Abstract
The expression of the corticotropin‐releasing hormone (PmCRH) and the CRH‐binding protein (PmCRHBP) mRNAs was studied by in situ hybridization in the brain of prolarvae, larvae, and adults of the sea lamprey Petromyzon marinus. We also generated an antibody against the PmCRH mature peptide to study the distribution of PmCRH‐immunoreactive cells and fibers. PmCRH immunohistochemistry was combined with antityrosine hydroxylase immunohistochemistry, PmCRHBP in situ hybridization, or neurobiotin transport from the spinal cord. The most numerous PmCRH‐expressing cells were observed in the magnocellular preoptic nucleus‐paraventricular nucleus and in the superior and medial rhombencephalic reticular formation. PmCRH expression was more extended in adults than in larvae, and some cell populations were mainly (olfactory bulb) or only (striatum, ventral hypothalamus, prethalamus) observed in adults. The preopto‐paraventricular fibers form conspicuous tracts coursing toward the neurohypophysis, but many immunoreactive fibers were also observed coursing in many other brain regions. Brain descending fibers in the spinal cord mainly come from cells located in the isthmus and in the medial rhombencephalic reticular nucleus. The distribution of PmCRHBP‐expressing neurons was different from that of PmCRH cells, with cells mainly present in the septum, striatum, preoptic region, tuberal hypothalamus, pretectum, pineal complex, isthmus, reticular formation, and spinal cord. Again, expression in adults was more extended than in larvae. PmCRH‐ and PmCRHBP‐expressing cells are different, excluding colocalization of these substances in the same neuron. Present findings reveal a complex CRH/CRHBP system in the brain of the oldest extant vertebrate group, the agnathans, which shows similarities but important divergences with that of mammals.
Keywords: brain distribution, CRH, CRH‐binding protein, development, immunohistochemistry, in situ hybridization, lamprey
We studied the expression of the corticortropin‐releasing hormone (CRH) transcript and mature peptide in the brain and spinal cord of sea lamprey prolarvae, larvae, and adults. We also studied the expression of the CRH binding protein transcript. Our data show that a complex CRHergic system is present in a representative of the oldest extant vertebrates.

Abbreviations
- ahr
anterior hypothalamic recess
- cc
central canal
- ch
optic chiasm
- chor
choroid plexus
- DC
dorsal column
- DCN
dorsal column nucleus
- DIG
dorsal isthmic grey
- dIs
dorsal region of isthmus
- dIsc
dorsal isthmic commissure
- dV
trigeminal descending nucleus
- fr
fasciculus retroflexus
- gl
glomerular layer of the olfactory bulb
- H
habenula
- Hy
hypothalamus
- igl
inner granular layer of OB
- III
third ventricle
- Ip
interpeduncular nucleus neuropil
- Is
isthmus
- IV
fourth ventricle
- IX
glossopharyngeal motor nucleus
- lH
left habenula
- LP
lateral pallium
- lt
lamina terminalis
- Ma
mammillary region
- Mes
mesencephalon
- mlf
medial longitudinal fascicle
- MP
medial pallium
- mPO
magnocellular preoptic nucleus
- MRRN
medial rhombencephalic reticular nucleus
- mV
trigeminal motor nucleus
- mv
mesencephalic ventricle
- n
notochord
- Nh
neurohypophysis
- Nmlf
nucleus of the medial longitudinal fascicle
- Npoc
nucleus of the postoptic commissure
- NPt
nucleus of the posterior tubercle
- OB
olfactory bulb
- OLA
octavolateralis area
- OT
optic tectum
- P
pineal organ
- pc
posterior commissure
- PEN
posterior entopeduncular nucleus
- PO
medial preoptic nucleus
- poc
postoptic commissure
- PP
parapineal organ
- PRRN
posterior rhombencephalic reticular nucleus
- Pt
pretectum
- Pth
prethalamus (ventral thalamus)
- PTu
posterior tubercle
- PV
paraventricular nucleus
- rH
right habenula
- Rho
rhombencephalon
- SC
spinal cord
- Se
septum
- SH
subhippocampal lobe
- SRRN
superior rhombencephalic reticular nucleus
- St
striatum
- Teg
mesencephalic tegmentum
- Th
thalamus (dorsal thalamus)
- TS
torus semicircularis
- Tu
tuberal nucleus
- v
ventricle
- VII
facial motor nucleus
- vIs
ventral region of isthmus
- vTu
ventral tuberal nucleus
1. INTRODUCTION
