSTAV, MAIPPKKNQ, MAIPPKKNQD 9–10 Antimicrobial
αs2-Casein151–181 bovine milk TKLTEEEKNRLNFLKKISQRYQKFΑLPQYLK 31 Antibacterial activity against B. subtilis and E. coli [43]

Antimicrobial peptides can also be classified on the basis of constituent amino acids such as proline-rich peptides, tryptophan-arginine-rich peptides, histidine-rich peptides, and glycine-rich peptides. The amino acid composition primarily regulates the antimicrobial activity and probable mechanism of action. For example, AMPs rich in proline (non-polar amino acid) enter bacterial cells through the non-invasive pathway. In contrast, arginine and histidine (basic amino acids)-rich peptides are attracted towards anionic bacterial membrane. On the basis of structural conformation of AMPs, they can be divided into four major categories, viz., linear, α-helical peptides, ß-pleated sheet peptides, linear extension structure, and both α-helical and ß-sheet peptides. This section focuses on milk and whey as source of AMPs. Casein makes up 80% of milk protein. Casein hydrolysis results into generation of diverse number of antimicrobial/bioactive peptides. Isracidin was the first antimicrobial peptide obtained from bovine casein hydrolysate. Casein hydrolysate-based AMPs, such as casecidin (caseicin A and caseicin B), lactenin, isracidin, and kappacin, are derived from α-, ß-, and ĸ-casein fractions [9]. αs1-casein f(99–109) obtained from pepsin-mediated hydrolysis of bovine sodium caseinate protein displayed antimicrobial activity against Gram-positive (B. subtilis and Listeria innocua) and Gram-negative bacteria (Salmonella typhimurium, E. coli, Salmonella enteritidis, and Citrobacter freundii) [45]. Caseicin A αs1-casein f(21–29) and caseicin B αs1-casein f(30–37) from bovine casein checked the growth of Cronobacter sakazakii in powdered infant formula trials [30]. In later studies, these peptides were found to inhibit Klebsiella spp., Salmonella spp., and Staph. aureus [46]. The chymosin digest of bovine sodium caseinate results into release of αs2-casein f(181–207), f(175–207), and f(164–207), which showed potential inhibition of a wide variety of Gram-positive and Gram-negative bacteria [44]. Another ĸ-casein-derived peptides such as kappacin, k-casein A (138–158) exhibited potential activity against Streptococcus mutans, E. coli, and Porphyromonas gingivalis [31].

Whey proteins are obtained following casein precipitation and constitute about 20% of the remaining protein in milk. Hydrolysis of whey proteins can generate bioactive peptides having antioxidant, antimicrobial, antihypertensive, and antidiabetic activities [47]. Whey lactoferricin (Lfcin) is a well-identified multifunctional peptide obtained from pepsin hydrolysis of bovine lactoferrin protein. Chemically synthesized lactoferrin domain peptide lactoferrampin f(268–284) exhibits anti-Candida activity and antibacterial activity against B. subtilis, E. coli, and Pseudomonas aeruginosa [32]. β-Lactoglobulin, another fraction of whey protein, composing 50% of whole protein can be found in the milk of many mammals, but not in human milk. Upon tryptic digestion, it produces four fragments including f(15–20), f(25–40), f(78–83), and f(92–100) displaying activity mainly against Gram-positive bacteria [48]. This protein component resists proteolytic enzymes and gastric digestion and serves as a stabilizer in yogurt and cheese due to its heat-gelling capacity [49]. α-Lactalbumin, another fraction of whey protein (14.4 kDa), results from trypsin or chymotrypsin digestion. Its presence in bovine milk is just 20%, while in human milk, it is the most abundant whey protein [50]. This protein component has high nutritional value leading to its commercial application in infant formula. Furthermore, it displays high antagonistic activity against Gram-positive bacteria including antibiotic-resistant variants.

Synthesis, Purification, and Identification of AMPs

Antimicrobial peptides that are encrypted in an inactive form within the protein can be released either through enzymatic hydrolysis or via microbial fermentation. Enzymatic hydrolysis, especially used in the food and pharmaceutical industries, is the most common approach for decrypting bioactive peptides from whole protein sources. Proteases used for hydrolysis may be of the gastrointestinal origin or from microbial or plant source. Trypsin and pepsin are the prominent proteases commonly used to obtain bioactive peptides with diverse activities. In particular, trypsin and pepsin hydrolysis have contributed to most of the recognized antimicrobial peptides [51]. In addition, alcalase, chymotrypsin, pancreatin, and thermolysin are used individually or in combination to release bioactive peptides from diverse protein sources. Shorter reaction time and ease of scalability select enzymatic hydrolysis over microbial fermentation. Proteolytic enzymes of microbial origin can be the source of many new peptides with unique bioactivities. Microbial proteases represent one of the most important tools in the modification of protein structure, development, and production of new protein hydrolysates to obtain specific peptides that can be commercially exploited. The peptide bonds cleaved by the proteolytic enzymes are surrounded by the amino acid sequence having some degree of substrate specificity. For instance, when bovine milk casein is hydrolyzed using pancreatin, the rate of peptide fragments produced is highest for ß- and α-casein [52]. In contrast, papain most effectively hydrolyzes sodium caseinate, followed by trypsin and pancreatin [53]. Thus, different milk sources differ in susceptibility to hydrolytic enzymes, which indicates differences in the number, type, and concentration of bioactive peptides.

Microbial fermentation to obtain bioactive peptides is gaining recognition due to being a natural, safe, and cost-effective strategy. Lactic acid bacteria (LAB) have developed the ability to hydrolyze proteins to compensate for their amino acid requirement. LABs not only generate free amino acids for their own use but also produce a wide range of biologically active peptides [54]. The proteolytic system of LABs mainly comprises of cell wall-bound proteinases (initially degrade casein into oligopeptides), peptide transporters (transfer oligopeptides into the cytoplasm), and distinct intracellular peptidases, including endopeptidases, aminopeptidases, tripeptidases, and dipeptidases which convert peptides into small molecules and generate free amino acids [55]. The proteolytic activity of LABs is exerted in a species- and strain-dependent manner. To name a few LABs, Lactobacillus helveticus, Lact. delbrueckii subsp. bulgaricus, Lact. delbrueckii subsp. lactis/diacetylactis, and Lact. delbrueckii subsp. lactis/cremoris display effective proteolytic activity for milk protein hydrolysis [56]. Especially, Lact. helveticus strains are most extensively studied and known to possess high extracellular proteinase activity. Fan and coworkers identified 212 peptide sequences from casein fermented with Lact. helveticus, among which 44 previously identified peptides possess antimicrobial activity [57]. In another study, Lactobacillus acidophilus-generated peptides (IKHQGLPQE, VLNENLLR, and SDIPNPIGSENSEK) displayed antibacterial activity against pathogenic Enterobacter sakazakii and E. coli [30]. Ebner and coworkers investigated the proteomic profile of kefir (alcoholic fermented milk beverage) and identified 257 peptides mostly released from β-casein [58]. Among them, 16 peptides were previously reported to have antimicrobial, immunomodulatory, ACE inhibitory, opioid, antithrombotic, mineral binding, and antioxidant activities. Fungal strains, e.g., Aspergillus oryzae and Aspergillus flavipes, have also been used for generating bioactive peptides from bovine and goat milk via solid-state fermentation. The generated peptides displayed potent antimicrobial activity [59]. Caseicin A (IKHQGLPQE) and caseicin B (VLNENLLR) generated from sodium caseinate fermentation by Bacillus cereus and Bacillus thuringiensis effectively inhibited C. sakazakii [60].

Recombinant DNA technology (RDT) is extensively used for the production of proteins and hormones having wide application in medical sciences. RDT has now also been explored for scaling up both the production and yield of the specific bioactive peptides. This method allows simultaneous production of several peptides by expression of peptide coding region into microbes [61]. AMPs of milk origin have been produced by over-expression of bovine lactoferricin B-W10 (LfcinB-W10), a novel derivative of cationic antimicrobial peptide lactoferricin Lf(f17–41) in E. coli. Likewise, by combining bovine lactoferricin and the inducible insect antimicrobial peptide thanatin, a hybrid antimicrobial peptide was developed [62].

Membrane filtration technology is the method of choice for the isolation and purification of peptides based on molecular weight. It has several advantages such as being cost-effective, non-chemical, energy-saving, and easy to set-up. Protein hydrolysates obtained following hydrolysis are fractionated through molecular weight cut-off membranes of varying sizes (0.5 to 100 kDa). Different fractions are later screened for their antimicrobial activity. Goat milk casein hydrolysates low molecular weight (< 3 kDa) fractions showed high antimicrobial activity against E. coli and B. cereus as compared to 3–10 kDa fractions [63]. Nanofiltration technique could also be applied for isolation of peptide with molar mass < 1 kDa, as it consists pore size of 0.5–2 nm [64]. More recently, an electrodialysis with filtration membrane technique has been adopted for increased efficiency based on peptide molecular weight and net charge [65]. For analytic purpose, there are many powerful techniques for separation, purification, detection, and isolation of bioactive and novel antimicrobial peptides. These are one-dimensional electrophoresis, high-performance liquid chromatography (HPLC), reverse-phase liquid chromatography (RP-HPLC), ion-exchange chromatography (IEC), size-exclusion chromatography (SEC), fast protein liquid chromatography (FPLC), gel-filtration chromatography, affinity chromatography, or multidimensional system. RP-HPLC is the most widely used purification method for milk-derived bioactive peptides due to its quick detection and separation potential from the sample mixture. Peptides are fractionated using an analytical silica-based RP-C18 column in the stationary phase [66]. The peptides fraction obtained are collected between retention and gradient time and the data is analyzed using an ultra-violet detector [63]. This technique has been preferably used to fractionate protein and peptide content in both one-dimensional and multidimensional separation systems based on peptide polarity and molecular weight. Size-exclusion chromatography also separates peptide molecules based on molecular size. Earlier, Morais and coworkers used SE-HPLC and separated whey protein concentrate hydrolysates into four fractions and characterized peptides according to chain length with molar mass < 1000 Da [67]. Parameters such as pore size/volume, ionic strength, and mobile phase nature affect the performance of the SE-HPLC column [68]. A multidimensional separation system combining more than one separation tool provides high-resolution power and peak capacity as compared to the one-dimensional purification and separation approach. Using this approach, Rahimi and coworkers hydrolyzed camel milk casein protein enzymatically and the peptides obtained were fractionized by multidimensional technique using ultrafiltration membranes and semi-preparative RP-HPLC [69]. However, multidimensional separation techniques are not always effective, due to variable nature of operational techniques which makes the solvent incompatible, while proper selection of combination of different multidimensional separation system will lead to potential outputs as well as purify and identify peptides of complex samples with high desirable bioactivity [65].

Identification and Characterization of Peptides

The antimicrobial peptide sequence can be determined using various approaches such as matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF MS), electro spray ionization (ESI), and nanostructure laser desorption/ionization (NALDI). In recent years, the most frequently used method for profiling and identification of peptides from several food sources including milk is through liquid chromatography coupled with mass spectrometry (LC–MS) [70]. The chromatographic technique combined with mass spectrophotometry termed as liquid chromatography/tandem mass spectrometry (LC–MS/MS) identifies and characterizes complex mixtures of peptide sequence, based on their molecular mass, and has high resolution and separation efficiency [71]. Fractionated peptides are desalted on a RP-C18 trap column and further separated using reverse-phase C18 analytical column. The eluted peptides are collected at different time intervals, on particular flow rate and the data monitored using MS analyzer instrument such as Q-Exactive Orbitrap and Q-TOF ion-trap. Peptide databases like BIOPEP, UNIPROT, SWISS PROT, and MBPDB are used to identify amino acid sequence for discovery of novel peptide [72]. Nowadays, in silico techniques like homology modeling, hidden Markov models, and support vector machine are also explored for modeling of identified protein fragments to confirm their bioactivity. Figure 1 represents the different antimicrobial peptides synthesis, purification, and identification strategies.

