Appendix 1—key resources table.
| Reagent type (species) or resource | Designation | Source or reference | Identifiers | Additional information |
|---|---|---|---|---|
| Strain, strain background (Escherichia coli) | ArticExpress (DE3) | Agilent Technologies | ||
| Cell line (Homo-sapiens) | HEK293T | ATCC | ||
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx | Prof. Daniel Durocher (Lunenfeld-Tanenbaum Research Institute) | ||
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx FE-PALB2-WT | This study | U2OS Flp-In T-REx harbouring inducible Flag-EGFP-PALB2 WT | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx FE-PALB2-ΔChAM | This study | U2OS Flp-In T-REx harbouring inducible Flag-EGFP-PALB2 ΔChAM | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA | Bleuyard et al., 2017b | U2OS Flp-In T-REx harbouring inducible shRNA targeting endogenous PALB2 | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA-EV | Bleuyard et al., 2017b | U2OS Flp-In T-REx P2shRNA cells, complemented with empty vector (EV) | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA-FLAG-PALB2 | Bleuyard et al., 2017b | U2OS Flp-In T-REx P2shRNA cells, complemented with 3xFLAG-PALB2 | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA-FLAG-PALB2 7Q | This paper | U2OS Flp-In T-REx P2shRNA cells, complemented with 3xFLAG-PALB2-7Q | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA-FLAG-PALB2-7R | This paper | U2OS Flp-In T-REx P2shRNA cells, complemented with 3xFLAG-PALB2-7R | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA- FE-PALB2-WT | This paper | U2OS Flp-In T-REx P2shRNA cells complemented with inducible Flag-EGFP-PALB2 WT | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA- FE-PALB2-7Q | This paper | U2OS Flp-In T-REx P2shRNA cells complemented with inducible Flag-EGFP-PALB2-7Q | |
| Cell line (Homo-sapiens) | U2OS Flp-In T-REx P2shRNA- FE-PALB2-7R | This paper | U2OS Flp-In T-REx P2shRNA cells complemented with inducible Flag-EGFP-PALB2-7R | |
| Antibody | anti-FLAG (Mouse monoclonal) | Sigma | Cat# F1804 | WB (1:1000) ChIP (10 μg per sample) |
| Antibody | Control IgG (Mouse monoclonal) | Jackson Immunoresearch | 015-000-003 | WB (1:1000) ChIP (10 μg per sample) |
| Antibody | anti-pan-acetyl-lysine (Rabbit polyclonal) | Cell signalling Technology | Cat# 9441 S | WB (1:1000) |
| Antibody | anti-PALB2 (Rabbit polyclonal) | Bethyl | Cat# A301-246A | WB (1:500) |
| Antibody | anti-PALB2 (Rabbit polyclonal) | Rodrigue et al., 2019 | WB (1:5000) | |
| Antibody | anti-BRCA2 (Mouse monoclonal) | Millipore | Cat# OP95 | WB (1:1000) |
| Antibody | anti-RAD51 (Rabbit polyclonal) | Yata et al., 2014 | 7946 | WB (1:5000) |
| Antibody | anti-RAD51 (Rabbit polyclonal) | BioAcademia | 70–001 | IF (1/1000) |
| Antibody | anti-lamin A (Rabbit polyclonal) | Sigma | L1293 | WB (1:2000) |
| Antibody | anti-vinculin (Rabbit polyclonal) | Sigma | V9131 | WB (1:200000) |
| Antibody | anti-gamma H2AX (Mouse monoclonal) | Millipore | 05–636 | WB (1:1000) IF (1:2000) |
| Antibody | anti-MRG15 (Rabbit polyclonal) | Cell signalling Technology | Cat# D2Y4 | WB (1:1000) |
| Antibody | anti-BRCA1 (Mouse monoclonal) | Sigma | Cat# OP107 | WB (1:1000) |
| Antibody | anti-GST (Mouse monoclonal) | Santa Cruz Biotechnology | Cat# sc-138 | WB (1:1000) |
