Skip to main content
BMC Pharmacology & Toxicology logoLink to BMC Pharmacology & Toxicology
. 2022 Dec 2;23:91. doi: 10.1186/s40360-022-00627-w

Potential antiviral peptides targeting the SARS-CoV-2 spike protein

Ibrahim Khater 1, Aaya Nassar 1,2,
PMCID: PMC9716172  PMID: 36461109

Abstract

Background

The coronavirus disease caused by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) infection became an international pandemic and created a public health crisis. The binding of the viral Spike glycoprotein to the human cell receptor angiotensin-converting enzyme 2 (ACE2) initiates viral infection. The development of efficient treatments to combat coronavirus disease is considered essential.

Methods

An in silico approach was employed to design amino acid peptide inhibitor against the receptor-binding domain (RBD) of the SARS-CoV-2 spike protein. The designed inhibitor (SARS-CoV-2 PEP 49) consists of amino acids with the α1 helix and the β4 - β5 sheets of ACE2. The PEP-FOLD3 web tool was used to create the 3D structures of the peptide amino acids. Analyzing the interaction between ACE2 and the RBD of the Spike protein for three protein data bank entries (6M0J, 7C8D, and 7A95) indicated that the interacting amino acids were contained inside two regions of ACE2: the α1 helical protease domain (PD) and the β4 - β5 sheets.

Results

Molecular docking analysis of the designed inhibitor demonstrated that SARS-CoV-2 PEP 49 attaches directly to the ACE2 binding site of the Spike protein with a binding affinity greater than the ACE2, implying that the SARS-CoV-2 PEP 49 model may be useful as a potential RBD binding blocker.

Keywords: SARS-CoV-2, Spike protein, COVID-19, Molecular docking, Peptide blocker, ACE2

Introduction

The coronavirus disease (COVID-19) is an ongoing global pandemic caused by the enigmatic severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). Since the virus was originally detected, multiple mutated variants of the virus have been identified globally, resulting in surges of infection, despite the vaccine administration. As of March 27, 2022, the pandemic had caused more than 480 million cases and 6.12 million deaths, making it one of the deadliest in history.

In the realm of infectious diseases, a pandemic is a worst-case scenario. During the last two decades, several viral epidemics involving the coronavirus family have been reported, including the Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV) found in 2002 and the influenza epidemic of the H1N1 virus in 2009, while the Middle East Respiratory Syndrome Coronavirus (MERS-CoV) was first identified in 2012 [1].

A human coronavirus (HCoV) is a virus that attacks the respiratory system of humans. Alphacoronaviruses 229E and NL63, as well as Betacoronaviruses OC43, HKU1, SARS, and MERS, have caused previous coronavirus outbreaks [2]. The most dangerous coronavirus strains have been identified as SARS and MERS. SARS-CoV-2 is the seventh coronavirus to infect humans; four of these coronaviruses, 229E, NL63, OC43, and HKU1, cause mild symptoms similar to common cold symptoms, while the other three coronaviruses, SARS-CoV, MERS-CoV, and SARS-CoV-2, cause severe symptoms that can be difficult to treat, resulting in high hospitalization and mortality rates. The SARS-CoV-2 virus is contagious, highly transmittable among humans, and spreads across countries. The genetic sequence of SARS-CoV-2 was found to be 88% similar to SARS [25], indicating that SARS-CoV-2 is a Betacoronavirus like SARS and MERS [6]. HCoVs are positive-sense, single-stranded RNA viruses with a genome length of about 30,000 base pairs. Spike protein (S), Nucleocapsid protein (N), Membrane protein (M), and Envelope protein (E) are structural proteins, while polymerase protein and protease protein are non-structural proteins found in HCoVs [7]. The Spike protein, which is one of the structural proteins, generates enormous protrusions from the virus’s surface, giving it the appearance of a crown. The Spike protein mediates the virus’s entry into the host cell [8, 9].

The SARS-CoV-2 Spike protein is involved in cell receptor identification and membrane fusion [9]. The Spike protein is made up of two subunits: the S1 receptor-binding domain (RBD), which recognizes and binds to the host receptor angiotensin-converting enzyme 2 (ACE2), and the S2 subunit, which is in charge of facilitating viral cell membrane fusion [1014]. During viral infection, the Spike protein is split into S1 and S2 subunits, with S1 subunits released during the transition to the post-fusion conformation [1520]. The RBD of the S1 subunit directly binds to the peptidase domain (PD) of ACE2 [21], whereas the S2 subunit is responsible for membrane fusion. When S1 binds to the host receptor ACE2, another cleavage site on S2 is exposed, and host proteases cleave it, a step that is necessary for viral infection [22, 23].. The SARS-CoV-2 Spike protein may similarly use ACE2 to infect the host cell [21, 24, 25]..