Corticotropin‐releasing hormone (CRH), also known as corticotropin‐releasing factor (CRF), is a neuropeptide consisting of 41 amino acids that was first purified from sheep hypothalamus (Vale et al., 1981). CRH is involved in stress response as the major regulator of the hypothalamo‐pituitary‐adrenal stress axis (Ketchesin, Stinnett, et al., 2017; Yuan et al., 2019). In nonmammalian vertebrates, CRH also has a potent thyrotrophic function (see De Groef et al., 2006). In addition to its role as a neurohormone, CRH has widespread roles within the brain as a neuropeptide involved in various functions (e.g., memory enhancement: Todorovic et al., 2005; anxiogenic and antinociceptive effects: Miguel & Nunes‐de‐Souza, 2011; stress control: Bale et al., 2000; Fox & Lowry, 2013; Yuan et al., 2019). CRH actions at synapses are mediated by CRH receptors and the CRH‐binding protein (CRHBP), which are necessary for the transduction of the perception of stressful environmental situations into survival‐based physiology and behavior (Behan et al., 1996; Jaferi & Bhatnagar, 2007; Ketchesin, Stinnett, et al., 2017). CRHBP is a secreted glycoprotein (with no hydrophobic transmembrane regions) that binds CRH with sub‐nanomolar affinity playing a main role in limiting CRH bioavailability and reducing CRH receptor activation (see Ketchesin, Stinnett, et al., 2017).
The CRH system possibly appeared early in metazoan evolution because homologous CRH‐like peptides, CRH receptors and the CRHBP have been found both in invertebrates and vertebrates (see Cai et al., 2021; Lovejoy & Lannoy, 2013). In vertebrates, the CRH‐family genes are widely distributed along the nervous system in all studied species (Cardoso et al., 2016, 2020). Initial studies in the sea lamprey Petromyzon marinus revealed the existence of a CRH system with three CRH family members (named CRH, urotensin I [UI] and urocortin 3 [Ucn3]), two types of CRH receptors (named alpha and beta), and a single CRHBP (Endsin, 2013; Endsin et al., 2017). These authors showed, by using polymerase chain reaction (PCR) methods, that all the components of a functional CRH system are expressed in the sea lamprey brain, and that these genes are regulated in response to stress, suggesting that a hypothalamo‐pituitary‐interrenal axis is functional in lampreys. More recently, Cardoso et al. (2020) reported the presence of five CRH‐family members in the sea lamprey (named CRH/UCNa [corresponds to CRH of Endsin et al., 2017], CRH/UCNb [corresponds to UI of Endsin et al., 2017], CRH/UCNc, UCNa [corresponds to Ucn3 of Endsin et al., 2017 and Sobrido‐Cameán, Anadón, et al., 2021], and UCNb). Although Cardoso et al. (2020) could not infer clear orthology relationships with all gnathostome members of the CRH family in their phylogenetic and synteny analyses, CRH of Endsin et al. (2017)/CRH/UCNa of Cardoso et al. (2020) corresponds to the gnathostome CRH1 (Cardoso et al., 2020; Endsin et al., 2017). The pattern of expression of Ucn3 (UCNa of Cardoso et al., 2020) in the sea lamprey brain was recently reported by means of in situ hybridization (ISH) by our group (Sobrido‐Cameán, Anadón, et al., 2021), but the brain/spinal cord distribution of the other members of the CRH system is not known.
Lampreys are interesting for comparative studies due to the position they occupy in the vertebrate phylogeny, the lamprey lineage together with myxines (hagfishes) belongs to the agnatha, the sister out‐group of gnathostomes (Delarbre et al., 2002; Forey & Janvier, 1993; Furlong & Holland, 2002; Kuratani & Ota, 2008; Murakami et al., 2005). The brain of lampreys exhibits the basic cell types, regions, and structures of the vertebrate brain (Lamanna et al., 2022; Murakami & Kuratani, 2008). Research on the nervous, endocrine, and immune systems of lampreys has significance for revealing the origin and evolution of these systems, to infer the ancestral organization of the brain in vertebrates and could also contribute to a better understanding of human diseases and treatments (see Barreiro‐Iglesias & Rodicio, 2012; Sobrido‐Cameán & Barreiro‐Iglesias, 2022). Here, we studied by ISH the expression of the P. marinus CRH (Endsin et al., 2017; in the following named PmCRH) and CRHBP (Endsin et al., 2017; PmCRHBP) mRNAs in the brain/spinal cord of sea lampreys at different life stages, as well as the distribution of neurons and fibers expressing the mature PmCRH peptide by immunohistochemistry, to better understand the development and organization of the CRH system in a jawless vertebrate.