| Antibody | anti-biotin coupled with horseradish peroxidase (HRP) (Mouse monoclonal) | Sigma | Cat# A0185 | WB (1:1000) |
| Antibody | anti-KAT2A/GCN5 (Mouse monoclonal) | Cell signalling Technology | Cat# 3305 | WB (1:1000) |
| Antibody | anti-alpha-tubulin (Mouse monoclonal) | Cell signalling Technology | Cat# 3873 | WB (1:2000) |
| Antibody | Secondary antibody coupled with horseradish peroxidase (HRP) / Goat anti-mouse (Goat polyclonal) |
Dako | Cat# P0447 | WB (1:1000) |
| Antibody | Secondary antibody coupled with horseradish peroxidase (HRP) / Goat anti-rabbit (Goat polyclonal) |
Dako | Cat# P0448 | WB (1:1000) |
| Antibody | Secondary antibody coupled with horseradish peroxidase (HRP) / Goat anti-mouse (Goat polyclonal) |
Jackson ImmunoResearch | 515-035-062 | WB (1: 20000) |
| Antibody | Secondary antibody coupled with horseradish peroxidase (HRP) / Goat anti-rabbit (Goat polyclonal) |
Jackson ImmunoResearch | 111-035-144 | WB (1: 20000) |
| Antibody | Secondary antibody coupled with Alexa Fluor/ Goat anti-mouse (Goat polyclonal) |
invitrogen | A-11001 | IF (1/1000) |
| Antibody | Secondary antibody coupled with Alexa Fluor/ Goat anti-mouse (Goat polyclonal) |
invitrogen | A-11017 | IF (1/400) |
| Antibody | Secondary antibody coupled with Alexa Fluor/ Goat anti-rabbit (Goat polyclonal) |
invitrogen | A-11011 | IF (1/1000) |
| Chemical compound, drug | sodium butyrate (NaB) | Sigma | 303410 | |
| Chemical compound, drug | Trichostatin (TSA) | Sigma | T8552 | |
| Chemical compound, drug | WST-1 reagent | Merck Life Sciences Uk Limited | 5015944001 | |
| Sequence-based reagent | siRNA: nontargeting control | Dharmacon | D001810-10-05 | 50 pmole |
| Sequence-based reagent | siRNA: targeting KAT2A | Dharmacon | L-009722-02-0005 | 50 pmole |
| sequence-based reagent | siRNA: targeting KAT2B | Dharmacon | L-005055-00-0005 | 50 pmole |
| Recombinant DNA reagent | pcDNA5/FRT-GW/N3×FLAG | Bleuyard et al., 2017b | ||
| Recombinant DNA reagent | pENTR3C | Invitrogen | ||
| Recombinant DNA reagent | pcDNA-DEST53 | Invitrogen | ||
| Recombinant DNA reagent | pCMV-SPORT6-PALB2 | Source BioSciences | IMAGE clone 6045564 | |
| Recombinant DNA reagent | pGEX-6P-1 | GE Healthcare | GST expression in bacteria cells | |
| Recombinant DNA reagent | pGEX-6P-1_PALB2 | This paper | GST-PALB2 full length expression in bacteria cells | |
| Recombinant DNA reagent | pGEX-6P-1_PALB2_Fr1 | This paper | GST-PALB2 fragment 1 (1-320) expression in bacteria cells | |
| Recombinant DNA reagent | pGEX-6P-1_PALB2_Fr2 | This paper | GST-PALB2 fragment 2 (295-610) expression in bacteria cells | |
| Recombinant DNA reagent | pGEX-6P-1_PALB2_Fr3 | This paper | GST-PALB2 fragment 3 (580-900) expression in bacteria cells | |
| Recombinant DNA reagent | pGEX-6P-1_PALB2_Fr4 | This paper | GST-PALB2 fragment 4 (867–1186) expression in bacteria cells | |
| Recombinant DNA reagent | pOG44 | Invitrogen | ||
| Recombinant DNA reagent | pENTR3C-ChAM #1 | This paper | ChAM #1 (395-450) in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C- ChAM #2 | This paper | ChAM #2 (395-433) in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C- ChAM #3 | This paper | ChAM #3 (353-433) in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C- ChAM #4 | This paper | ChAM #4 (353-450) in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C- ChAM #5 | This paper | ChAM #5 (353-499) in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C-PALB2 | Bleuyard et al., 2017b | Full length PALB2 in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C-PALB2-7Q | This paper | Full length PALB2-7Q in the gateway entry vector | |