The genomics research examined approximately 4 K SARS-CoV-2 genomes using large-scale, fast whole-genome sequencing in order to better understand viral transmission and evolution [26], (27), [27, 28]. The first virus strains discovered were the B.1.1.7 lineage, which originated from the United Kingdom, P.1 from Brazil, B.1.351 from South Africa, and delta variant B.1.617.2, which was first discovered in India in December 2020 and was substantially more contagious and sparked a worldwide increase in coronavirus cases. A new variant named Omicron B.1.1.529 was first identified in South Africa in November 2021, and at present, there are a number of Omicron sub-lineages, including BA.2, BA.4, and BA.5, and another recombinant detected, made up of BA.1 and BA.2. The main goal of basic research studies is to find powerful SARS-CoV-2 structural and non-structural protein inhibitors. Recent research looked at a few commercially available antiviral treatments to see if they can be repurposed to inhibit the SARS-CoV-2 main protease (Mpro) and papin-like protease (PLpro), using in-silico screening to look for possible SARS-CoV-2 inhibitors by using molecular docking analysis [29, 30]. Because the main protease protein appears to play an essential role in viral replication, inhibiting it may be effective in blocking the initiation of the infection and the replication chain. On the other hand, few approved antiviral treatments demonstrated high binding probabilities as inhibitors of the SARS-CoV-2 papin-like protease. The current work aims to design an in-silico peptide inhibitor of the SARS-CoV-2 Spike protein by first examining the interactions between ACE2 and RBD of the Spike protein for the three protein data bank (PDB) entries: 1) The crystal structure of the SARS-CoV-2 spike receptor-binding domain bound with ACE2 (PDB IDs: 6M0J), 2) The cryo-EM structure of cat ACE2 and SARS-CoV-2 RBD (PDB IDs: 7C8D), and 3) The SARS-CoV-2 Spike Glycoprotein with one ACE2 bound and one RBD upright in a clockwise direction (PDB IDs: 7A95). The peptide models were computationally designed by applying the PEP-FOLD3 web tool to act as the inhibitors of RBD-ACE2 interaction and developed into 49 amino acids.

Methods

Structural analysis

Three structures of the SARS-CoV-2, 6M0J, 7C8D, and 7A95, were selected as models to illustrate the interactions between the SARS-CoV-2 RBD of the Spike protein and ACE2. The protein structures were then downloaded from the Protein Data Bank (PDB), available at (https://www.rcsb.org). The interacting energy between RBD and ACE2 was calculated using MM/GBSA on the HawkDock web server [31]. MM/GBSA is employed to predict the binding free energy and decompose the free energy contributions to the binding free energy of a protein-protein complex in per-residue to help analyze the binding structures. Interface residues between RBD and ACE2 were calculated using MM/GBSA for the three protein structures. The interface residues that were repeated in all structures were extracted.

The novel peptide design

The web-based tool ESPript (https://espript.ibcp.fr/ESPript/ESPript) is a web tool for extracting and rendering a comprehensive analysis of the protein structure in an automated form. The ESPript program renders sequence similarities and secondary structure elements from aligned sequences with numerous options to optimize and enhance their depiction [32]. The amino acid sequence of ACE2 was aligned with the secondary structure of ACE2 of 6M0J using ESPript version 3. The sequence of the secondary structure, which was obtained and used to design the peptide, contains the most relevant and adjacent repeating ACE2 interface residues.

Physicochemical properties and solubility prediction

Using the online web server ProtParam (http://web.expasy.org/protparam), the computed parameters, including theoretical pI (isoelectric point), aliphatic index, instability index, estimated half-life in mammalian reticulocytes in vitro, extinction coefficient, molecular weight, and grand average of hydropathicity (GRAVY) of candidate peptides, were determined [33, 34]. The Pepcalc program (http://pepcalc.com) was then used to determine the peptide’s estimated solubility in water [35].

Secondary structure prediction

PSI-blast based secondary structure PREDiction (PSIPRED) is a protein structure analysis approach. Its algorithm is based on artificial neural networks and machine learning. The PSIPRED prediction method (http://bioinf.cs.ucl.ac.uk/psipred) was used to predict the secondary structure of the peptide [36].

Tertiary structure prediction and validation

PEP-FOLD3 (https://bioserv.rpbs.univ-paris-diderot.fr/services/PEP-FOLD3) is a fast computational framework for de novo free-biased prediction of linear peptides between 5 and 50 amino acids that allows for the creation of native-like conformations of peptides interacting with proteins when the interaction site is known [37, 38]. The PEP-FOLD3 web tool was applied for three-dimensional (3D) structure prediction of the peptide, yielding five different models that were ranked based on free energies, the ERRAT score [39] and the PROVE pass test [40]. The best model was verified with the PROCHECK [41] program and ProSA-web (https://prosa.services.came.sbg.ac.at/prosa.php) [42].

Molecular docking

The protein docking server ClusPro 2.0 was used to dock the peptide to the RBD of the Spike protein [4345]. The ClusPro server (https://cluspro.org) is a widely used tool for protein-protein docking. Ten docking complexes were created. The complexes were ranked according to MM/GBSA interaction energy. After that, the docking complex with the highest interaction energy was chosen.

Molecular dynamics simulations

The CHARMM-GUI was used to build the protein topologies and parameter files [4648]. The software package GROMACS-2019 [49], as well as the CHARMM36 force field [50], were carried out for the molecular dynamics (MD) simulation. The system was solvated with TIP3P water in the “add solvation box” [51], and the whole complexes were neutralized by using the Monte-Carlo ion-placing method to add appropriate amounts of K+ and Cl ions. The system was energy-minimized for 5000 steps using the steepest descent algorithm before simulations [52] and equilibrated for 125 ps at a constant number of molecules, volume, and temperature (NVT). Finally, the MD simulations were performed for 100 ns at a constant temperature (310 K), pressure (1 atm), and the number of molecules (NPT ensemble). The number of hydrogen bonds, the radius of gyration (Rg), and the root mean square deviation (RMSD) of the protein atom backbone were displayed as a function of time [53]. The average root mean square fluctuation (RMSF) was then graphed as a function of the residue number.