Fig. 1.

Fig. 1

Schematic representation of different antimicrobial peptides synthesis, purification, and identification strategies

Antimicrobial Peptide Database

Peptides derived from food proteins, due to their biological and functional properties, are considered valuable health beneficial and functional food components. The research interest in bioactive peptides is reflected by the huge spike in the number of articles published annually on these peptides [73]. The latter has ramifications in terms of the necessity to collect and store the huge amount of data being generated in databases. A variety of databases have been developed in the past to keep track of various types (antiviral, antimicrobial, antitumor, hemolytic, and cell penetrating peptides) of bioactive peptides [74]. Most of the information about these bioactive peptides is available in various databases such as TumorHoPe [75], Biopep-UWM, StraPep, FeptideDB, ACEpepDB, BioPD, APD, BACTIBASE [76], CAMP, PenBase [77], RAPD [78], Hmrbase [79], PhytAMP [80], PeptideDB, ACEpepDB [81], Amper [82], and BAGEL3 [83].

Several antimicrobial peptide databases have been created over the past several years including Peptaibol Database [84], PenBase [77], Defensins Knowledgebase [85], PhytAMP [80], BACTIBASE [76], CAMP [86], YADAMP [87], DAMPD [88], Milk AMP [89], CAMPR3 [90], DBAASP [91], APD [92], MBPBD [93], FeptideDB [94], and FermFooDb [74]. Despite the huge potential of antimicrobial peptides from food especially from milk, only a few databases are dedicated to them. Food-derived bioactive peptides have been widely reported since the 1970s. However, in databases of food-derived antimicrobial peptide, the information including sequence, function, source, and references is poorly integrated. There are few reasons for poor integration of relevant information regarding active peptides from food sources: first, their sequence information is to be gathered from the relevant published articles and databases; second, lack of professional classification in food sources of active peptide; and lastly, several connections between food-derived peptides, their origins, roles, and products are unknown. Due to the lack of a comprehensive database on food-derived peptides, researchers in laboratories and industry must scour the Internet for them [95]. Milk AMP database was designed specifically for milk antimicrobial peptides and lists natural and artificial antimicrobial peptides derived from amino acid sequences of dairy proteins of different origins. The database was created with an aim to provide comprehensive information on peptide structure/function relationships, inhibitory activity, spectrum of action, and minimal inhibitory concentration (MIC) determined for each tested microbial strain. It includes a fairly complete list of references for each peptide. The information in this database will supplement conventional databases by supplying missing data and allowing for rapid prediction of structure/function correlations and target organisms, resulting in improved usage of peptide biological activity in both the pharmaceutical and food industries. At the time of creation, it contained 371 entries, including 9 hydrolysates, 299 antimicrobial peptides, and 23 peptides predicted as antimicrobial, as well as 40 non-active peptides. This database also allows entries from users for expansion and improvement in data [89].

MBPDB is a comprehensive database of functional peptides in milk. This database was created to identify and analyze novel bioactive peptides and allows examination of patterns in the data of bioactive peptides. The database offered improvement over earlier databases in being specific and comprehensive to all milk bioactive peptides across species and proteins with several advanced search functions. This database helps in the creation of prediction models based on the relationship between peptide structure and activity to determine the likelihood of bioactive milk peptides identified in other types of biological samples. This database contains information for 177 AMPs only as some information was lacking in the rest of the AMPs from other databases such as the original research article, the full sequence of amino acids in peptide, bioactive function, source species, and source proteins [93]. The BIOPEP-UWM database, a widely used database in food and nutrition science, is freely accessible. This database is continuously being updated and modified. The BIOPEP-UWM provides databases of proteins, allergenic proteins, and their epitopes in addition to bioactive peptides. The database enables users to help in update of the database by allowing them to submit a peptide sequence, which after verification gets updated. The information provided by the database consists of ID number, name, sequence, function, number of amino acid residues, activity, chemical mass, and bibliographic data [72]. FermFooDb is a consolidated database that maintains biologically active peptides obtained from fermented foods. As the food industry, especially dairy industry, is focusing mainly on the commercialization and development of novel fermented foods, this database can be of great use for the purpose. This database enables users to evaluate the medicinal potential of fermented foods using the wide range of bioactive peptide characteristics stored in this database, which are compiled from existing databases like AHTPDB, ACEPepDB, BIOPEP, and MBPDB [74]. This database maintains the different peptide properties like sequence, physicochemical properties, length, and IC50 value as well as fermentation process along with compiled details including experimental model, starter culture, and PubMed ID of research article.

Mechanisms of Action of Antimicrobial Peptides

Activity and specificity of AMPs precisely depend upon structural parameters, such as conformation, charge, hydrophobicity, amphipathicity, and polar angle. It is important to note that these molecular determinants are interdependent; hence, modification of one parameter often leads to compensatory alterations in others. Here, the article will discuss in general the major structural components of antimicrobial peptides that influence their mechanism of action. In spite of the structural conformational homology displayed during target membrane interaction, AMPs display immense diversity in their peptide sequences. The reason for this structural homology could lie in the presence of specific peptide sequences that are crucial for particular activity irrespective of the sequence of remaining peptide residue. One such important feature is the presence of glycine residue cap at N-terminal of peptide chain. Tossi and coworkers reported that glycine at the first position of N-terminus region of α-helical peptide is relatively conserved sequence [96]. Glycine residue cap prevents peptide cleavage by aminopeptidases. Likewise, presence of peptide amidation has been observed as another important post-translational modification for AMPs. The peptide amidation provides one additional H-atom which in turn transfers the energy to acquire helical structure as well as prevent the cleavage of peptide by carboxypeptidases [97]. In addition to these specificities, presence of long stretch of basic amino acids (lysine and arginine) also enhances the cationic nature of peptides [96]. The partition constant of AMP and membrane is an important factor that determines interaction between AMP and cell surface. Usually, AMPs have higher magnitude of partition constant as compared to the charged cell membranes. The aromatic amino acids are a major contributor towards partition constant and facilitate the anchoring of peptide to the head group of lipid bilayer [98]. Some amphipathic peptides acquire conformation in which hydrophobic residue resides on one side and hydrophilic on the other. The hydrophilic cationic domain initially interacts with the membrane surface and the hydrophobic portion leads to peptide insertion (mediated via Van der Waals interaction and hydrophobic interaction in hydrocarbon chain).

The degree of structure is another pivotal aspect of antimicrobial peptides. The peptides usually acquire α-helix or β-sheet conformation, which upon contact with the cell membrane helps peptide to combat with the differences in partition constants between AMP and cell membrane. Electrostatic charge is another driving factor that influences peptide attraction towards microbial cell and peptide folding at lipid peptide interface. Most of the antimicrobial peptides are cationic in nature with net positive charge ranging from + 2 to + 9. The presence of acidic phospholipids, phosphatidylserine, and cardiolipins imparts negative charge to the cell membrane. Additionally, presence of lipopolysaccharide in Gram-negative bacteria and teichoic/lipoteichoic acid in Gram-positive bacteria distributes the total anionic charge. Likewise, presence of phosphomannans, chitin, and β-1 → 3 glucan carries strong negative charge to the fungal cell wall. In contrast, mammalian cells have higher proportion of cationic components such as phosphatidyl choline, phosphatidylethanolamine, sphingomyelin, and no/low amount of anionic components (phosphatidylglycerol and cardiolipins) conferring net positive charge to the mammalian membrane [99]. Thus, the electrostatic charge is prime factor that regulates the initial interaction of peptide with cell surface. The difference in electrostatic potential and lipid composition of microbial cells plays a major role in the selectivity and specificity of antimicrobial peptides. For instance, Tossi and coworkers observed that increase in charge of magainin-2 peptide from + 2 to + 5, while keeping other factors stable, increased its antimicrobial activity [96]. Furthermore, it was also observed that the increase in cationic charge from + 6 to + 7 did not improve the antimicrobial activity. This may be due to the fact that increase in positive charge results in strong interaction between peptide and phospholipids, which hinders peptide translocation through the microbial membrane. The addition of a formal net charge of + 8 to a peptide increased activity against yeast cells while decreasing activity against Bacillus megaterium and Staph. aureus. This could be explained by stearic impediment in peptide helix formation due to its near proximity and net repulsive contact between basic residues of packed peptides [96]. In addition to this, the electrostatic repulsion within the peptide decreases the lifespan of the pore, thus reducing its membranolytic activity.

Amphipathicity is the measure of relative ratio of hydrophobic and hydrophilic residues in the peptide. Quantitatively, the vector sum of all hydrophobic amino acid, normalized to ideal helix, gives the measure of hydrophobic moment and, hence, the amphipathicity. Alpha-helical conformation is the most favorable conformation acquired by amphipathic peptides having 3–4 amino acids per turn periodically. This is the crucial property of an AMP for its initial interaction with the cell membrane. In α-helix, polar phase is attracted towards the negatively charged membrane and non-polar phase causes insertion into membrane through Van der Waals forces and hydrophobic interactions leading to increased permeability. Hydrophobicity, the measure of hydrophobic residues within a peptide, determines partition constant of membrane hydrophobic core [100]. It is suggested that hydrophobicity has higher impact on toxicity towards host cell as compared to antimicrobial activity. Beyond some threshold value, the increase in hydrophobicity enhances peptide hemolytic activity and decreases its ability to discriminate between host and microbial cells [101]. For example, Chen and coworkers demonstrated that the increased hydrophobicity of L-V13K peptide enhanced its activity against RBCs by 62.5 times. Increasing hydrophobicity beyond a certain limit causes oligomerization or dimerization of peptide, resulting in the formation of energetically stable peptide aggregates [102]. The higher aqueous stability of peptide aggregates can prevent the partition into the membrane, displaying weaker interaction with membrane surface. A systematic study on gramicidin S exhibited that the balance between hydrophobicity and amphipathicity is the key factor that determine relative therapeutic ability of peptide (i.e., directly affects their hemolytic and antimicrobial activity) [103].

Polar angle of peptide represents the relative fraction of polar versus non-polar faces of an amphipathic helical peptide. Any aggregation or change in the polar or non-polar residue tends to change the polar angle. It is assumed that higher non-polar (hydrophobic) domain in peptide is directly related to smaller polar angles and increased membrane permeabilization [104], thus having a strong correlation with membrane stability and pore formation. Irrespective of the precise mechanism of action, all AMPs primarily act on the plasma membrane through the establishment of electrostatic bonding with plasma membrane components [105]. AMPs acquire α-helical or β-sheet conformation upon coming in contact with the membrane via electrostatic force of attraction. Anionic AMPs usually complex with zinc ion or highly cationic peptides. Cationic AMPs can easily bind to negatively charged cell surface. Nisin specifically binds with the lipid II component of cell wall. Mersacidin also interferes with transglycosylation and peptidoglycan synthesis of Gram-positive cell wall via targeting lipid II [106]. Following binding, a critical concentration of AMP is required to precede surface disruption. With multimerization, AMPs penetrate into the deeper layers of target cell surface. AMPs enter cells via membrane lytic or non-membrane lytic mode. Various models, viz., barrel stave model, toroidal model, and carpet models, have been identified for membrane lytic mechanism of AMPs (Fig. 2). In barrel stave model, AMPs adopt amphipathic conformation in the membrane to form a stave (spokes within barrel)-like structure which goes deep inside the membrane forming a stable pore-like structure that disrupts the membrane integrity [107]. Toroidal model is primarily shown by α-helical AMP molecules. The helical AMPs position parallel to the membrane, resulting in displacement of phospholipid groups. These cause break in hydrophobic regions and induce a strain on membrane. After attaining a threshold critical concentration, AMPs change their conformation perpendicular to the membrane and form toroidal pore complex [108]. In carpet model, AMPs initially bind to cell surface causing conformational change within them. After attaining threshold concentration, AMPs cover the surface of target cell in sheet/carpet-like manner, causing change in energy kinetics and fluidity of membrane which subsequently leads to membrane destabilization. In the final stage, AMPs saturate the cell membrane resulting in membrane collapse into micelles.