2. MATERIALS AND METHODS
2.1. Animals
Prolarvae (n = 15), larvae (n = 20), downstream migrating young adults (postmetamorphic juveniles; n = 6), and upstream migrating adults (n = 8) of sea lampreys, P. marinus L., were used for this study (see Table 1 for details of the animals used in each experiment). As indicated in Table 1, brains/spinal cords from some animals were sectioned in parallel series to process each series for a different labeling. Prolarvae were obtained from in vitro fertilized eggs reared in our laboratory (their ages are indicated as days posthatching). Downstream migrating juveniles (young adults) and larvae (ammocoete; lengths comprised between 80 and 110 mm, 4–7 years old) were collected from the River Ulla (Galicia, Spain) with permission from the Xunta de Galicia. Upstream migrating adults were acquired from local suppliers. Adults/juveniles were fixed immediately upon arrival to the laboratory, and larvae were maintained in aquaria containing river sediment and with appropriate feeding, aeration, and temperature conditions until the day of use. Before all experiments, animals were deeply anesthetized with 0.1% tricaine methanesulfonate (MS‐222; Sigma–Aldrich, St. Louis, MO, USA) in fresh water and killed by decapitation. All experiments were approved by the Bioethics Committee at the University of Santiago de Compostela and the Xunta de Galicia (project reference 15012/2020/011) and were performed in accordance with European Union and Spanish guidelines on animal care and experimentation.
TABLE 1.
Animals used in each of the experiments. In some cases, serial sections from the same animal (color coded) were used for different experiments
|
2.2. Cloning and sequencing of the PmCRH and PmCRHBP precursor cDNAs
Larvae were anesthetized by immersion in MS‐222 (Sigma; see above), and the brain and spinal cord were dissected out under sterile conditions. Total RNA was isolated from these tissues using the TriPure reagent (Roche, Mannhein, Germany). The first‐strand cDNA synthesis reaction from total RNA was catalyzed with Superscript III reverse transcriptase (Invitrogen, Waltham, MA, USA) using random primers (hexamers; Invitrogen). For PCR cloning, specific oligonucleotide primers (forward: 5′‐CCACCAGCCTTCTCGTCCTC‐3′; reverse: 5′‐CCGATGCTCGTTCTCCTCGT‐3′) were designed based on the PmCRH precursor cDNA sequence that is deposited in GenBank with accession number KX446863.1 (Endsin et al., 2017); and specific oligonucleotide primers (forward: 5′‐GCTGGAGCTGTTGACGATGC‐3′; reverse: 5′‐ CTCGGGGCTAGAAGGGAACG‐3′) were designed based on the putative PmCRHBP cDNA sequence that is deposited in GenBank with accession number KX446865.1 (Endsin et al., 2017). The amplified fragments were cloned into pGEM‐T easy vectors (Promega, Madison, WI, USA) using standard protocols and sequenced by GATC Biotech (Cologne, Germany). Sequencing confirmed that we cloned fragments (PmCRH: 305 bp; PmCRHBP: 341 bp) of the same sequences deposited in GenBank by Endsin et al. (2017).
2.3. In situ hybridization
Templates for in vitro transcription were prepared by PCR amplification as follows. A fragment of the PmCRH and PmCRHBP precursor sequence was obtained using the primers mentioned above. But in this case, the reverse primer included the sequence of the universal T7 promoter (TAAGCTTTAATACGACTCACTATAGGGAGA). For the generation of sense probes, the sequence of the T7 promoter was included in the forward primers. Digoxigenin (DIG)‐labeled riboprobes were synthesized using the amplified fragments as templates and following standard protocols using a T7 polymerase (Nzytech, Lisbon, Portugal).