Results

The interacting energies between RBD and ACE2 for the three protein structures (6M0J, 7C8D, and 7A95) were calculated using MM/GBSA. Table 1 demonstrates the interacting energies between RBD and ACE2 for the three protein structures, showing the highest interacting energy between RBD and ACE2 at − 60.56 kcal/mol. Interface residues between RBD and ACE2 were calculated using MM/GBSA for the three structures, and the repeated residues of ACE2 were aligned with the secondary structure of ACE2 using ESPript version 3, where the interface residues are highlighted in red triangles as illustrated in Fig. 1. The interacting amino acids (black rectangles) were contained inside two regions of ACE2: α1 helical protease domain (PD) and β4 - β5 sheets (red rectangles). The proposed peptide (49 amino acids) was then designed, utilizing the amino acids of the entire length of α1 helix and β4 - β5 sheets inside the red rectangles.

Table 1.

Using MM/GBSA (kcal/mol). the interacting energies between receptor-binding domain (RBD) and angiotensin-converting enzyme 2 (ACE2) for the three structures (6M0J, 7C8D, and 7A95) were calculated. Bold red highlights the area with the highest interaction energy

Structure MM/GBSA Scores (kcal/mol) Average score
6M0J −60.91 −59.7 −61.06 −60.56 ± 0.75
7C8D − 55.17 −50.37 − 52.92 − 52.82 ± 2.40
7A95 −56.36 − 55.14 − 55.14 −55.55 ± 0.70

Fig. 1.

Fig. 1

Using ESPript3, the amino acid sequences of ACE2 of 6M0J were aligned with the secondary structure of ACE2, demonstrating the amino acids’ solvent accessibility.. Two regions of ACE2, α1 helical protease domain (PD) and β4 - β5 sheets (red rectangles surrounding the 49 amino acids), contained the majority of the amino acids that interacted with RBD (red triangles)

The peptide had an estimated molecular weight of 5713.23 kDa and a theoretical isoelectric point (pI) of 4.50, which is less than seven, indicating that the protein has a high proportion of negatively charged residues versus positively charged residues. The instability index (Ii) was determined to be 49.67, indicating solution instability. The hydropathicity index (GRAVY) large average was − 0.710, indicating that it was a hydrophilic protein that could interact in aqueous solutions. The peptide’s aliphatic index (Ai) was 63.88, indicating that it can be stable over a wide temperature range. Taking into account that the estimated half-life of mammalian reticulocytes in vitro was 1.9 hours, while yeast had a half-life of 20 hours, and E. coli had a half-life of 10 hours. The extinction coefficient (EC) was calculated to be 13,940 M− 1 cm− 1, indicating good water solubility and supporting a quantitative study of protein-ligand and protein-protein interaction in solution. Table 2 displays the results of the candidate peptide’s physicochemical properties.

Table 2.

The physicochemical properties of the peptide. The extinction coefficient (EC) of 13,940 M− 1 cm− 1 indicates good water solubility and supports a quantitative study of protein-ligand and protein-protein interaction in solution

Peptide Sequence LENGTH PI GRAVY MW (Da) Solubility Half-life (h) Ii Ai EC (M−1 cm− 1)
STIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNPTAWDLGKGDFRIL 49 4.50 −0.710 5713.23 Good water solubility 1.9 49.67 63.88 13,940

The PSIPRED-predicted secondary structure of the designed peptide is illustrated in Fig. 2A. Using the PEP-FOLD3 web tool, five models of the peptide’s tertiary structure were created and ranked based on the free energies, the ERRAT scores, and the PROVE pass test. The best model was then chosen and designated as the SARS-CoV-2 PEP 49 model, as displayed in Fig. 2B.

Fig. 2.

Fig. 2

The final peptide’s projected secondary structure. A PSIPRED predicted secondary structure. B PEP-FOLD3 predicted three-dimensional structure; the helix and coil are, respectively, shown in light magenta and gray

The energy of the stable conformation of psi (ψ) and phi (Φ) twisting or dihedral angles for each amino acid is determined by the Ramachandran plot. The results of the Ramachandran plot analysis’s tertiary structure validation show that the total percentage of favored and allowed region residues was greater than 97% as displayed in Fig. 3A. The ProSA-web tool was used to validate the quality and potential errors in the crude 3D model, which resulted in a Z-score of − 2.68 for the peptide model as shown in Fig. 3B. The Ramachandran plot and the ProSA-web score both validated the PEP 49 model’s quality.

Fig. 3.

Fig. 3

Validation of PEP 49 model’s tertiary structure. A More than 97% of the amino acids in the final peptide are in the permitted regions as seen in the Ramachandran plot. B ProSA-web plot of the peptide, which results in a Z-score of − 2.68

The PEP 49 model was docked to the RBD of the Spike protein 6M0J using ClusPro 2.0. The MM/GBSA interaction energy between the PEP 49 model and RBD was − 91.49 ± 0.18 kcal/mol. The resulting interacting energy was greater than the highest interacting energy (− 60.56 kcal/mol) between RBD and ACE2. Figure 4 displays the common interface residues of the PEP 49 model, ACE2, and RBD in light orange, whereas the unique interacting residues of PEP 49 are shown in light green, and the unique interaction residues of ACE2 are displayed in magenta. As listed in Table 3, the interactions between the RBD and PEP 49 model were investigated using PDBePISA, which included hydrogen bonds and salt bridges. The PEP 49 model produced eight hydrogen bonds and six salt bridges with RBD. This result explains the interaction energy that MM/GBSA measured.

Fig. 4.