Fig. 2.

Fig. 2

Mechanism of action of the antimicrobial peptides by membrane lytic mechanism [A barrel stave model, B toroidal model, C carpet model] and non-membrane lytic mechanism, D aggregate model, E sinking raft model, F electroporation, and G leaky slit model]

Several models (aggregate channel model, sinking raft model, electroporation model) have been proposed for explaining non-membrane lytic action mechanism of AMPs (Fig. 2). In “aggregate channel model,” AMPs initially attract to the cell surface and consequently get inserted into the membrane. Following insertion, peptide conformed itself into unstructured aggregate that covers the membrane. These peptide aggregates associate with water molecules, thus leading to formation of channels through which ions and larger molecules get leaked. Some AMPs preferentially bind to specific lipid domains in the lipid membrane and thus causes imbalance in mass ratio. This imbalance increases membrane curvature of confined regions leading to peptide translocation. This phenomenon is referred to as sinking raft model, and is responsible for creating transient pores in the membrane through inducing mass imbalance in peptides of membrane leaflet [109]. Electroporation model proposes transient membrane pore formation under the influence of electric field. This only occurs when peptides have sufficient charge density to generate the electric potential of at least 0.2 V. This model explains the mechanism of entry opted by annexin V peptide [110]. Some peptides significantly disrupt cell membrane by forming lipid peptide domains. This phenomenon can be explained with the peptide-induced lipid segregation mechanism, where peptide induced the segregation of anionic components from zwitterionic lipids and can even cause the de-mixing of the anionic lipids in Gram-positive model membrane [111]. Arouri and coworkers proposed that peptides can induce lipid segregation in PG/PE (phosphoglycine/phosphoethanolamine) membranes, which could be the specific action of these peptides on bacterial membrane and hence their killing [112]. Zhao and coworkers suggested that AMPs can act similar to some bacterial cytotoxin proteins and cytolysin [113]. Peptide bound to lipids acquires linear amphipathic structure with hydrophobic portion facing towards lipid bilayer, which enhances the insertion of lipid-protein complex in the membrane. The hydrophilic face increases the hydrogen bond-assisted self-multimerization between the proteins leading to the formation of long fibrils that confer cytotoxicity. The insertion of lipid-protein aggregates increases the positive curvature in the membrane which causes transient leakage in the cell membrane (leaky slit) and thus enhances membrane permeabilization. Finally, these fibrils acquire conformation of amyloid-like structure that spans the complete cell membrane. This mechanism proved that the conformational flexibility, amphipathicity, and propensity to fold are the basic properties that affect the toxicity of AMPs.

AMPs cause microbial cell death via disruption of cell membrane. Membrane disruption causes the leakage of cell contents to the surrounding and thus killing the cells. AMPs also target several other microbial cell components. Various cationic AMPs can bind to nucleic acid (anionic) due to electrostatic force of attraction. Buforins isolated from Bufo bufo gargarizans can bind to DNA. Buforin II, a 21-amino acid peptide, is able to induce membrane permeability in Gram-negative bacteria. Similarly, indolicidin (13-amino acid peptide) derived from cytoplasmic granules of bovine neutrophils attacks at a basic site of DNA, thus inhibiting its biosynthesis. Furthermore, it also binds to DNA topoisomerases, thus preventing DNA relaxation of replication fork [114]. Another AMP microcin 25 (mcc25 or J25) isolated from the E. coli AY25 is a potent antibacterial peptide, particularly against Gram-negative bacteria. Microcin J25 binds to catalytic center of RNA polymerase and disrupts transcript elongation [115]. Lactoferricin B hinders bacterial growth by suppressing phosphorylation of the two-component system [116].

Application of Milk-Derived Antimicrobial Peptides

AMPs with broad-spectrum activity against a wide range of pathogens are considered promising candidates for the development of new bio-preservatives. AMPs have been shown to have a number of biological actions, including antibacterial, antiviral, antifungal, and anti-mitogenic effects, as well as anticancer and anti-inflammatory capabilities and the potential to modulate the immune system. Their broad spectrum of activity, effective antibacterial action, less susceptibility to resistance development, and potent immunomodulatory effects make them suitable to be used as an alternative to a wide range of regularly used bio-preservatives and medications [117]. During the past decade, application of antimicrobial peptides in food and pharmaceutical industries for designing safer and functional food/pharmaceutical options has gained immense interest.

Application in Food and Dairy Sector

Milk-derived AMPs can serve as promising alternative to chemical preservatives. Introduction of milk-derived AMPs may provide a new arena to food industry, which can fulfill the consumers’ demands without compromising industrial interests. Several AMPs have been evaluated for their potential to inhibit foodborne pathogens in a number of food matrices such as dairy, meat, beverage, and fruit-based products. Recently, Yang and coworkers reported an antimicrobial peptide from whey acidic protein (WAP) of large yellow croaker (Larimichthys crocea) [118]. The peptide LCWAP displayed MIC value of 15.6 µg/mL against Staph. aureus. The killing effect was due to the disruption of cell membrane integrity resulting in leakage of cell contents. The peptide had no cytotoxic effect on hepatocytic cells of human, but had strong inhibitory effect on the growth of Staph. aureus in milk. Similarly, a peptic hydrolysate of LF at a dose of ≤ 2 mg/mL under limiting conditions of temperature (4 °C) and pH 4.0 could restrict the growth of E. coli O157:H7 and Listeria monocytogenes in milk [119]. Earlier, Quinteri and coworkers established the potential of LFcin B in restricting the spoilage of mozzarella cheese from mesophilic bacteria [120]. The presence of isracidin and kappacin in Italian cheeses indicates the release of antimicrobial peptide by microbial proteases during cheese formation and ripening process [121]. Recently, a combination of LFcin B (0.5 mg/g) and high pressure (400–500 MPa) was reported to significantly control the population of Pseudomonas fluorescens ATCC948 [122]. On the other hand, lactoferrin has been incorporated in different food matrices such as in sausage batters [123], bologna [124], ground beef/meat fractions [125], and fennel [126]. However, rapid degradation in food matrix poses the major limitation with AMP application in food. Several milk-derived peptides such as casocidin and isracidin [127] and LFcin B were evaluated for their resistance against microbial proteolytic degradation using different starter cultures (Streptococcus thermophilus and Lact. delbrueckii subsp. bulgaricus strains). Long sequenced AMPs and chemical modification in sequences can help generate AMPs with reduce susceptibility to proteolysis.

The U.S. Food and Drug Administration (FDA) have conferred lactoferrin with Generally Recognized as Safe (GRAS) status since 2000. European Commission (EC) approved use of bovine Lf (bLf) in different food categories and documented its maximum levels under Regulation (EC) No. 258/97 [128]. Bovine lactoferrin has found its application in infant milk formula, fermented and skim milks, yoghurts, drinks, and nutritional supplements [128–130]. In oil industry, lactoferrin was reported to decrease oxidation of unsaturated fatty acids, thus enhancing shelf life of soybean oil powder. Lactoferrin also inhibit Dekkera bruxellensis, yeast responsible for deteriorating wine quality [131]. Enrique and coworkers reported that LF f(17–31) peptide-based approaches have potential to control the population of Saccharomyces cerevisiae and other spoilage wine yeasts (Cryptococcus albidus, Dekkera bruxellensis, Pichia membranifaciens, Zygosaccharomyces bailii, and Zygosaccharomyces bisporus) and bacteria (Levilactobacillus brevis (formerly Lactobacillus brevis), Lactobacillus hilgardii, Pediococcus damnosus, and Oenococcus oeni) without compromising wine attributes [132–134]. Functional coating with immobilized lactoferricin B controlled the microbial deterioration of cheese [120]. Del Olmo and coworkers showed that lactoferrin and its derivatives under hydrostatic pressure significantly control the bacterial (E. coli O157: H7 and P. fluorescens) contamination in chicken fillet [135]. Taylor and coworkers demonstrated that spray application of bovine milk-derived lactoferrin on raw beef reduces the microbial contamination [136]. A commercial LF-based spray for control of bacterial contamination in beef during carcasses processing was approved by the USDA–FSIS in 2008 (US Department of Agriculture Food Safety and Inspection Service). Barbiroli and coworkers used the combination of lysozyme and lactoferrin on carboxyl-methyl cellulose single use paper napkins, which effectively controlled growth of Listeria sp. [137]. In a similar study, cellulose film was coated with bLf and its antimicrobial activity was evaluated in packaging fresh sausage. The bLf-coated cellulose film could effectively reduce E. coli and Staph. aureus [138]. Nakamura reported the antimicrobial, iron binging, and emulsifying properties of glycosylated Lactoferrin (gLf) [139]. Glycosylated Lf showed 1.29 times higher iron binding and emulsification property than native lactoferrin and repressed the growth of E. coli in cottage cheese at 15 °C for a week. Lactoferrin is stable at pasteurization conditions and significantly maintains its storage stability and iron binding activity. LFcin displays better bactericidal over fungicidal activity [134]. Milk-derived AMPs can also serve as potential candidate to control the growth of food spoilage microbes in agriculture produces such as fruits and vegetables. In this context, LFcinB and LF f(17–31) were tested on mandarins to control the population of Penicillium digitatum, thereby paving a way to use AMPs to replace the fungicides [134].

Pharmacological Applications

Antimicrobial peptides do have application as pharmaceutical agent as visible by several convincing reports. However, only a few AMPs have reached industry as drug options. Kappacin (milk peptides) along with Zn2+ ion has been shown to have antimicrobial effect by inhibiting biofilm formation by oral cariogenic microorganisms [140]. Kappacin and zinc ions are used as mouth wash solutions. Glycomacropeptide/kappacin and zinc at 1:15 produced comparable effects to chlorhexidine commercial preparations against plaque formation on teeth. Likewise, lactoferricin-derived peptides showed immense antibacterial potential against Clostridium. Teraguchi and coworkers demonstrated ability of bovine lactoferricin (intact or hydrolyzed with pepsin) to control growth of Clostridium species under in vivo conditions [141]. Mastitis, a mammary gland infection caused by Staph. aureus and Streptococcus species, is a big concern for dairy farming. Kawai and coworkers used infusion of LF hydrolysate in mastitis-infected cows [142]. They reported reduced somatic cell number on first infusion; however, the disease was eradicated in a total of 14 days. AMPs have good ability to cure systemic infection and subcutaneous infection caused by Staphylococcus spp., Pseudomonas spp., E. coli, and Candida spp. Intramuscular injection of isracidin showed protective action on mice subcutaneously infected with Staph. aureus, L. monocytogenes, and Streptococcus pyogenes (M3) and these protective effects lasted for 5 months. Recently, Elnagdy and Alkhazindar proposed that lactoferrin has the ability to enhance host immunity against viral infections, such as SARS-CoV [143]. Lactoferricin can serve as first line of defense against microbial infections as it is an important constituent of human and bovine milk. Lactoferricin hLF f(1–11) exhibited good antifungal activity against fluconazole resistant Candida species [144].