ISH experiments were performed as previously described for other neuropeptide riboprobes (Sobrido‐Cameán et al., 2019; Sobrido‐Cameán, Yáñez‐Guerra, et al., 2020; Sobrido‐Cameán, Anadón, et al., 2021; Sobrido‐Cameán, Yáñez‐Guerra, Deber, Rodicio, et al., 2021). Briefly, whole prolarvae or the brains/rostral spinal cords of larvae and young and mature adults were dissected out and fixed by immersion for 12 h in 4% paraformaldehyde (PFA) in phosphate‐buffered saline (PBS) at 4°C. Then, they were cryoprotected with 30% sucrose in PBS, embedded in Tissue Tek (Sakura, Torrance, CA, USA), frozen in liquid nitrogen‐cooled isopentane, and cut serially on a cryostat (14 µm thickness) in transverse planes. Sections were mounted on Superfrost® Plus glass slides (Menzel, Braunschweig, Germany). The sections were incubated with DIG‐labeled antisense riboprobes (1 µg/ml) at 70°C overnight in hybridization mix and treated with RNase A (Sigma) in posthybridization washes. Then, the sections were incubated with a sheep anti‐DIG antibody conjugated to alkaline phosphatase (1:2000; Roche) overnight at 4°C. Staining was conducted in BM Purple (Roche) at 37°C until the signal was clearly visible. Finally, the sections were mounted in Mowiol® (Sigma). No staining was observed when incubating brain sections with sense probes.
2.4. Generation of a novel anti‐PmCRH antibody
A modified mature PmCRH peptide (CSDEPPISLDLTFHLLREVLEMAKAEQLAQQAHTNRQIMENI‐NH2) with the addition of a cysteine residue to the N‐terminus was synthesized by Biomedal (Sevilla, Spain) to enable coupling to key limpet hemocyanin (KLH). A rabbit (8 weeks old, New Zealand White) was first immunized subcutaneously with the peptide‐KLH conjugate (400 mg) emulsified in Freund's complete adjuvant. After 4 weeks, the rabbit was immunized once weekly for 2 weeks by intramuscular injection of the peptide‐KLH conjugate (200 mg) emulsified in Freund's complete adjuvant. Pre‐immune (negative control with no anti‐PmCRH antibodies present) and postimmunization bleeds were collected. Note that 2.5 ml of antiserum from the final bleed was purified using a protein A‐Sepharose column (GE Healthcare, Little Chalfont, UK), and the purified antibodies were used for the immunohistochemical analyses. Antibody information was deposited in the Antibody Registry database (www.antibodyregistry.org) with RRID number AB_2923134.
2.5. Tissue processing for immunohistochemistry
For immunohistochemistry, the whole prolarvae or brains/spinal cords of larvae and juveniles and adults were fixed by immersion in 4% PFA in 0.05 M Tris‐buffered saline pH 7.4 (TBS) for 4–12 h at 4°C. The samples were then rinsed in TBS, cryoprotected with 30% sucrose in TBS, embedded in Tissue Tek (Sakura), frozen in liquid nitrogen‐cooled isopentane, and cut serially on a cryostat (14–20 µm thickness) in transverse planes. Sections were mounted on Superfrost® Plus glass slides (Menzel).
2.6. PmCRH and TH double immunofluorescence experiments
Some samples were incubated with the purified rabbit polyclonal anti‐PmCRH antibody (dilution 1:1500) at 4°C for 72 h. Other samples were processed for double immunofluorescence experiments using a cocktail of a mouse monoclonal antityrosine hydroxylase (TH) antibody (dilution 1:1000; Millipore, Temecula, CA, USA; Cat# MAB318; lot 0509010596; RRID: AB_2201528; immunogen: TH purified from PC12 cells) in combination with the anti‐PmCRH antibody. Primary antibodies were diluted in TBS containing 15% normal goat serum and 0.2% Triton as detergent.
For double detection of PmCRH and TH by indirect immunofluorescence, the sections were rinsed in TBS and incubated for 1 h at room temperature with a cocktail of Cy3‐conjugated goat anti‐rabbit (1:200; Millipore; Cat# AP132C; RRID:AB_92489) and FITC‐conjugated goat anti‐mouse (1:100; Millipore; Cat# AQ303F; RRID:AB_92818) antibodies. Sections were rinsed in TBS and distilled water and mounted with Mowiol® (Sigma).