Fig. 4

Complexes of PEP 49 (in red) with RBD and ACE2 have a value of (− 91.36 ± 0.18 kcal/mol). The unique interacting residues of PEP 49 are depicted in light green, while the unique interacting residues of ACE2 are depicted in magenta. The common interface residues of PEP 49 model 5; ACE2 and RBD were displayed in light orange

Table 3.

Utilizing PDBePISA, the interactions between the RBD and PEP 49 peptide models were analyzed. With RBD, the PEP 49 model generated eight hydrogen bonds and six salt bridges

Peptide model-RBD complex
Hydrogen bonds Salt bridges
RBD residue ACE2 residue Distance (Ao) RBD residue ACE2 residue Distance (Ao)
ARG 346 GLU 4 1.79 ARG 346 GLU 4 3.98
TYR 449 GLU 4 2.04 ARG 346 GLU 4 2.77
GLU 484 LYS 13 1.70 LYS 444 GLU 4 2.64
GLU 484 LYS 13 1.75 LYS 444 GLU 4 2.54
PHE 486 GLU 17 2.39 GLU 484 LYS 13 2.64
ASN 487 GLU 17 2.00 GLU 484 LYS 13 2.54
GLN 493 GLY 42 1.99
TYR 505 ARG 47 2.38

Discussion

In silico molecular docking analysis and simulations targeting the Spike protein revealed insights that designed inhibitors can bind directly at the ACE2 binding site of the Spike protein [54, 55]. However, to have improved affinity, inhibitors need to have complementary conformations that match their target. An inhibitor for the essential amino acids should have selective binding and a low root-mean-square deviation (RMSD) [5659]. Antiviral peptides can prevent SARS-CoV-2 membrane fusion and could be employed to prevent and treat infections in the future. The use of blocking peptides to target the SARS-CoV-2 Spike protein and fusion cores opens up a new avenue for therapeutic development. Peptide inhibitors are a potential strategy for treating coronavirus infections, according to in silico investigations on SARS-CoV-2 targeting the fusion sites [6063].

The interactions between the ligands and the protein are instantaneous through the docking process, and the interaction may be unstable [64]. The molecular dynamics simulations provided useful information on the stability of the complexes’ molecular interactions. The PEP 49 model had the highest chance of binding to the RBD in this research study. The stability of the complex was assessed using the RMSD for the backbone atoms of RBD and RBD-PEP 49 model complexes in comparison to the starting structures [65]. The RMSD values are plotted in Fig. 5 of RBD (blue) and the RBD – PEP 49 model complex (orange). RBD was stabilized between 5 and 60 nm and RMSD increased after that, while the RBD-PEP 49 model complex was stabilized between 30 and 70 nm and increased after that, which may have returned to the fluctuation of RBD itself. Further, the complex’s stability was assessed by graphing the Radius of gyration (Rg) as a function of time [65]. The calculated Rg values over the simulation time scale are graphed in Fig. 6, where the parameter is stable for the RBD (blue) and the RBD-peptide complex (orange) over the simulation time. The number of hydrogen bonds in the RBD and RBD-peptide complex were shown in Fig. 5 indicating that the number of hydrogen bonds in the complex is greater than the RBD and is approximately stable over the simulation time.

Fig. 5.

Fig. 5

Graph showing the Root Mean Square Deviation (RMSD) for the backbone atoms, the radius of gyration (Rg), the number of hydrogen bonds in the RBD (blue), and the RBD-PEP 49 model 5 complex (orange) throughout the course of a 100 ns simulation

Fig. 6.

Fig. 6

Graph of the average RMSF per residue for the RBD (blue) and RBD-PEP 49 model 5 complex (orange) over 100 ns simulations

As already observed in Fig. 6, the average RMSF over 100 ns per residue for RBD (blue) and the RBD-peptide complex (orange), indicated a distinct decrease of the RMSF of the residues between 473 and 493 of RBD in the complex with the peptide compared with the free RBD. The presence of residues 484, 486, 487, and 493 in this region, which together form 2 salt bridges and 5 hydrogen bonds with the PEP 49 model, underlines the great stability of these interactions. According to the findings, the SARS-CoV-2 PEP 49 model binds to the ACE2 binding region of RBD with a high affinity, indicating that it might be employed as a possible SARS-CoV-2 Spike protein inhibitor.

Conclusion

Developing SARS-CoV-2 Spike protein inhibitors has received a lot of attention The designed peptide model created from 49 interface amino acids of ACE2 (SARS-CoV-2 PEP 49) demonstrated a higher binding affinity to SARS-CoV-2 Spike protein than ACE2, implying that it may be used to inhibit SARS-CoV-2. In order to prevent the transmission of the virus, the results of this research could be used to develop therapeutic inhibitors. The designed peptide model could also be used to test new COVID-19 treatment options and their efficacy in experimental research.

Acknowledgements

Authors would like to acknowledge Bibliotheca Alexandrina for making the High-Performance Computing Workstation available for the Molecular Dynamics Simulations calculations.