Recently, administration of hLF(1–11) at a rate of 40 µg/kg in MRSA-infected (20-h infection) neutropenic mice showed 15–60 fold cell reduction within 2 h irrespective of mode of administration (intravenous, intra-peritoneal, subcutaneous, or oral injections). However, dose-dependent effects were observed with increasing intravenous dosage. During the first phase of clinical trials, hLF(1–11) at a dose of up to 5 mg was found to be safe and well tolerated by health individuals [145]. The drug is in its second phase of clinical trial that includes testing on risk patients. Till now, LFcin B was known as potential peptide characterized with low MIC values and broad-spectrum activities in vitro. However, the claim is supported by limited in vivo studies [146]. The broad-spectrum activities such as anti-pathogenic, anticancer, and anti-inflammation characterized by LFcin B make it prime target for the development of drug molecules and functional foods. The antibacterial activity of milk sample supplemented with 1.5% whey protein concentrate and fermented with Lacticaseibacillus rhamnosus (formerly Lactobacillus rhamnosus (NS4)) was attributed to antimicrobial peptide (ETVPYMFEN) which was identified as lactoferrin that blocks the entry of bacteria by binding to the surface receptors [147]. The analysis of ionic fraction of buttermilk peptide revealed that antimicrobial activity was key characteristic of cationic peptides; on the other hand, anionic and neutral peptides were inefficient against Salmonella enterica [148]. Any modification in the peptide structure can invariably alter the function of peptide. Alvarez-Ordonez and coworkers modified αS2-casein (183–207) peptide by c-terminal pentapeptide truncation followed by substitution of alanine at position 23 with arginine and loss of lysine, which significantly reduced the antibacterial activities against L. monocytogenes and C. sakazakii. On the other hand, modification of αs2-casein f(193–203) and αs2-casein f(197–207) peptides with hydrophobic end tagging statistically enhanced the antimicrobial activities against L. monocytogenes [149].

Moreover, due to its specific properties, lactoferrin has become the choice of ligand and component to drug delivery system. It is extensively used in targeted drug delivery system for intravenous administration for encephalopathy [150], as well as hepatic [151] and pulmonary tumors [152]. This phenomenon owes to the ability of lactoferrin to act as ligand that can cause modification in nano-carriers and can cross blood–brain barrier through lactoferrin receptor-mediated transcytosis [153]. Owing to proteolytically stable structure of lactoferrin, it can withstand the gastrointestinal environment and thus can be exploited for the development of oral delivery system drugs [154].

With respect to clinical application, there are a number of AMPs, which are not from milk origin but are well studied singly or in association with some antibiotics against multi-drug-resistant bacteria with positive outcomes. In a recent study, it was observed that the use of AMPs alone or in combination with conventional drugs is effective in combating different infectious agents, especially multi-drug-resistant bacteria. In one such study, a combined action of natural AMPs with different structures and modes of action with varied antibiotic agents including gentamicin, ofloxacin, oxacillin, rifampicin, and polymyxin B toward selected bacteria was examined [155]. Akbari et al. [156] also studied the synergistic effect of antimicrobial peptides and antibiotics against multi-drug-resistant isolates of Acinetobacter baumannii and P. aeruginosa and reported a significant reduction in minimal inhibitory concentration of these organisms. Another study demonstrated SAAP-148 (synthetic antimicrobial peptide) as a promising compound against antibiotic-resistant bacteria. A single 4-h treatment with SAAP-148 containing ointment eradicated infections with methicillin-resistant Staph. aureus and MDR A. baumannii [157]. Conlon et al. [158] discovered that acyldepsipeptide (ADEP4) effectively activated the ClpP protease, having the ability to degrade more than 400 proteins, thereby forcing cells to digest themselves and killing persister cells. When combined with rifampicin, ADEP4 eliminated Staph. aureus biofilms in vitro and treated deep leg infection in mice. As an increasing body of research keeps on suggesting the development of drug resistance in microorganisms, it is becoming crucial and difficult at the same time to develop alternative antimicrobial compounds. The use of antimicrobial peptides provides a golden opportunity to develop the potential antimicrobial peptide drug candidates that can be used effectively in place of traditional antibiotics. The FDA has also approved the use of several AMPs in clinical applications (Table 3) [159]. AMPs derived from milk can also be explored further for their antimicrobial activity and can be considered to be as a potent alternative to antibiotics.

Table 3.

The antimicrobial peptide drugs approved by the Food and Drug Administration (FDA) (adapted from Lei et al. [159]

Drugs Administration In use
Bacitracin Topical Localized skin and eye infections, wound infections
Dalbavancin Intravenous Acute bacterial skin infections
Daptomycin Daptomycin Bacterial skin infections
Enfuvirtide Subcutaneous HIV-1 infection
Oritavancin Intravenous Bacterial skin infections
Teicoplanin Intravenous and intramuscular Bacterial skin infections
Telaprevir Oral Hepatitis C
Telavancin Intravenous Bacterial skin infections

Conclusion

In modern world of functional and safe food options, milk serves as an important source for the production of antimicrobial bioactive peptides. The application of AMPs in food animals and food matrices is regarded as safe alternative to antibiotics and food preservatives. Addition of AMPs in food matrices can not only replace chemical preservatives but also enhance shelf life without compromising the quality and nutritional aspect of food. Unlike antibiotics and various food preservatives, AMPs do not pose risk of resistance development in pathogenic microbes, and thus can serve as resourceful alternative against the global threat of antibiotic resistance. The commercialization of AMP in food matrices and pharmacological products requires an elaborated assessment of safety measurements through human clinical trials, which can prove their efficacy and safety. Till now, only a few studies have been attempted to assess the safety aspects of antimicrobial peptides. Therefore, a detailed understanding of the mechanism and safety aspects of the magical milk-derived AMPs can pave the way towards the development of functional and safe options for food preservation and pharmaceutical formulations.

Acknowledgements

AS acknowledges the INSPIRE Fellowship (IF190446) from the Department of Science and Technology, Government of India, for her doctoral research work. BS acknowledges the DS Kothari Post Doctoral Fellowship (BL/20-21/0194) from University Grant Commission, Government of India.

Abbreviations

AMP

Antimicrobial peptides

AMR

Antimicrobial resistance

DNA

Deoxyribonucleic acid

LAB

Lactic acid bacteria

MDR

Multi-drug-resistant

HPLC

High-performance liquid chromatography

RP-HPLC

Reverse-phase liquid chromatography

IEC

Ion-exchange chromatography

SEC

Size-exclusion chromatography

FPLC

Fast protein liquid chromatography

MALDI-TOF MS

Matrix-assisted laser desorption ionization time-of-flight mass spectrometry

ESI

Electro spray ionization

NALDI

Nanostructure laser desorption/ionization

LC-MS

Liquid chromatography-mass spectrometry

Author Contribution

All the authors significantly contributed to the manuscript. AS, RTD, AGW, JKS, and ST wrote the different sections of the manuscript. BPS, MKS, KSS, and VS reviewed the manuscript. HP conceptualized the idea, and reviewed and edited the final version of manuscript.

Declarations

Conflict of Interest

The authors declare no competing interests.