2.7. Double in situ hybridization and immunohistochemistry
In some samples, ISH for PmCRHBP was followed by immunohistochemistry against PmCRH. These experiments were performed as described in a previous study (Sobrido‐Cameán, Tostivint, et al., 2020). Briefly, after the ISH signal was clearly visible, sections were rinsed twice in TBS and treated with 10% H2O2 in TBS for 30 min. For heat‐induced epitope retrieval, sections were treated with 0.01 M citrate buffer (pH 6.0) for 30 min at 90°C and allowed to cool for 20 min at room temperature (RT). Then, the sections were incubated with the anti‐PmCRH primary antibody solution (same as above) overnight at RT. After rinsing in TBS, the sections were incubated with the solution containing the secondary antibody, goat anti‐rabbit IgG serum, conjugated with HRP (Dako, Glostrup, Denmark; Cat# P0448, RRID: AB_2617138, dilution 1:200) for 1 h at RT. The immunoreaction was developed with 0.25 mg/ml diaminobenzidine tetrahydrochloride (DAB; Sigma) containing 0.00075% H2O2. Finally, the sections were mounted in Mowiol® (Sigma).
2.8. Antibody characterization
The antiserum and the purified fraction of anti‐PmCRH antibody were tested for specificity with an enzyme‐linked immunosorbent assay (ELISA) using standard methods. The antiserum, the purified antibody (at concentrations from 1:1000 to 1:100000), and the pre‐immune serum (1:1000) were tested against the synthetic PmCRH peptide without KLH (at a concentration of 1 mM) in the ELISA. Both the antiserum and the purified fraction gave a positive signal at all the tested concentrations, while the very low signal registered with the pre‐immune serum was the same as the one obtained in the negative controls with PBS only. Since the pattern of PmCRH‐immunoreactive (‐ir) neuronal populations in the central nervous system (CNS) matches the pattern of PmCRH transcript expressing populations seen by ISH (Section 3), it further supports the specificity of the antibody for this peptide.
The specificity of the anti‐TH antibody was tested by the supplier. The anti‐TH antibody was also tested in western blots of sea lamprey and rat brain protein extracts in our laboratory, which revealed bands of similar size for the sea lamprey and rat TH enzymes (Barreiro‐Iglesias, Villar‐Cerviño, Villar‐Cheda, et al., 2008). This antibody has been used in many immunohistochemical studies of lamprey brain and retina (Barreiro‐Iglesias, Anadón, et al., 2010; Barreiro‐Iglesias et al., 2017; Pierre et al., 1997; Villar‐Cerviño et al., 2006).
As a general control for the secondary antibodies, some sections were processed as above, except that the primary antiserum was omitted. No staining was observed in these controls.
2.9. Retrograde tract‐tracing study of spinal cord‐projecting PmCRH‐ir neurons
The origin of PmCRH‐ir fibers observed in the spinal cord was investigated by neuronal tract tracing combined with immunofluorescence. Tract‐tracing experiments were performed in larval samples to label descending neurons that innervate the spinal cord. Neurobiotin (MW 322.8 Da; Vector, Burlingame, CA, USA) was used as a tracer. The larval spinal cord was exposed by a longitudinal incision made in the dorsal region of the body at the level of the fifth gill and completely cut with Castroviejo scissors. The tracer was applied in the rostral stump of the transected spinal cord with the aid of a minute pin (#000). The animals were allowed to recover at 19.5°C with appropriate aeration conditions for 7 days to allow transport of the tracer from the application point to the neuronal soma of descending neurons. Brains of these larvae were fixed with 4% PFA and processed for PmCRH immunofluorescence as above. After the immunofluorescence protocol, the sections were incubated at room temperature with Avidin D‐FITC conjugated (dilution 1:1000; Vector; Cat#: A‐2001) diluted in TBS containing 0.3% Triton X‐100 for 4 h to reveal the presence of neurobiotin. Slides were rinsed in TBS and distilled water and mounted with Mowiol® (Sigma).
2.10. Nuclear counterstain
Nuclear counterstain was carried out after the immunofluorescence procedure by immersing the slides in 0.5 µg/ml bisbenzimide (Sigma) in TBS for 10 s before mounting.
2.11. Image acquisition and montage
Confocal photomicrographs were taken with a TCS‐SP2 spectral confocal laser microscope (Leica Microsystems, Wetzlar, Germany). Data were acquired by use of appropriate laser lines and narrow spectral windows tuned to the specific absorption and emission wavelengths of each fluorescent marker (bisbenzimide, FITC or Cy3). Confocal projections of stacks were done with the LAF suite (Leica) or with ImageJ (Schneider et al., 2012). Fluorescence and bright‐field photomicrographs were obtained with an AX70 epifluorescence microscope equipped with a DP70 digital camera (Olympus, Tokyo, Japan). Plates of photomicrographs and minimal bright/contrast adjustments were done with Photoshop 2021 (Adobe, San Jose, CA, USA). Schematic drawings were done with CorelDraw 2019 (Corel, Ottawa, Canada).