Abbreviations

229E

A species of Alphacoronavirus which infects humans and bats

ACE2

Angiotensin-converting enzyme 2

ClusPro 2.0

Web server for protein-protein docking

COVID-19

2019 Novel coronavirus

ERRAT scores

“Overall quality factor” for non-bonded atomic interactions measured by a program for verifying protein structures determined by crystallography

HCoVs

Human coronaviruses

HKU1

Species of coronavirus in humans and animals

MERS

Middle East Respiratory Syndrome Coronavirus

MM/GBSA

Poisson–Boltzmann or generalized Born and surface area continuum solvation method

NL63

A species of Alphacoronavirus, specifically a Setracovirus from among the Alphacoronavirus genus

OC43

A member of the species Betacoronavirus 1, which infects humans and cattle

PDB IDs: 6M0J

Crystal structure of SARS-CoV-2 spike receptor-binding domain bound with ACE2

PDB IDs: 7C8D

Cryo-EM structure of cat ACE2 and SARS-CoV-2 RBD

PDBePISA

An interactive web tool for the exploration of macromolecular interfaces

PEP-FOLD3 web tool

A web tool to create the 3D structures of the peptide amino acids

ProSA-web

An interactive web service for the recognition of errors in three-dimensional structures of proteins

PROVE

PROtein Volume Evaluation program

RBD

Receptor-binding domain

RBD-PEP 49

RBD and PEP 49 model complex

Rg

Radius of gyration

RMSF

Root mean square fluctuation

SARS

severe acute respiratory syndrome

SARS-CoV-2

Severe acute respiratory syndrome 2

SARS-CoV-2 PEP 49

Designed model of amino acids with the α1 helix and the β4 - β5 sheets of ACE2

Authors’ contributions

I.K. and A.N. wrote the main manuscript text and I.K. prepared the figures. All authors reviewed the manuscript. The author(s) read and approved the final manuscript.

Funding

No funding was provided.

Availability of data and materials

All data generated or analyzed during this study are included in this published article.

Declarations

Ethics approval and consent to participate

This work did not include any animals or human participants.

Consent for publication

NA.

Competing interests

The authors declare that they have no known competing financial interests or personal relationships that could have appeared to influence the work reported in this paper.

Footnotes

Publisher’s Note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Contributor Information

Ibrahim Khater, Email: ikhater@sci.cu.edu.eg.

Aaya Nassar, Email: aaya_nassar@cu.edu.eg.