| Recombinant DNA reagent | pENTR3C-PALB2-7R | This paper | Full length PALB2-7R in the gateway entry vector | |
| Recombinant DNA reagent | pcDNA-DEST53- ChAM #1 | This paper | GFP-ChAM #1 (395-450) expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA-DEST53- ChAM #2 | This paper | GFP-ChAM #2 (395-433) expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA-DEST53- ChAM #3 | This paper | GFP-ChAM #3 (353-433) expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA-DEST53- ChAM #4 | This paper | GFP-ChAM #4 (353-450) expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA-DEST53- ChAM #5 | This paper | GFP-ChAM #5 (353-499) expression in mammalian cells | |
| Recombinant DNA reagent | pGEX4T3 | GE Healthcare | GST expression in bacteria cells | |
| Recombinant DNA reagent | pGEX4T3-ChAM | Bleuyard et al., 2012 | GST-ChAM WT expression in bacteria cells | |
| Recombinant DNA reagent | pGEX4T3-ChAM-3Q4K | This paper | GST-ChAM-3Q4K expression in bacteria cells | |
| Recombinant DNA reagent | pGEX4T3-ChAM-3K4Q | This paper | GST-ChAM-3K4Q expression in bacteria cells | |
| Recombinant DNA reagent | pGEX4T3-ChAM-7Q | This paper | GST-ChAM-7Q expression in bacteria cells | |
| Recombinant DNA reagent | pGEX4T3-ChAM-3R4K | This paper | GST-ChAM-3R4K expression in bacteria cells | |
| Recombinant DNA reagent | pcDNA5/FRT-GW/N3×FLAG-PALB2 | Bleuyard et al., 2017b | Constitutive 3xFlag- PALB2 expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA5/FRT-GW/N3×FLAG-PALB2-7Q | This study | Constitutive 3xFlag- PALB2 7Q expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA5/FRT-GW/N3×FLAG-PALB2-7R | This study | Constitutive 3xFlag- PALB2 7R expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA5/FRT/TO/FE-PALB2 | Bleuyard et al., 2012 | Inducible Flag-EGFP-PALB2 fusion expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA5/FRT/TO/FE-PALB2 7Q | This paper | Inducible Flag-EGFP-PALB2 7Q expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA5/FRT/TO/FE-PALB2 7R | This paper | Inducible Flag-EGFP-PALB2 7R expression in mammalian cells | |
| Recombinant DNA reagent | pcDNA5/FRT/TO/FE-PALB2_ΔChAM | Bleuyard et al., 2012 | Inducible Flag-EGFP-PALB2 ΔChAM expression in mammalian cells | |
| Sequence-based reagent | PALB2-F1_fo1 | This paper | PCR primers | 5’-atggatccatggacgagcctccc-3’ |
| Sequence-based reagent | PALB2-F1_re1 | This paper | PCR primers | 5’-atgcggccgcattagaacttgtgggcag-3’ |
| Sequence-based reagent | PALB2-F2_fo1 | This paper | PCR primers | 5’-atggatccgcacaaggcaaaaaaatg-3’ |
| Sequence-based reagent | PALB2-F2_re1 | This paper | PCR primers | 5’-atgcggccgctgtgatactgagaaaagac-3’ |
| Sequence-based reagent | PALB2-F3_fo1 | This paper | PCR primers | 5’-atggatccttatccttggatgatgatg-3’ |
| Sequence-based reagent | PALB2-F3_re1 | This paper | PCR primers | 5’-atgcggccgcagctttccaaagagaaac-3’ |
| Sequence-based reagent | PALB2-F4_fo1 | This paper | PCR primers | 5’-atggatcctgttccgtagatgtgag-3’ |
| Sequence-based reagent | PALB2-F4_re1 | This paper | PCR primers | 5’-atgcggccgcttatgaatagtggtatacaaat-3’ |