Footnotes

Publisher's Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

References

  • 1.Hager E, Chen J, Zhao L. Minireview: parabens exposure and breast cancer. Int J Environ Res Public Health. 2022;19:1873. doi: 10.3390/ijerph19031873. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Geiker NRW, Bertram HC, Mejborn H, Dragsted LO, Kristensen L, Carrascal JR, Bugel S, Astrup A. Meat and human health - current knowledge and research gaps. Foods. 2021;10:1556. doi: 10.3390/foods10071556. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Sharma C, Rokana N, Chandra M, Singh BP, Gulhane RD, Gill JPS, Ray P, Puniya AK, Panwar H. Antimicrobial resistance: its surveillance, impact, and alternative management strategies in dairy animals. Front Vet Sci. 2018;4:1–27. doi: 10.3389/fvets.2017.00237. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Lopez Cascales JJ, Zenak S, García de La Torre J, Lezama OG, Garro A, Enriz RD (2018) Small cationic peptides: influence of charge on their antimicrobial activity. ACS omega 3:5390–5398. 10.1021/acsomega.8b00293 [DOI] [PMC free article] [PubMed]
  • 5.Boparai JK, Sharma PK. Mini review on antimicrobial peptides, sources, mechanisms and recent applications. Protein Pept Lett. 2020;27:4–16. doi: 10.2174/0929866526666190822165812. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Guha S, Sharma H, Deshwal GK. A comprehensive review on bioactive peptides derived from milk and milk products of minor dairy species. Food Prod Process and Nutr. 2021;3:2. doi: 10.1186/s43014-020-00045-7. [DOI] [Google Scholar]
  • 7.Park YW, Nam MS. Bioactive peptides in milk and dairy products: A review. Korean J Food Sci Anim Resour. 2015;35:831–840. doi: 10.5851/kosfa.2015.35.6.831. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Mohanty D, Jena R, Choudhury PK, Pattnaik R, Mohapatra S, Saini MR. Milk derived antimicrobial bioactive peptides: a review. Int J Food Prop. 2016;19:837–846. doi: 10.1080/10942912.2015.1048356. [DOI] [Google Scholar]
  • 9.Niaz B, Saeed F, Ahmed A, Imran M, Maan AA, Khan MKI, Suleria HAR (2019) Lactoferrin (LF): a natural antimicrobial protein. Int J Food Prop 22:1626–1641. 10.1080/10942912.2019.1666137
  • 10.Bruck WM, Kelleher SL, Gibson GR, Nielsen KE, Chatterton DE, Lonnerdal B. rRNA probes used to quantify the effects of glycomacropeptide and α-lactalbumin supplementation on the predominant groups of intestinal bacteria of infant rhesus monkeys challenged with enteropathogenic E.coli. J Pediatr Gastroenterol Nutr. 2003;37:273–280. doi: 10.1097/00005176-200309000-00014. [DOI] [PubMed] [Google Scholar]
  • 11.Nibbering PH, Ravensbergen E, Welling MM, Van Berkel LA, van Berkel PHC, Pauwels EKJ, Nuijens JH. Human lactoferrin and peptides derived from its N terminus are highly effective against infections with antibiotic-resistant bacteria. Infect Immun. 2001;69:1469–1476. doi: 10.1128/IAI.69.3.1469-1476.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Nibbering PH, Welling MM, Paulusma-Annema A, Brouwer CPJM, Lupetti A, Pauwels EKJ. 99mTc-labeled UBI 29–41 peptide for monitoring the efficacy of antibacterial agents in mice infected with Staphylococcus aureus. J Nucl Med. 2004;45:321–326. [PubMed] [Google Scholar]
  • 13.Dijkshoorn L, Brouwer CPJM, Bogaards SJP, Nemec A, van den Broek PJ, Nibbering PH. The synthetic N-terminal peptide of human lactoferrin, hLF(1–11), is highly effective against experimental infection caused by multidrug resistant Acinetobacter baumannii. Antimicrob Agents Chemotherp. 2004;48:4919–4921. doi: 10.1111/j.1471-0307.2010.00584.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Faber C, Stallmann HP, Lyaruu DM, Joosten U, von Eiff C, van NieuwAmerongen A, Wuisman PIJM. Comparable efficacies of the antimicrobial peptide human lactoferrin 1–11 and gentamicin in a chronic methicillin-resistant Staphylococcus aureus osteomyelitis model. Antimicrob Agents Chemo therp. 2005;49:2438–2444. doi: 10.1128/AAC.49.6.2438-2444.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Wang X, Sun Y, Wang F, You L, Cao Y, Tang R, Cui X. A novel endogenous antimicrobial peptide CAMP 211–225 derived from casein in human milk. Food Funct. 2020;11:2291–2298. doi: 10.1039/c9fo02813g. [DOI] [PubMed] [Google Scholar]
  • 16.Van Boeckel TP, Brower C, Gilbert M, Grenfell BT, Levin SA, Robinson TP, Laxminarayan R. Global trends in antimicrobial use in food animals. Proc Natl Acad Sci. 2015;112:5649–5654. doi: 10.1073/pnas.1503141112. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Singh P, Gandhi N. Milk preservatives and adulterants: processing, regulatory and safety issues. Food Rev Int. 2015;31:236–261. doi: 10.1080/87559129.2014.994818. [DOI] [Google Scholar]
  • 18.Abbas ME, Luo W, Zhu L, Zou J, Tang H. Fluorometric determination of hydrogen peroxide in milk by using a Fenton reaction system. Food Chem. 2010;120:327–331. doi: 10.1016/j.foodchem.2009.10.024. [DOI] [Google Scholar]
  • 19.Singh P, Gandhi N (2015) Milk preservatives and adulterants: processing, regulatory and safety issues. Food Rev Int 31:236–261. 10.1080/87559129.2014.994818
  • 20.Tfouni SAV, Toledo MCF. Estimates of the mean per capita daily intake of benzoic and sorbic acids in Brazil. Food Addit Contam. 2002;19:647–654. doi: 10.1080/02652030210125119. [DOI] [PubMed] [Google Scholar]
  • 21.Food safety and standards (Food products standards and food additives) Regulation (2011) Version XXIV. 2022. https://www.fssai.gov.in/upload/uploadfiles/files/Compendium_Food_Additives_Regulations_30_06_2022.pdf
  • 22.Wen Y, Wang Y, Feng YQ. A simple and rapid method for simultaneous determination of benzoic and sorbic acids in food using in-tube solid-phase microextraction coupled with high-performance liquid chromatography. Anal Bioanal Chem. 2007;388:1779–1787. doi: 10.1007/s00216-007-1395-8. [DOI] [PubMed] [Google Scholar]
  • 23.Amit Z, Lasem LA, Rahamn MHLA, Rifen NNNA, Muti NHA, Ling JH (2020) Contents of Boric Acid in Noodles and Processed Foods. Borneo Journal of Resource Science and Technology 10:70–78. 10.33736/bjrst.1975.2020
  • 24.Barham GS, Khaskheli M, Soomro AH, Nizamani ZA. Extent of extraneous water and detection of various adulterants in market milk at Mirpurkhas, Pakistan. J Agri Vet Sci. 2014;7:83–89. doi: 10.9790/2380-07318389. [DOI] [Google Scholar]
  • 25.McGartland C, Robson PJ, Murray L, Cran G, Savage MJ, Watkins D. Carbonated soft drink consumption and bone mineral density in adolescence: the Northern Ireland Young Hearts project. J Bone Min Res. 2003;18:1563–1569. doi: 10.1359/jbmr.2003.18.9.1563. [DOI] [PubMed] [Google Scholar]
  • 26.Afzal A, Mahmood MS, Hussain I, Akhtar M. Adulteration and microbiological quality of milk (a review) Pak J Nutr. 2011;10:1195–1202. doi: 10.3923/pjn.2011.1195.1202. [DOI] [Google Scholar]
  • 27.Kroger M. Milk sample preservation. J Dairy Sci. 1985;68:783–787. doi: 10.3168/jds.S0022-0302(85)80889-4. [DOI] [Google Scholar]
  • 28.Cruz J, Ortiz C, Guzman F, Fernandez-Lafuente R, Torres R. Antimicrobial peptides: promising compounds against pathogenic microorganisms. Curr Med Chem. 2014;21:2299–2321. doi: 10.2174/0929867321666140217110155. [DOI] [PubMed] [Google Scholar]
  • 29.Huan Y, Kong Q, Mou H, Yi H (2020) Antimicrobial peptides: classification, design, application and research progress in multiple fields. Front Microbiol 2559. 10.3389/fmicb.2020.582779 [DOI] [PMC free article] [PubMed]
  • 30.Hayes M, Rose RP, Fitzgerald GF, Hill C, Stnton C. Casein-derived antimicrobial peptides generated by Lactobacillus acidophilus DPC6026. Appl Environ Microbiol. 2006;72:2260–2264. doi: 10.1128/AEM.72.3.2260-2264.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Malkoski M, Dashper SG, O’Brien-Simpson NM, Talbo GH, Macris M, Cross KJ. Kappacin, a novel antibacterial peptide from bovine milk. Antimicrob Agents Chemotherp. 2001;45:2309–2315. doi: 10.1128/AAC.45.8.2309-2315.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Van Der Kraan MIA, Groenink J, Nazmi K, Veerman ECI, Bolscher JGM, NieuwAmerongen AV. Lactoferrampin: a novel antimicrobial peptide in the N1-domain of bovine lactoferrin. Peptides. 2004;25:177–183. doi: 10.1016/j.peptides.2003.12.006. [DOI] [PubMed] [Google Scholar]
  • 33.Muhialdin BJ, Algboory HL. Identification of low molecular weight antimicrobial peptides from Iraqi camel milk fermented with Lactobacillus plantarum. Pharma Nutrition. 2018;6:69–73. doi: 10.1016/j.phanu.2018.02.002. [DOI] [Google Scholar]
  • 34.Sun Y, Zhou Y, Liu X, Zhang F, Yan L, Chen L, Wang J. Antimicrobial activity and mechanism of PDC213, an endogenous peptide from human milk. Biochem Biophys Res Commun. 2017;484:132–137. doi: 10.1016/j.bbrc.2017.01.059. [DOI] [PubMed] [Google Scholar]
  • 35.Birkemo GA, O’Sullivan O, Ross RP, Hill C. Antimicrobial activity of two peptides casecidin 15 and 17, found naturally in bovine colostrum. J Appl Microbiol. 2009;106:233–240. doi: 10.1111/j.1365-2672.2008.03996.x. [DOI] [PubMed] [Google Scholar]
  • 36.Reyes-Diaz A, Gonzalez-Cordova AF, Hernandez-Mendoza A, Reyes-Diaz R, Vallejo-Cordoba B. Immunomodulation by hydrolysates and peptides derived from milk proteins. Int J Dairy Tech. 2018;71:1–9. doi: 10.1111/1471-0307.12421. [DOI] [Google Scholar]
  • 37.Zucht HD, Raida M, Adermann K, Mägert HJ, Forssmann WG. Casocidin-I: a casein-αs2 derived peptide exhibits antibacterial activity. FEBS Lett. 1995;372:185–188. doi: 10.1016/0014-5793(95)00974-e. [DOI] [PubMed] [Google Scholar]
  • 38.Bellamy W, Takase M, Yamauchi K, Wakabayashi H, Kawase K, Tomita M. Identification of the bactericidal domain of lactoferrin. Biochim Biophys Acta Prot Struct Mol Enzym. 1992;1121:130–136. doi: 10.1016/0167-4838(92)90346-F. [DOI] [PubMed] [Google Scholar]
  • 39.Brogden KA (2005) Antimicrobial peptides: Pore formers or metabolic inhibitors in bacteria?. Nature Rev Microbiol 3:238–50. 10.1038/nrmicro1098 [DOI] [PubMed]
  • 40.Pei J, Jiang H, Li X, Jin W, Tao Y. Antimicrobial peptides sourced from post-butter processing waste yak milk protein hydrolysates. AMB Express. 2017;7:217. doi: 10.1186/s13568-017-0497-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Lopez-Exposito I, Gomez-Ruiz JA, Amigo L, Recio I. Identification of antibacterial peptides from ovine αs2-casein. Int Dairy J. 2006;16:1072–1080. doi: 10.1016/j.idairyj.2005.10.006. [DOI] [Google Scholar]