References

  • 1.Cascella M, Rajnik M, Cuomo A, Dulebohn SC, Di Napoli R. Features, evaluation and treatment coronavirus (COVID-19), StatPearls. 2020. [PubMed] [Google Scholar]
  • 2.Hui DS, Azhar EI, Madani TA, Ntoumi F, Kock R, Dar O, et al. The continuing 2019-nCoV epidemic threat of novel coronaviruses to global health — The latest 2019 novel coronavirus outbreak in Wuhan, China. Int J Infect Dis. 91(2020):264–6. 10.1016/j.ijid.2020.01.009. [DOI] [PMC free article] [PubMed]
  • 3.Lu R, Zhao X, Li J, Niu P, Yang B, Wu H, Wang W, Song H, Huang B, Zhu N, Bi Y, Ma X, Zhan F, Wang L, Hu T, Zhou H, Hu Z, Zhou W, Zhao L, Chen J, Meng Y, Wang J, Lin Y, Yuan J, Xie Z, Ma J, Liu WJ, Wang D, Xu W, Holmes EC, Gao GF, Wu G, Chen W, Shi W, Tan W. Genomic characterisation and epidemiology of 2019 novel coronavirus: implications for virus origins and receptor binding. Lancet. 2020;395:565–574. doi: 10.1016/S0140-6736(20)30251-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Wang W, Tang J, Wei F. Updated understanding of the outbreak of 2019 Novel coronavirus (2019-nCoV) in Wuhan, China. J Med Virol. 2020;92:441–447. doi: 10.1002/jmv.25689. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Bogoch II, Watts A, Thomas-Bachli A, Huber C, Kraemer MUG, Khan K. Pneumonia of unknown etiology in Wuhan, China: potential for international spread via commercial air travel. J Travel Med. 2020:1–3. 10.1093/jtm/taaa008. [DOI] [PMC free article] [PubMed]
  • 6.Chan JFW, Lau SKP, To KKW, Cheng VCC, Woo PCY, Yue KY. Middle East respiratory syndrome coronavirus: another zoonotic betacoronavirus causing SARS-like disease. Clin Microbiol Rev. 2015;28:465–522. doi: 10.1128/CMR.00102-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Elfiky AA, Ismail AM. Molecular modeling and docking revealed superiority of IDX-184 as HCV polymerase inhibitor. Future Virol. 2017;12:339–347. doi: 10.2217/fvl-2017-0027. [DOI] [Google Scholar]
  • 8.Li F. Structure, function, and evolution of coronavirus spike proteins. Annu Rev Virol. 2016;3:237–261. doi: 10.1146/annurev-virology-110615-042301. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Li F, Li W, Farzan M, Harrison SC. Structure of SARS coronavirus spike receptor-binding domain complexed with receptor. Science. 2005;309:1864–1868. doi: 10.1126/science.1116480. [DOI] [PubMed] [Google Scholar]
  • 10.Li W, Choe H, Farzan M. In: Insights from the association of SARS-CoV S-protein with its receptor, ACE2 BT - the Nidoviruses. Perlman S, Holmes KV, editors. Boston: Springer US; 2006. pp. 209–218. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Fehr AR, Perlman S. In: Coronaviruses: an overview of their replication and pathogenesis BT - coronaviruses: methods and protocols. Maier HJ, Bickerton E, Britton P, editors. New York: Springer New York; 2015. pp. 1–23. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Huang Y, Yang C, Xu X, Xu W, Liu S. Structural and functional properties of SARS-CoV-2 spike protein : potential antivirus drug development for COVID-19. Acta Pharmacol Sin. 2020. 10.1038/s41401-020-0485-4. [DOI] [PMC free article] [PubMed]
  • 13.Gallagher TM, Buchmeier MJ. Coronavirus spike proteins in viral entry and pathogenesis. Virology. 2001;279:371–374. doi: 10.1006/viro.2000.0757. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Simmons G, Zmora P, Gierer S, Heurich A, Pöhlmann S. Proteolytic activation of the SARS-coronavirus spike protein: cutting enzymes at the cutting edge of antiviral research. Antivir Res. 2013;100:605–614. doi: 10.1016/j.antiviral.2013.09.028. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Shang J, Ye G, Shi K, Wan Y, Luo C, Aihara H, Geng Q, Auerbach A, Li F. Structural basis of receptor recognition by SARS-CoV-2. Nature. 2020;581:221–224. doi: 10.1038/s41586-020-2179-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Lan J, Ge J, Yu J, Shan S, Zhou H, Fan S, Zhang Q, Shi X, Wang Q, Zhang L, Wang X. Structure of the SARS-CoV-2 spike receptor-binding domain bound to the ACE2 receptor. Nature. 2020;581:215–220. doi: 10.1038/s41586-020-2180-5. [DOI] [PubMed] [Google Scholar]
  • 17.Wang Q, Zhang Y, Wu L, Niu S, Song C, Zhang Z, Lu G, Qiao C, Hu Y, Yuen K-Y, Wang Q, Zhou H, Yan J, Qi J. Structural and functional basis of SARS-CoV-2 entry by using human ACE2. Cell. 2020;181:894–904.e9. doi: 10.1016/j.cell.2020.03.045. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Belouzard S, Chu VC, Whittaker GR. Activation of the SARS coronavirus spike protein via sequential proteolytic cleavage at two distinct sites. 2009. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Simmons G, Reeves JD, Rennekamp AJ, Amberg SM, Piefer AJ, Bates P. Characterization of severe acute respiratory spike glycoprotein-mediated viral entry. 2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Song W, Gui M, Wang X, Xiang Y. Cryo-EM structure of the SARS coronavirus spike glycoprotein in complex with its host cell receptor ACE2. 2018. pp. 1–19. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Li W, Moore MJ, Vasilieva N, Sui J. Angiotensin-converting enzyme 2 is a functional receptor for the SARS coronavirus, 426. 2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Millet JK, Whittaker GR. Host cell proteases : critical determinants of coronavirus tropism and pathogenesis. Virus Res. 2015;202:120–134. doi: 10.1016/j.virusres.2014.11.021. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Simmons G, Gosalia DN, Rennekamp AJ, Reeves JD, Diamond SL, Bates P. Inhibitors of cathepsin L prevent severe acute respiratory syndrome coronavirus entry. Proc Natl Acad Sci USA. 2005;102(33):11876–81. 10.1073/pnas.0505577102. [DOI] [PMC free article] [PubMed]