| Sequence-based reagent | PALB2_395_Fo | This paper | PCR primers | 5’- actggatcctcttgcacagtgcctg-3’ |
| Sequence-based reagent | PALB2_353_Fo | This paper | PCR primers | 5’- actggatccaaatctttaaaatctcccagtg-3’ |
| Sequence-based reagent | PALB2_450_Re | This paper | PCR primers | 5’- tatctcgagttaatttttacttgcatccttattttta-3’ |
| Sequence-based reagent | PALB2_433_Re | This paper | PCR primers | 5’- tatctcgagttacaaatgactctgaatgacagc-3’ |
| Sequence-based reagent | PALB2_499_Re | This paper | PCR primers | 5’- tatctcgagttacaagtcattatcttcagtggg-3’ |
| Sequence-based reagent | Patch 1-K-Rev | This paper | PCR primers | 5’-tcagagtcatttggatgtcaagaaaaaaggttt-3’ |
| Sequence-based reagent | Patch 2-WT-Fwd | This paper | PCR primers | 5’-aaaaataaaaataaggatgcaagtaaaaat-3’ |
| Sequence-based reagent | Patch 1-R-Rev | This paper | PCR primers | 5’-tcagagtcatttggatgtcaggagaagagggttt-3’ |
| Sequence-based reagent | Patch 2-R-Fwd_FL | This paper | PCR primers | 5’-agaaatagaaatagggatgcaagtagaaatttaaacctttccaat-3’ |
| Sequence-based reagent | Patch 1-Q-Rev | This paper | PCR primers | 5’-tcagagtcatttggatgtccagcaacaaggttt-3’ |
| Sequence-based reagent | Patch 2-Q-Fwd_FL | This paper | PCR primers | 5’-caaaatcaaaatcaggatgcaagtcaaaatttaaacctttccaat-3’ |
| Sequence-based reagent | Patch 2-Q-Fwd_ChAM | This paper | PCR primers | 5’-caaaatcaaaatcaggatgcaagtcaaaattgagcggccgcact-3’ |
| Sequence-based reagent | Beta-Actin_in3-fo | This paper | PCR primers | 5’-taacactggctcgtgtgacaa-3’ |
| Sequence-based reagent | Beta-Actin_in3-re | This paper | PCR primers | 5’-aagtgcaaagaacacggctaa-3’ |
| Sequence-based reagent | Chr5_TCOF1_peak2_fo | This paper | PCR primers | 5’-ctacccgatccctcaggtca-3’ |
| Sequence-based reagent | Chr5_TCOF1_peak2_re | This paper | PCR primers | 5’-tcagggctctatgaggggac-3’ |
| Sequence-based reagent | Chr11_WEE1_mid_fo | This paper | PCR primers | 5’-ggccgaggcttgaggtatatt-3’ |
| Sequence-based reagent | Chr11_WEE1_mid_re | This paper | PCR primers | 5’-ataaccccaaagaacacaggtca-3’ |
| Peptide, recombinant protein | ChAM-WT | This paper | Francis Crick Institute Peptide Chemistry Technology Platform | AEKHSCTVPEGLLFPAEYYVRTTRSMSNCQRKVAVEAVIQSHLDVKKKGFKNKNKDASKN |
| Peptide, recombinant protein | ChAM-K436(Ac)-K437(Ac)-K438(Ac) | This paper | Francis Crick Institute Peptide Chemistry Technology Platform | AEKHSCTVPEGLLFPAEYYVRTTRSMSNCQRKVAVEAVIQSHLDVK(Ac)K(Ac)K(Ac)GFKNKNKDASKN |
| Peptide, recombinant protein | ChAM-K436(Ac) | This paper | Francis Crick Institute Peptide Chemistry Technology Platform | AEKHSCTVPEGLLFPAEYYVRTTRSMSNCQRKVAVEAVIQSHLDVK(Ac)KKGFKNKNKDASKN |
| Peptide, recombinant protein | ChAM-K437(Ac) | This paper | Francis Crick Institute Peptide Chemistry Technology Platform | AEKHSCTVPEGLLFPAEYYVRTTRSMSNCQRKVAVEAVIQSHLDVKK(Ac)KGFKNKNKDASKN |
| Peptide, recombinant protein | ChAM-K438(Ac) | This paper | Francis Crick Institute Peptide Chemistry Technology Platform | AEKHSCTVPEGLLFPAEYYVRTTRSMSNCQRKVAVEAVIQSHLDVKKK(Ac)GFKNKNKDASKN |
| Software, algorithm | Image J | https://imagej.nih.gov/ij/ | Schneider et al., 2012 | |
| Software, algorithm | Proteome Discoverer v1.4 | ThermoFischer Scientific | ||
| Software, algorithm | FlowJo software V10 | FlowJo | ||
| Commercial assay, kit | SensiFAST SYBR No-Rox kit | Bioline | BIO-98005 |