  • 42.Capriotti AL, Cavaliere C, Piovesana S, Samperi R, Lagana A. Recent trends in the analysis of bioactive peptides in milk and dairy products. Anal Bioanal Chem Res. 2016;408:2677–2685. doi: 10.1007/s00216-016-9303-8. [DOI] [PubMed] [Google Scholar]
  • 43.Liu Y, Eichler J, Pischetsrieder M. Virtual screening of a milk peptide database for the identification of food-derived antimicrobial peptides. MolNutr Food Res. 2015;59:2243–2254. doi: 10.1002/mnfr.201500182. [DOI] [PubMed] [Google Scholar]
  • 44.Sansi MS, Iram D, Zanab S, Vij S, Puniya AK, Singh A, Meena S. Antimicrobial bioactive peptides from goat Milk proteins: in silico prediction and analysis. J Food Biochem. 2022;5:e14311. doi: 10.1111/jfbc.14311. [DOI] [PubMed] [Google Scholar]
  • 45.McCann KB, Shiell BJ, Michalski WP, Lee A, Wan J, Roginski H, Coventry MJ. Isolation and characterization of a novel antibacterial peptide from bovine αS1-casein. Int Dairy J. 2006;16:316–323. doi: 10.1016/j.idairyj.2005.05.005. [DOI] [Google Scholar]
  • 46.Norberg S, O'Connor PM, Stanton C, Ross RP, Hill C, Fitzgerald GF, Cotter PD (2011) Altering the composition of caseicins A and B as a means of determining the contribution of specific residues to antimicrobial activity. Appl Environ Microbiol 77:2496–2501. 10.1128/AEM.02450-10 [DOI] [PMC free article] [PubMed]
  • 47.Brandelli A, Daniel JD, Ana PFC. Whey as a source of peptides with remarkable biological activities. Food Res Int. 2015;73:149–161. doi: 10.1016/j.foodres.2015.01.016. [DOI] [Google Scholar]
  • 48.Khan MU, Pirzadeh M, Forster CY, Shityakov S, Shariati MA. Role of milk-derived antibacterial peptides in modern food biotechnology: Their synthesis, applications and future perspectives. Biomol. 2018;8:110. doi: 10.3390/biom8040110. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Barros RM, Ferrira CA, Silva SV, Malcata FX. Quantitative studies on the enzymatic hydrolysis of milk proteins brought about by cardosins precipitated by ammonium sulfate. Enzyme Microb Technol. 2001;2:541–547. doi: 10.1016/S0141-0229(01)00431-8. [DOI] [Google Scholar]
  • 50.Kamau BL, Cheison SC, Chen W, Liux M, Lu RR. Alpha-lactalbumins: its production technologies and bioactive peptides. Compr Rev Food Sci Food Saf. 2010;9:197–212. doi: 10.1111/j.1541-4337.2009.00100.x. [DOI] [Google Scholar]
  • 51.Shivanna SK, Nataraj BH (2020) Revisiting Therapeutic and Toxicological Fingerprints of Milk-Derived Bioactive Peptides: An Overview. Food Biosci 100771. 10.1016/j.fbio.2020.100771
  • 52.Su R, Liang M, Qi W, Liu R, Yuan S, He Z. Pancreatic hydrolysis of bovine casein: Peptide release and time-dependent reaction behavior. Food Chem. 2012;133:851–858. doi: 10.1016/j.foodchem.2012.01.103. [DOI] [Google Scholar]
  • 53.Luo Y, Pan K, Zhong Q. Physical, chemical and biochemical properties of casein hydrolyzed by three proteases: Partial characterizations. Food Chem. 2014;155:146–154. doi: 10.1016/j.foodchem.2014.01.048. [DOI] [PubMed] [Google Scholar]
  • 54.Raveschot C, Cudennec B, Coutte F, Flahaut C, Fremont M, Drider D, Dhulster P. Production of Bioactive Peptides by Lactobacillus Species: From Gene to Application. Front Microbiol. 2018;9:2354. doi: 10.3389/fmicb.2018.02354. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Venegas-Ortega MG, Flores-Gallegos AC, Martinez-Hernandez JL, Aguilar CN, Nevarez-Moorillon GV. Production of Bioactive Peptides from Lactic Acid Bacteria: A Sustainable Approach for Healthier Foods. Compr Rev Food Sci Food Saf. 2019;18:1039–1051. doi: 10.1111/1541-4337.12455. [DOI] [PubMed] [Google Scholar]
  • 56.de Castro RJS, Sato HH. Biologically active peptides: Processes for their generation, purification and identification and applications as natural additives in the food and pharmaceutical industries. Food Res Int. 2015;74:185–198. doi: 10.1016/j.foodres.2015.05.013. [DOI] [PubMed] [Google Scholar]
  • 57.Fan M, Guo T, Li W, Chen J, Li F, Wang C, Shi Y, Li DXA, Zhang S. Isolation and identification of novel casein-derived bioactive peptides and potential functions in fermented casein with Lactobacillus helveticus. Food Sci Hum Well. 2019;8:156–176. doi: 10.1016/j.fshw.2019.03.010. [DOI] [Google Scholar]
  • 58.Ebner J, Arslan AA, Fedorova M, Hoffmann R, Kucukcetin A, Pischetsrieder M. Peptide profiling of bovine kefir reveals 236 unique peptides released from caseins during its production by starter culture or kefir grains. J Proteom. 2015;117:41–57. doi: 10.1016/j.jprot.2015.01.005. [DOI] [PubMed] [Google Scholar]
  • 59.Zanutto-Elgui MR, Vieira JCS, do Prado DZ, Buzalaf MAR, de MagalhaesPadilha P, de Oliveira DE, Fleuri LF, Production of milk peptides with antimicrobial and antioxidant properties through fungal proteases. Food Chem. 2019;278:823–831. doi: 10.1016/j.foodchem.2018.11.119. [DOI] [PubMed] [Google Scholar]
  • 60.Kent RM, Guinane CM, O’connor PM, Fitzgerald GF, Hill C, Stanton C, Ross RP. Production of the antimicrobial peptides Caseicin A and B by Bacillus isolates growing on sodium caseinate. Lett Appl Microbiol. 2012;55:141–148. doi: 10.1111/j.1472-765X.2012.03271.x. [DOI] [PubMed] [Google Scholar]
  • 61.Mada SB, Ugwu CP, Abarshi MM. Health Promoting Effects of Food-Derived Bioactive Peptides: A Review. Int J Pept Res Therap. 2020;26:831–848. doi: 10.1007/s10989-019-09890-8. [DOI] [Google Scholar]
  • 62.Hafeez Z, Cakir-Kiefer C, Roux E, Perrin C, Miclo L, Dary-Mourot A. Strategies of producing bioactive peptides from milk proteins to functionalize fermented milk products. Food Res Int. 2014;63:71–80. doi: 10.1016/j.foodres.2014.06.002. [DOI] [Google Scholar]
  • 63.Esmaeilpour M, Ehsani MR, Aminlari M, Shekarforoush S, Hoseini E. Antimicrobial activity of peptides derived from enzymatic hydrolysis of goat milk caseins. Comp Clin Path. 2016;25:599–605. doi: 10.1007/s00580-016-2237-x. [DOI] [Google Scholar]
  • 64.Kumar P, Sharma N, Ranjan R, Kumar S, Bhat ZF, Jeong DK. Perspective of membrane technology in dairy industry: A review. Asian-Australas J Anim Sci. 2013;26:1347–1358. doi: 10.5713/ajas.2013.13082. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Acquah C, Chan YW, Pan S, Agyei D, Udenigwe CC. Structure-informed separation of bioactive peptides. J Food Biochem. 2019;43:e12765. doi: 10.1111/jfbc.12765. [DOI] [PubMed] [Google Scholar]
  • 66.Poole CF, Lenca N. Applications of the solvation parameter model in reversed-phase liquid chromatography. J Chromatogr A. 2017;1486:2–19. doi: 10.1016/j.chroma.2016.05.099. [DOI] [PubMed] [Google Scholar]
  • 67.Morais HA, Silvestre MPC, Silva MR, Silva VDM, Batista MA, Simoes e Silva AC, Silveira JN, Enzymatic hydrolysis of whey protein concentrate: Effect of enzyme type and enzyme:substrate ratio on peptide profile. J Food Sci Tech. 2015;52:201–210. doi: 10.1007/s13197-013-1005-z. [DOI] [Google Scholar]
  • 68.Goyon A, Beck A, Colas O, Sandra K, Guillarme D, Fekete S. Evaluation of size exclusion chromatography columns packed with sub-3 μm particles for the analysis of biopharmaceutical proteins. J Chromatogr A. 2017;1498:80–89. doi: 10.1016/j.chroma.2016.11.056. [DOI] [PubMed] [Google Scholar]
  • 69.Rahimi M, Ghaffari SM, Salami M, Mousavy SJ, Niasari-Naslaji A, Jahanbani R, Moosavi-Movahedi AA. ACE- inhibitory and radical scavenging activities of bioactive peptides obtained from camel milk casein hydrolysis with proteinase K. Dairy Sci Tech. 2016;96:489–499. doi: 10.1007/s13594-016-0283-4. [DOI] [Google Scholar]
  • 70.Miranda G, Bianchi L, Krupova Z, Trossat P, Martin P (2020) An improved LC–MS method to profile molecular diversity and quantify the six main bovine milk proteins, including genetic and splicing variants as well as post-translationally modified isoforms. Food Chem X-5:100080. 10.1016/j.fochx.2020.100080 [DOI] [PMC free article] [PubMed]
  • 71.Lin L, Mao XF, Sun YH, Cui HY. Antibacterial mechanism of artemisinin/ ß-cyclodextrins against methicillin resistant Staphylococcus aureus (MRSA) Microb Pathog. 2018;118:66–73. doi: 10.1016/j.micpath.2018.03.014. [DOI] [PubMed] [Google Scholar]
  • 72.Minkiewicz P, Iwaniak A, Darewicz M. BIOPEP-UWM Database of Bioactive Peptides: Current Opportunities. Int J Mol Sci. 2019;20:5978. doi: 10.3390/ijms20235978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 73.Iwaniak A, Darewicz M, Minkiewicz P (2021) Databases of bioactive peptides. In: Toldra F, Wu J (ed) Biologically active peptides, Academic press, pp 309–330. 10.1016/B978-0-12-821389-6.00025-X
  • 74.Chaudharya A, Bhalla S, Patiyal S, Raghava GPS, Sahnic G. FermFooDb: A database of bioactive peptides derived from fermented foods. Heliyon. 2021;7:e06668. doi: 10.1016/j.heliyon.2021.e06668. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75.Kapoor P, Singh H, Gautam A, Chaudhary K, Kumar R, Raghava GPS. TumorHoPe: a database of tumor homing peptides. PLoS ONE. 2012;7:e35187. doi: 10.1371/journal.pone.0035187. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76.Hammami R, Fliss I. Current trends in antimicrobial agent research: chemo- and bioinformatics approaches. Drug Discov Today. 2010;15:540–546. doi: 10.1016/j.drudis.2014.05.002. [DOI] [PubMed] [Google Scholar]
  • 77.Gueguen Y, Garnier J, Robert L, Lefranc MP, Mougenot I, de Lorgeril J, Janech M, Gross PS, Warr GW, Cuthbertson B, Barracco MA, Bulet P, Aumelas A, Yang YS, Bo D, Xiang JH, Tassanakajon A, Piquemal D, Bachere E. PenBase, the shrimp antimicrobial peptide penaeidin database: sequence-based classification and recommended nomenclature. Dev Comp Immunol. 2006;30:283–288. doi: 10.1016/j.dci.2005.04.003. [DOI] [PubMed] [Google Scholar]
  • 78.Li Y, Chen Z. RAPD: a database of recombinantly-produced antimicrobial peptides. FEMS Microbiol Lett. 2008;289:126–129. doi: 10.1111/j.1574-6968.2008.01357.x. [DOI] [PubMed] [Google Scholar]
  • 79.Rashid M, Singla D, Sharma A, Kumar M, Raghava GP. Hmrbase: a database of hormones and their receptors. BMC Genom. 2009;10:307. doi: 10.1186/1471-2164-10-307. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 80.Hammami R, Hamida BJ, Vergoten G, Fliss I (2009) PhytAMP: a database dedicated to antimicrobial plant peptides. Nucleic Acids Res 37:D963–D968. 10.1093/nar/gkn655 [DOI] [PMC free article] [PubMed]
  • 81.Jimsheena VK, Gowda LR. Arachin derived peptides as selective angiotensin Iconverting enzyme (ACE) inhibitors: structure-activity relationship. Peptides. 2010;31:1165–1176. doi: 10.1016/j.peptides.2010.02.022. [DOI] [PubMed] [Google Scholar]