  • 24.Zhou P, Yang X, Wang X, Hu B, Zhang L, Zhang W, et al. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature. 2020;579. 10.1038/s41586-020-2012-7. [DOI] [PMC free article] [PubMed]
  • 25.Kuba K, Imai Y, Rao S, Gao H, Guo F, Guan B, et al. A crucial role of angiotensin converting enzyme 2 ( ACE2 ) in SARS coronavirus – induced lung injury. 2005;11:875–9. 10.1038/nm1267. [DOI] [PMC free article] [PubMed]
  • 26.Oude Munnink BB, Nieuwenhuijse DF, Stein M, O’Toole Á, Haverkate M, Mollers M, Kamga SK, Schapendonk C, Pronk M, Lexmond P, van der Linden A, Bestebroer T, Chestakova I, Overmars RJ, van Nieuwkoop S, Molenkamp R, van der Eijk AA, GeurtsvanKessel C, Vennema H, Meijer A, Rambaut A, van Dissel J, Sikkema RS, Timen A, Koopmans M, Oudehuis GJAPM, Schinkel J, Kluytmans J, Kluytmans-van den Bergh M, van den Bijllaardt W, Berntvelsen RG, van Rijen MML, Schneeberger P, Pas S, Diederen BM, Bergmans AMC, van der Eijk PAV, Verweij JJ, Buiting AGN, Streefkerk R, Aldenkamp AP, de Man P, Koelemal JGM, Ong D, Paltansing S, Veassen N, Sleven J, Bakker L, Brockhoff H, Rietveld A, Slijkerman Megelink F, Cohen Stuart J, de Vries A, van der Reijden W, Ros A, Lodder E, Verspui-van der Eijk E, Huijskens I, Kraan EM, van der Linden MPM, Debast SB, Al Naiemi N, Kroes ACM, Damen M, Dinant S, Lekkerkerk S, Pontesilli O, Smit P, van Tienen C, Godschalk PCR, van Pelt J, Ott A, van der Weijden C, Wertheim H, Rahamat-Langendoen J, Reimerink J, Bodewes R, Duizer E, van der Veer B, Reusken C, Lutgens S, Schneeberger P, Hermans M, Wever P, Leenders A, ter Waarbeek H, Hoebe C. T.D.-C.-19 response team, Rapid SARS-CoV-2 whole-genome sequencing and analysis for informed public health decision-making in the Netherlands. Nat. Med. 2020;26:1405–1410. doi: 10.1038/s41591-020-0997-y. [DOI] [PubMed] [Google Scholar]
  • 27.Kim D, Lee J-Y, Yang J-S, Kim JW, Kim VN, Chang H. The architecture of SARS-CoV-2 transcriptome. Cell. 2020;181:914–921.e10. doi: 10.1016/j.cell.2020.04.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.SPHERES. SARS-CoV-2 sequencing for public health emergency response, epidemiology, and surveillance. Cent Dis Control Prev. 2021; https://www.cdc.gov/coronavirus/2019-ncov/variants/spheres.html.
  • 29.Khater I, Nassar A. In silico molecular docking analysis for repurposing approved antiviral drugs against SARS-CoV-2 main protease. Biochem Biophys Reports. 2021;27:101032. doi: 10.1016/j.bbrep.2021.101032. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Khater I, Nassar A. Repurposing antiviral drugs to inhibit SARS-CoV-2 Papin-like protease activity. Int J Intell Comput Inf Sci. 2021;21:149–164. doi: 10.21608/ijicis.2021.66637.1068. [DOI] [Google Scholar]
  • 31.Weng G, Wang E, Wang Z, Liu H, Zhu F, Hou T, et al. HawkDock : a web server to predict and analyze the protein – protein complex based on computational docking and MM / GBSA. 2019;47:322–30. 10.1093/nar/gkz397. [DOI] [PMC free article] [PubMed]
  • 32.Robert X, Gouet P. Deciphering key features in protein structures with the new ENDscript server. Nucleic Acids Res. 2014;42:320–324. doi: 10.1093/nar/gku316. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Wilkins MR, Gasteiger E, Bairoch A, Sanchez JC, Williams KL, Appel RD, Hochstrasser DF. Protein identification and analysis tools in the ExPASy server. Methods Mol Biol. 1999;112:531–552. doi: 10.1385/1-59259-584-7:531. [DOI] [PubMed] [Google Scholar]
  • 34.E. Gasteiger, C. Hoogland, A. Gattiker, S. Duvaud, M.R. Wilkins, R.D. Appel, A. Bairoch, Protein identification and analysis tools on the ExPASy server: Walk J.M. Proteomics Protoc. Handb., Springer Protocols Handbooks, Humana Press, 2005. 10.1385/1-59259-890-0:571.
  • 35.Lear S, Cobb SL. Pep-Calc.com: a set of web utilities for the calculation of peptide and peptoid properties and automatic mass spectral peak assignment. J Comput Aided Mol Des. 2016;30:271–277. doi: 10.1007/s10822-016-9902-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.McGuffin LJ, Bryson K, Jones DT. The PSIPRED protein structure prediction server. Bioinformatics. 2000;16:404–405. doi: 10.1093/bioinformatics/16.4.404. [DOI] [PubMed] [Google Scholar]
  • 37.Lamiable A, Thévenet P, Rey J, Vavrusa M, Derreumaux P, Tufféry P. PEP-FOLD3: faster de novo structure prediction for linear peptides in solution and in complex. Nucleic Acids Res. 2016;44:W449–W454. doi: 10.1093/nar/gkw329. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Thévenet P, Shen Y, Maupetit J, Guyon F, Derreumaux P, Tufféry P. PEP-FOLD: an updated de novo structure prediction server for both linear and disulfide bonded cyclic peptides. Nucleic Acids Res. 2012;40:W288–W293. doi: 10.1093/nar/gks419. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Colovos C, Yeates TO. Verification of protein structures: patterns of nonbonded atomic interactions. Protein Sci. 1993;2:1511–1519. doi: 10.1002/pro.5560020916. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Pontius J, Richelle J, Wodak SJ. Deviations from standard atomic volumes as a quality measure for protein crystal structures. J Mol Biol. 1996;264:121–136. doi: 10.1006/jmbi.1996.0628. [DOI] [PubMed] [Google Scholar]
  • 41.Laskowski RA, MacArthur MW, Moss DS, Thornton JM. PROCHECK: a program to check the stereochemical quality of protein structures. J Appl Crystallogr. 1993;26:283–291. doi: 10.1107/S0021889892009944. [DOI] [Google Scholar]
  • 42.Wiederstein M, Sippl MJ. ProSA-web: interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res. 2007;35:W407–W410. doi: 10.1093/nar/gkm290. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Vajda S, Yueh C, Beglov D, Bohnuud T, Scott E, Xia B, Hall DR, Kozakov D. New additions to the ClusPro server motivated by CAPRI. Proteins. 2018;85:435–444. doi: 10.1002/prot.25219.New. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Kozakov D, Hall DR, Xia B, Porter KA, Padhorny D, Yueh C, Beglov D, Vajda S, Biology Q. The ClusPro web server for protein-protein docking. Nat Protoc. 2017;12:255–278. doi: 10.1038/nprot.2016.169.The. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Kozakov D, Beglov D, Bohnuud T, Mottarella SE, Xia B, Hall DR, Vajda S. How good is automated protein docking? Proteins. 2013;81:2159–2166. doi: 10.1002/prot.24403.How. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Jo S, Kim T, Iyer VG, Im W. CHARMM-GUI: a web-based graphical user interface for CHARMM. J Comput Chem. 2008;29:1859–1865. doi: 10.1002/jcc.20945. [DOI] [PubMed] [Google Scholar]
  • 47.Kim S, Lee J, Jo S, Brooks CL, 3rd, Lee HS, Im W. CHARMM-GUI ligand reader and modeler for CHARMM force field generation of small molecules. J Comput Chem. 2017;38:1879–1886. doi: 10.1002/jcc.24829. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Jo S, Cheng X, Islam SM, Huang L, Rui H, Zhu A, Lee HS, Qi Y, Han W, Vanommeslaeghe K, MacKerell AD, Jr, Roux B, Im W. CHARMM-GUI PDB manipulator for advanced modeling and simulations of proteins containing nonstandard residues. Adv Protein Chem Struct Biol. 2014;96:235–265. doi: 10.1016/bs.apcsb.2014.06.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Pronk S, Páll S, Schulz R, Larsson P, Bjelkmar P, Apostolov R, Shirts MR, Smith JC, Kasson PM, van der Spoel D, Hess B, Lindahl E. GROMACS 4.5: a high-throughput and highly parallel open source molecular simulation toolkit. Bioinformatics. 2013;29:845–854. doi: 10.1093/bioinformatics/btt055. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Huang J, MacKerell AD., Jr CHARMM36 all-atom additive protein force field: validation based on comparison to NMR data. J Comput Chem. 2013;34:2135–2145. doi: 10.1002/jcc.23354. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51.Mark P, Nilsson L. Structure and dynamics of the TIP3P, SPC, and SPC/E water models at 298 K. J Phys Chem A. 2001;105:9954–9960. doi: 10.1021/jp003020w. [DOI] [Google Scholar]
  • 52.Piche SW. Steepest descent algorithms for neural network controllers and filters. IEEE Trans Neural Netw. 1994;5:198–212. doi: 10.1109/72.279185. [DOI] [PubMed] [Google Scholar]
  • 53.Knapp B, Frantal S, Cibena M, Schreiner W, Bauer P. Is an intuitive convergence definition of molecular dynamics simulations solely based on the root mean square deviation possible? J Comput Biol. 2011;18:997–1005. doi: 10.1089/cmb.2010.0237. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Jaiswal G, Kumar V. In-silico design of a potential inhibitor of SARS-CoV-2 S protein. PLoS One. 2020;15:e0240004. doi: 10.1371/journal.pone.0240004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Jaiswal G, Yaduvanshi S, Kumar V. A potential peptide inhibitor of SARS-CoV-2 S and human ACE2 complex. J Biomol Struct Dyn. 2021:1–11. 10.1080/07391102.2021.1889665. [DOI] [PMC free article] [PubMed]
  • 56.Kim S, Liu Y, Lei Z, Dicker J, Cao Y, Zhang XF, et al. Differential interactions between human ACE2 and spike RBD of SARS-CoV-2 variants of concern, BioRxiv Prepr. Serv Biol. 2021:2021.07.23.453598. 10.1101/2021.07.23.453598.
  • 57.Pitsillou E, Liang J, Huang HYM, Hung A, Karagiannis TC. In silico investigation to identify potential small molecule inhibitors of the RNA-dependent RNA polymerase (RdRp) nidovirus RdRp-associated nucleotidyltransferase domain. Chem Phys Lett. 2021;779:138889. doi: 10.1016/j.cplett.2021.138889. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Wang L, Wu Y, Yao S, Ge H, Zhu Y, Chen K, et al. Discovery of potential small molecular SARS-CoV-2 entry blockers targeting the spike protein. Acta Pharmacol Sin. 2021. 10.1038/s41401-021-00735-z. [DOI] [PMC free article] [PubMed]
  • 59.Heydari H, Golmohammadi R, Mirnejad R, Tebyanian H, Fasihi-Ramandi M, Moosazadeh Moghaddam M. Antiviral peptides against Coronaviridae family: a review. Peptides. 2021;139:170526. doi: 10.1016/j.peptides.2021.170526. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60.Mahendran ASK, Lim YS, Fang C-M, Loh H-S, Le CF. The potential of antiviral peptides as COVID-19 therapeutics. Front Pharmacol. 2020;11. 10.3389/fphar.2020.575444. [DOI] [PMC free article] [PubMed]
  • 61.Chowdhury SM, Talukder SA, Khan AM, Afrin N, Ali MA, Islam R, Parves R, Al Mamun A, Sufian MA, Hossain MN, Hossain MA, Halim MA. Antiviral peptides as promising therapeutics against SARS-CoV-2. J Phys Chem B. 2020;124:9785–9792. doi: 10.1021/acs.jpcb.0c05621. [DOI] [PubMed] [Google Scholar]
  • 62.Sakib MMH, Nishat AA, Islam MT, Raihan Uddin MA, Iqbal MS, Bin Hossen FF, Ahmed MI, Bashir MS, Hossain T, Tohura US, Saif SI, Jui NR, Alam M, Islam MA, Hasan MM, Sufian MA, Ali MA, Islam R, Hossain MA, Halim MA. Computational screening of 645 antiviral peptides against the receptor-binding domain of the spike protein in SARS-CoV-2. Comput Biol Med. 2021;136:104759. doi: 10.1016/j.compbiomed.2021.104759. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Ling R, Dai Y, Huang B, Huang W, Yu J, Lu X, Jiang Y. In silico design of antiviral peptides targeting the spike protein of SARS-CoV-2. Peptides. 2020;130:170328. doi: 10.1016/j.peptides.2020.170328. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Hollingsworth SA, Dror RO. Molecular dynamics simulation for all. Neuron. 2018;99:1129–1143. doi: 10.1016/j.neuron.2018.08.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Reva BA, Finkelstein AV, Skolnick J. What is the probability of a chance prediction of a protein structure with an rmsd of 6 å? Fold Des. 1998;3:141–147. doi: 10.1016/S1359-0278(98)00019-4. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

All data generated or analyzed during this study are included in this published article.


Articles from BMC Pharmacology & Toxicology are provided here courtesy of BMC

RESOURCES