  • 82.Fjell CD, Hancock RE, Cherkasov A (2007) AMPer: a database and an automated discovery tool for antimicrobial peptides. Bioinform 23:1148–1155. 10.1093/bioinformatics/btm068 [DOI] [PubMed]
  • 83.van Heel AJ, de Jong A, Montalban-Lopez M, Kok J, Kuipers OP. BAGEL3: automated identification of genes encoding bacteriocins and (non-) bactericidal post translationally modified peptides. Nucleic Acids Res. 2013;41:448–453. doi: 10.1093/nar/gkt391. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 84.Whitmore L, Wallace BA. Thepeptaibol database: a database for sequences and structures of naturally occurring peptaibols. Nucleic Acids Res. 2004;32:D593–D594. doi: 10.1093/nar/gkh077. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 85.Seebah S, Suresh A, Zhuo SW, Choong YH, Chua H, Chuon D, Beuerman R, Verma C. Defensins knowledgebase: a manually curated database and information source focused on the defensins family of antimicrobial peptides. Nucleic Acids Res. 2007;35:D265–D268. doi: 10.1093/nar/gkl866. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 86.Thomas S, Karnik S, Barai RS, Jayaraman VK, Idicula-Thomas S. CAMP: a useful resource for research on antimicrobial peptides. Nucleic Acids Res. 2010;38:D774–D780. doi: 10.1093/nar/gkp1021. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 87.Piotto SP, Sessa L, Concilio S, Iannelli P. YADAMP: yet another database of antimicrobial peptides. Int J Antimicrob Ag. 2012;39:346–351. doi: 10.1016/j.ijantimicag.2011.12.003. [DOI] [PubMed] [Google Scholar]
  • 88.SeshadriSundararajan V, Gabere MN, Pretorius A, Adam S, Christoffels A, Lehvaslaiho M, Archer JAC, Bajic VB. DAMPD: a manually curated antimicrobial peptide database. Nucleic Acids Res. 2012;40:D1108–D1112. doi: 10.1093/nar/gkr1063. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 89.Theolier J, Fliss I, Jean J, Hammami R. MilkAMP: a comprehensive database of antimicrobial peptides of dairy origin. Dairy Sci Technol. 2014;94:181–193. doi: 10.1007/s13594-013-0153-2. [DOI] [Google Scholar]
  • 90.Waghu FH, Barai RS, Gurung P, Idicula-Thomas S (2015) CAMPR3: A database on sequences, structures and signatures of antimicrobial peptides. Nucleic Acids Res 44:D1094-D1097. 10.1093/nar/gkv1051 [DOI] [PMC free article] [PubMed]
  • 91.Pirtskhalava M, Gabrielian A, Cruz P, Griggs HL, Squires RB, Hurt DE, Tartakovsky M (2016) DBAASP v.2: An enhanced database of structure and antimicrobial/cytotoxic activity of natural and synthetic peptides. Nucleic Acids Res 44:D1104-D1112. 10.1093/nar/gkv1174 [DOI] [PMC free article] [PubMed]
  • 92.Wang G, Li X, Wang Z (2016) APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res 44:D1087-D1093. 10.1093/nar/gkv1278 [DOI] [PMC free article] [PubMed]
  • 93.Nielsen SD, Beverly RL, Qu Y, Dallas DC (2017) Milk bioactive peptide database: A comprehensive database of milk protein-derived bioactive peptides and novel visualization. Food Chem 232:673–682. 10.1016/j.foodchem.2017.04.056 [DOI] [PMC free article] [PubMed]
  • 94.Panyayaia T, Ngamphiw C, Tongsima S, Mhuantong W, Limsripraphan W, Choowongkomon K, Sawatdichaikul O (2019) FeptideDB: A web application for new bioactive peptides from food protein. Heliyon 5:e02076. 10.1016/j.heliyon.2019.e02076 [DOI] [PMC free article] [PubMed]
  • 95.Li Q, Zhang C, Chen H, Xue J, Guo X, Liang M, Chen M (2018) BioPepDB: an integrated data platform for food derived bioactive peptides. Int J Food Sci Nutr 69:963–968. 10.1080/09637486.2018.1446916 [DOI] [PubMed]
  • 96.Tossi A, Sandri L, Giangaspero A. Amphipathic, α-helical antimicrobial peptides. Pept Sci. 2000;55:4–30. doi: 10.1002/1097-0282(2000)55:1<4::AID-BIP30>3.0.CO;2-M. [DOI] [PubMed] [Google Scholar]
  • 97.Andreu D, Rivas L. Animal antimicrobial peptides: an overview. Pept Sci. 1998;47:415–433. doi: 10.1002/(SICI)1097-0282(1998)47:6<415::AID-BIP2>3.0.CO;2-D. [DOI] [PubMed] [Google Scholar]
  • 98.Chan DI, Prenner EJ, Vogel HJ. Tryptophan- and arginine-rich antimicrobial peptides: structures and mechanisms of action. Biochim Biophys Acta. 2006;1758:1184–1202. doi: 10.1016/j.bbamem.2006.04.006. [DOI] [PubMed] [Google Scholar]
  • 99.Taniguchi M, Aida R, Saito K, Ochiai A, Takesono S, Saitoh E, Tanaka T. Identification and characterization of multifunctional cationic peptides from traditional Japanese fermented soybean Natto extracts. J Biosci Bioeng. 2019;127:472–478. doi: 10.1016/j.jbiosc.2018.09.016. [DOI] [PubMed] [Google Scholar]
  • 100.Yount NY, Bayer AS, Xiong YQ, Yeaman MR. Advances in antimicrobial peptide immunobiology. Biopolymers. 2006;84:435–458. doi: 10.1002/bip.20543. [DOI] [PubMed] [Google Scholar]
  • 101.Jiang Z, Vasil AI, Hale JD, Hancock REW, Vasil ML, Hodges RS. Effects of net charge and the number of positively charged residues on the biological activity of amphipathic [alpha]-helical cationic antimicrobial peptides. Pept Sci. 2008;90:369–383. doi: 10.1002/bip.20911. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 102.Chen Y, Guarnieri MT, Vasil AI, Vasil ML, Mant CT, Hodges RS. Role of peptide hydrophobicity in the mechanism of action of [alpha]-helical antimicrobial peptides. Antimicrob Agents Chemotherp. 2007;51:1398–1406. doi: 10.1128/AAC.00925-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 103.Prenner EJ, Kiricsi M, Jelokhani-Niaraki M, Lewis RN, Hodges RS, McElhaney RN. Structure-activity relationships of diastereomeric lysine ring size analogs of the antimicrobial peptide gramicidin S: mechanism of action and discrimination between bacterial and animal cell membranes. J Biolog Chem. 2005;2(80):2002–2011. doi: 10.1074/jbc.M406509200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 104.Kobayashi S, Takeshima K, Park CB, Kim SC, Matsuzaki K. Interactions of the novel antimicrobial peptide buforin 2 with lipid bilayers: proline as a translocation promoting factor. Biochem. 2000;39:8648–8654. doi: 10.1021/bi0004549. [DOI] [PubMed] [Google Scholar]
  • 105.Reddy KVR, Yedery RD, Aranha C. Antimicrobial peptides: premises and promises. Int J Antimicrob Agents. 2004;24:536–547. doi: 10.1016/j.ijantimicag.2004.09.005. [DOI] [PubMed] [Google Scholar]
  • 106.Malin JJ, de Leeuw E. Therapeutic compounds targeting Lipid II for antibacterial purposes. Infect drug Resis. 2019;12:2613–2625. doi: 10.2147/IDR.S215070. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 107.Breukink E, de Kruijff B (1999) The lantibiotic nisin, a special case or not? Biochim Biophys Acta Biomembr 1462:223–234. 10.1016/S0005-2736(99)00208-4 [DOI] [PubMed]
  • 108.Wang G, Mishra B, Lau K, Lushnikova T, Golla R, Wang X. Antimicrobial peptides in 2014. Pharmaceuticals. 2015;8:123–150. doi: 10.3390/ph8010123. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 109.Pokorny A, Almeida PFF. Kinetics of dye efflux and lipid flip-flop induced by dlysin in phosphatidylcholine vesicles and the mechanism of graded release by amphipathic, a-helical peptides. Biochem. 2004;43:8846–8857. doi: 10.1021/bi0497087. [DOI] [PubMed] [Google Scholar]
  • 110.Karshikov A, Berendes R, Burger A, Cavalie A, Lux HD, Huber R. Aimexin V membrane interaction: an electrostatic potential study. Eur Biophys J. 1992;20:337–344. doi: 10.1007/BF00196592. [DOI] [Google Scholar]
  • 111.Teixeira V, Feio MJ, Rivas L, De la Torre BG, Andreu D, Coutinho A, Bastos M. Influence of Lysine Nε-Trimethylation and Lipid Composition on the Membrane Activity of the Cecropin A-Melittin Hybrid Peptide CA (1–7) M (2–9) J Physic Chem B. 2010;114:16198–16208. doi: 10.1021/jp106915c. [DOI] [PubMed] [Google Scholar]
  • 112.Arouri A, Dathe M, Blume A (2008) Peptide induced demixing in PG/PE lipid mixtures: a mechanism for the specificity of antimicrobial peptides towards bacterial membranes?.Biochim Biophys Acta Biomembr 1788:650–659. 10.1016/j.bbamem.2008.11.022 [DOI] [PubMed]
  • 113.Zhao H, Sood R, Jutila A, Bose S, Fimland G, Nissen-Meyer J, Kinnunen PK. Interaction of the antimicrobial peptide pheromone Plantaricin A with model membranes: implications for a novel mechanism of action. Biochim Biophys Acta Biomembr. 2006;1758:1461–1474. doi: 10.1016/j.bbamem.2006.03.037. [DOI] [PubMed] [Google Scholar]
  • 114.Marchand C, Krajewski K, Lee HF, Antony S, Johnson AA, Amin R, Roller P, Kvaratskhelia M, Pommier Y. Covalent binding of the natural antimicrobial peptide indolicidin to DNA abasic sites. Nucleic Acids Res. 2006;34:5157–5165. doi: 10.1093/nar/gkl667. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 115.Mukhopadhyay J, Sineva E, Knight J, Levy RM, Ebright RH. Antibacterial peptide microcin J25 inhibits transcription by binding within and obstructing the RNA polymerase secondary channel. Mol Cell. 2004;14:739–751. doi: 10.1016/j.molcel.2004.06.010. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 116.Ho YH, Sung TC, Chen CS. Lactoferricin B inhibits the phosphorylation of the two-component system response regulators BasR and CreB. Mol Cell Proteom. 2012;11:M111–014720. doi: 10.1074/mcp.M111.014720. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 117.Leon-Buitimea A, Garza-Cardenas CR, Garza-Cervantes JA, Lerma-Escalera JA, Morones-RamirezJ R (2020) The demand for new antibiotics: antimicrobial peptides, nanoparticles, and combinatorial therapies as future strategies in antibacterial agent design. Front in Microbiol 11:1669. 10.3389/fmicb.2020.01669 [DOI] [PMC free article] [PubMed]
  • 118.Yang S, Li J, Aweya JJ, Yuan Z, Weng W, Zhang Y, Liu GM. Antimicrobial mechanism of Larimichthyscrocea whey acidic protein-derived peptide (LCWAP) against Staphylococcus aureus and its application in milk. Int J Food Microbiol. 2020;335:108891. doi: 10.1016/j.ijfoodmicro.2020.108891. [DOI] [PubMed] [Google Scholar]
  • 119.Murdock CA, Matthews KR. Antibacterial activity of pepsin-digested lactoferrin on foodborne pathogens in buffered broth systems and ultra-high temperature milk with EDTA. J Appl Microbiol. 2002;93:850–856. doi: 10.1046/j.1365-2672.2002.01762.x. [DOI] [PubMed] [Google Scholar]
  • 120.Quinteri L, Pistillo PB, Caputo L, Favia P, Baruzzi F. Bovine lactoferrin and lactoferricin on plasma-deposited coating against spoilage Pseudomonas spp. Innov Food Sci Emerg Technol. 2013;20:215–222. doi: 10.1016/j.ifset.2013.04.013. [DOI] [Google Scholar]
  • 121.Rizzello CG, Losito I, Gobbetti M, Carbonara T, De Bari MD, Zambonin PG. Antibacterial activities of peptides from the water-soluble extracts of Italian cheese varieties. J Dairy Sci. 2005;88:2348–2360. doi: 10.3168/jds.S0022-0302(05)72913-1. [DOI] [PubMed] [Google Scholar]
  • 122.Del Olmo A, Calzada J, Nunez M. Effect of lactoferrin and its derivatives, high hydrostatic pressure, and their combinations, on Escherichia coli O157:H7 and Pseudomonas fluorescens in chicken filets. Innov Food Sci Emerg Technol. 2012;13:51–56. doi: 10.1016/j.ifset.2011.07.016. [DOI] [Google Scholar]
  • 123.Al-Nabulsi AA, Holley RA. Effects on Escherichia coli O157: H7 and meat starter cultures of bovine lactoferrin in broth and microencapsulated lactoferrin in dry sausage batters. Int J Food Microbiol. 2007;113:84–91. doi: 10.1016/j.ijfoodmicro.2006.07.019. [DOI] [PubMed] [Google Scholar]
  • 124.Al-Nabulsi AA, Han JH, Liu Z, Rodrigues-Vieira ET, Holley RA. Temperature sensitive microcapsules containing lactoferrin and their action against Carnobacteri umviridans on Bologna. J Food Sci. 2006;71:M208–M214. doi: 10.1111/j.1750-3841.2006.00103.x. [DOI] [Google Scholar]
  • 125.Del Olmo A, Morales P, Nunez M. Bactericidal activity of lactoferrin and its amidated and pepsin-digested derivatives against Pseudomonas fluorescens in ground beef and meat fractions. J Food Protein. 2009;72:760–765. doi: 10.4315/0362-028X-72.4.760. [DOI] [PubMed] [Google Scholar]
  • 126.Martínez-Hernández GB, Amodio ML, de Chiara MLV, Russo P, Colelli G. Microbial inactivations with hydrolysedlactoferrin and other natural antimicrobials in fresh-cut fennel. LWT. 2017;84:353–358. doi: 10.1016/j.lwt.2017.05.079. [DOI] [Google Scholar]
  • 127.Somkuti GA, Paul M (2010) Enzymatic fragmentation of the antimicrobial peptides casocidin and isracidin by Streptococcus thermophilus and Lactobacillus delbrueckii ssp.bulgaricus. Appl Microbiol Biotechnol 87:235–242. 10.1007/s00253-009-2433-6 [DOI] [PubMed]
  • 128.Franco I, Perez MD, Conesa C, Calvo M, Sanchez L. Effect of technological treatments on bovine lactoferrin: an overview. Food Res Int. 2018;106:173–182. doi: 10.1016/j.foodres.2017.12.016. [DOI] [PubMed] [Google Scholar]
  • 129.Wakabayashi H, Yamauchi K, Takase M. Lactoferrin research, technology and applications. Int Dairy J. 2006;16:1241–1251. doi: 10.1016/j.idairyj.2006.06.013. [DOI] [Google Scholar]
  • 130.Garcia-Montoya IA, Cendon TS, Ar-evalo-Gallegos S, Rascon-Cruz Q. Lactoferrin a multiple bioactive protein: an overview. Biochim Biophys Acta Gen Sub. 2012;1820:226–236. doi: 10.1016/j.bbagen.2011.06.018. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 131.Yılmaz B, Tosun H (2013) Natural antimicrobial systems in milk and their use in the food industry - the natural antimicrobial systems in milk and their utilization in food industry. Celal Bayar Univ J Sci 9:11–20. https://dergipark.org.tr/en/pub/cbayarfbe/issue/4055/53415
  • 132.Enrique M, Marcos JF, Yuste M, Martínez M, Valles S, Manzanares P. Antimicrobial action of synthetic peptides towards wine spoilage yeasts. IntJ Food Microbiol. 2007;118:318–325. doi: 10.1016/j.ijfoodmicro.2007.07.049. [DOI] [PubMed] [Google Scholar]
  • 133.Enrique M, Marcos JF, Yuste M, Martínez M, Valles S, Manzanares P. Inhibition of the wine spoilage yeast Dekkera bruxellensis by bovine lactoferrin-derived peptides. Int J Food Microbiol. 2008;127:229–234. doi: 10.1016/j.ijfoodmicro.2008.07.011. [DOI] [PubMed] [Google Scholar]
  • 134.Enrique M, Manzanares P, Yuste M, Martinez M, Valles S, Marcos JF. Selectivity and antimicrobial action of bovine lactoferrin derived peptides against wine lactic acid bacteria. Food Microbiol. 2009;26:340–346. doi: 10.1016/j.fm.2008.11.003. [DOI] [PubMed] [Google Scholar]
  • 135.Del Olmo A, Calzada J, Nunez M. Effect of lactoferrin and its derivatives against gram positive bacteria in-vitro and combined with high pressure, in chicken breast fillets. Meat Sci. 2012;90:71–76. doi: 10.1016/j.meatsci.2011.06.003. [DOI] [PubMed] [Google Scholar]
  • 136.Taylor S, Brock J, Kruger C, Berner T, Murphy M. Safety determination for the use of bovine milk-derived lactoferrin as a component of an antimicrobial beef carcass spray. Regul Toxicol Pharmacol. 2004;39:12–24. doi: 10.1016/j.yrtph.2003.10.001. [DOI] [PubMed] [Google Scholar]
  • 137.Barbiroli A, Bonomi F, Capretti G, Iametti S, Manzoni M, Piergiovanni L, Rollini M. Antimicrobial activity of lysozyme and lactoferrin incorporated in cellulose-based food packaging. Food Control. 2012;26:387–392. doi: 10.1016/j.foodcont.2012.01.046. [DOI] [Google Scholar]
  • 138.Padrao J, Goncalves S, Silva JP, Sencadas V, Lanceros-M-endez S, Pinheiro A. Bacterial cellulose-lactoferrin as an antimicrobial edible packaging. Food Hydrocoll. 2016;58:126–140. doi: 10.1016/j.foodhyd.2016.02.019. [DOI] [Google Scholar]
  • 139.Nakamura K. Potent antimicrobial effects of the glycosylated Lactoferrin. Food Preserv Sci. 2002;28:243–246. doi: 10.5891/jafps.28.243. [DOI] [Google Scholar]
  • 140.Dashper SG, Liu SW, Reynolds EC. Antimicrobial peptides and their potential as oral therapeutic agents. Int J Pept Res Therp. 2007;13:505–516. doi: 10.1007/s10989-007-9094-z. [DOI] [Google Scholar]
  • 141.Teraguchi S, Shin K, Ozawa K, Nakamura S, Fukuwatari Y, Tsuyuki S, Shimamura S (1995) Bacteriostatic effect of orally administered bovine lactoferrin on proliferation of Clostridium species in the gut of mice fed bovine milk. Appl Environ Microbiol 61:501–506. 10.1128/aem.61.2.501-506.1995 [DOI] [PMC free article] [PubMed]
  • 142.Kawai H, Wiederschain D, Kitao H, Stuart J, Tsai KK, Yuan ZM. DNA damage-induced MDMX degradation is mediated by MDM2. J Biol Chem. 2003;278:45946–45953. doi: 10.1074/jbc.M308295200. [DOI] [PubMed] [Google Scholar]
  • 143.Elnagdy S, AlKhazindar M. The potential of antimicrobial peptides as an antiviral therapy against COVID-19. ACS Pharmacol Transl Sci. 2020;3:780–782. doi: 10.1021/acsptsci.0c00059. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 144.Lupetti A, Paulusma-Annema A, Welling MM, Dogterom-Ballering H, Brouwer CP, Senesi S, Van Dissel JT, Nibbering PH. Synergistic activity of the N-terminal peptide of human lactoferrin and fluconazole against Candida species. Antimicrob Agents Chemotherp. 2003;47:262–267. doi: 10.1128/aac.47.1.262-267.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 145.Velden WJ, van Iersel TM, Blijlevens NM, Donnelly JP. Safety and tolerability of the antimicrobial peptide human lactoferrin 1–11 (hLF1-11) BMC Med. 2009;7:1–8. doi: 10.1186/1741-7015-7-44. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 146.Exposito I L, Recio I (2006) Antibacterial activity of peptides and folding variants from milk proteins. Int Dairy J 16:1294–1305. 10.1016/j.idairyj.2006.06.002
  • 147.Hati S, Patel N, Sakure A, Mandal S. Influence of whey protein concentrate on the production of antibacterial peptides derived from fermented milk by lactic acid bacteria. Int J Pept Res Ther. 2017;24:87–98. doi: 10.1007/s10989-017-9596-2. [DOI] [Google Scholar]
  • 148.Jean C, Boulianne M, Britten M, Robitaille G. Antimicrobial activity of buttermilk and lactoferrin peptide extracts on poultry pathogens. J Dairy Sci. 2016;83:497–504. doi: 10.1017/S0022029916000637. [DOI] [PubMed] [Google Scholar]
  • 149.Alvarez-Ordonez A, Carvajal A, Arguello H, Martinez-Lobo FJ, Rubio NG, P, Antibacterial activity and mode of action of a commercial citrus fruit extract. J App Microbiol. 2013;115:50–60. doi: 10.1111/jam.12216. [DOI] [PubMed] [Google Scholar]
  • 150.Xu Y, Asghar S, Yang L, Li H, Wang Z, Ping Q, Xiao Y. Lactoferrin-coated polysaccharide nanoparticles based on chitosan hydrochloride/hyaluronic acid/PEG for treating brain glioma. Carbohydr polym. 2017;157:419–428. doi: 10.1016/j.carbpol.2016.09.085. [DOI] [PubMed] [Google Scholar]
  • 151.Golla K, Bhaskar C, Ahmed F, Kondapi AK. A target-specific oral formulation of doxorubicin-protein nanoparticles: efficacy and safety in hepatocellular cancer. J Cancer. 2013;4:644–652. doi: 10.7150/jca.7093. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 152.Pandey V, Gajbhiye KR, Soni V. Lactoferrin-appended solid lipid nanoparticles of paclitaxel for effective management of bronchogenic carcinoma. Drug Deliv. 2015;22:199–205. doi: 10.3109/10717544.2013.877100. [DOI] [PubMed] [Google Scholar]
  • 153.Xia X, Cheng L, Zhang S, Wang L, Hu J. The role of natural antimicrobial peptides during infection and chronic inflammation. Antonie Van Leeuwenhoek. 2018;111:5–26. doi: 10.1007/s10482-017-0929-0. [DOI] [PubMed] [Google Scholar]
  • 154.Zhang ZH, Wang XP, Ayman WY, Munyendo WLL, Lv HX, Zhou JP. Studies on lactoferrin nanoparticles of gambogic acid for oral delivery. Drug Deliv. 2013;20:86–93. doi: 10.3109/10717544.2013.766781. [DOI] [PubMed] [Google Scholar]
  • 155.Zharkova MS, Orlov DS, Golubeva OY, Chakchir OB, Eliseev IE, Grinchuk TM (2019) Application of antimicrobial peptides of the innate immune system in combination with conventional antibiotics-a novel way to combat antibiotic resistance? Front Cell Infect Microbiol 9:128. 10.3389/fcimb.2019.00128 [DOI] [PMC free article] [PubMed]
  • 156.Akbari R, Hakemi-Vala M, Pashaie F, Bevalian P, Hashemi A, PooshangBagheri K (2019). Highly synergistic effects of melittin with conventional antibiotics against multidrug-resistant isolates of Acinetobacterbaumannii and Pseudomonas aeruginosa. Microb Drug Resist 25:193–202. 10.1089/mdr.2018.0016 [DOI] [PubMed]
  • 157.de Breij A, Riool M, Cordfunke RA, Malanovic N, de Boer L, Koning RI, Nibbering PH (2018) The antimicrobial peptide SAAP-148 combats drug-resistant bacteria and biofilms. Sci Transl Med 10:eaan4044. 10.1126/scitranslmed.aan4044 [DOI] [PubMed]
  • 158.Conlon BP, Nakayasu ES, Fleck LE, LaFleur MD, Isabella VM, Coleman K, Lewis K (2013) Activated ClpP kills persisters and eradicates a chronic biofilm infection. Nature 503:365–370. 10.1038/nature12790 [DOI] [PMC free article] [PubMed]
  • 159.Lei J, Sun L, Huang S, Zhu C, Li P, He J, Mackey V, Coy DH, He Q. The antimicrobial peptides and their potential clinical applications. Am J Transl Res. 2019;11:3919–3931. [PMC free article] [PubMed] [Google Scholar]

Articles from Probiotics and Antimicrobial Proteins are provided here courtesy of Nature Publishing Group

RESOURCES