3. RESULTS
3.1. Distribution of CRHergic cell populations in the brain of sea lampreys
We studied the distribution of CRHergic cell populations in the brain and spinal cord of the sea lamprey using specific anti‐PmCRH riboprobes for ISH and antibodies against the mature PmCRH peptide for immunofluorescence. Both ISH and immunohistochemistry revealed similar PmCRH‐expressing populations distributed along the brain. The most conspicuous PmCRH‐expressing populations were observed in the preoptic region and isthmus, whereas in other brain regions positive cells were much more restricted. Combination of ISH or immunochemistry for PmCRH and TH immunohistochemistry was also used to better define preoptic and hypothalamic PmCRH positive populations. With immunohistochemistry, PmCRH‐ir fibers were observed in most brain regions although at different densities, extending also in the spinal cord. The cells of origin of spinal PmCRH‐ir brain descending fibers were studied by combining tract‐tracing from the spinal cord (at the level of the 5th gill opening) with PmCRH immunohistochemistry.
Schematic drawings of transverse sections of brains of adults and larvae based on PmCRH ISH results are presented in Figures 1 and 2. Photomicrographs of sections of adult brains processed by PmCRH ISH and PmCRH immunohistochemistry are presented in Figures 3, 4 and Figure 5, respectively. Photomicrographs of double labeling with PmCRH ISH and TH immunohistochemistry or PmCRHBP ISH and PmCRH immunohistochemistry are presented in Figure 6. Photomicrographs of sections of larval brains processed for PmCRH ISH and PmCRH immunohistochemistry are presented in Figure 7 and Figure 8, respectively. Photomicrographs of sections of adult and larval spinal cords processed for PmCRH immunohistochemistry are presented in Figure 9. Figure 10 shows photomicrographs of sections of prolarval heads processed for PmCRH ISH, PmCRHBP ISH, or PmCRH immunohistochemistry. The distribution of PmCRH‐expressing cells projecting to the spinal cord is presented in Figure 11. The terminology employed in this study for the various regions, nuclei, tracts, and identified neurons followed those used in other studies of lamprey neuropeptides of our group (see Sobrido‐Cameán et al., 2019; Sobrido‐Cameán, Yáñez‐Guerra, et al., 2020; Sobrido‐Cameán, Anadón, et al., 2021). Since the same positive populations found by PmCRH ISH were also observed by PmCRH immunofluorescence, we assumed that the antibody recognized only this PmCRH peptide. We named the cells showing the PmCRH mRNA and the PmCRH peptide as PmCRH‐expressing cells. However, the possibility that the anti‐PmCRH antibody may cross‐react with other related members of the CRH‐family peptides (e.g., CRH/UCNb of Cardoso et al., 2020) cannot be ruled out. As expected, immunohistochemistry provided additional information on the cell shape and revealed the pattern of innervation of the hypophysis and brain by PmCRH‐ir fibers.
FIGURE 1.

Schematic drawings of transverse sections of the adult sea lamprey brain showing the distribution of PmCRH‐expressing neurons revealed by ISH (at the right) and the anatomical references (at the left). The levels of sections are indicated in the figurine of the lateral view of the adult brain. Outline boxes indicate the approximate location of photomicrographs shown in Figures 3 and 4. For abbreviations, see the list. Scale bars, 200 µm (a‐l), 1 mm (figurine)
FIGURE 2.

Schematic drawings of transverse sections of the brain of a larval sea lamprey showing the distribution of PmCRH‐expressing neurons revealed by ISH (at the right) and the anatomical references (at the left). The levels of sections are indicated in the figurines of the lateral view of the brains. For abbreviations, see the list. Scale bars, 200 µm
FIGURE 3.

Photomicrographs of transverse sections of the forebrain of a young adult (postmetamorphic) sea lamprey showing the expression of PmCRH mRNA in neurons by ISH. (a) Groups of PmCRH‐expressing neurons in the olfactory bulb located near the glomerular layer. (b–d) Sections through the ventral telencephalon and preoptic region showing high expression in neurons of the mPO nucleus and positive neurons scattered in the striatum. (e) Section showing positive neurons in the paraventricular nucleus, which is continuous with the mPO. (f and g) Sections showing positive neurons in the posterior entopeduncular nucleus. (h) Section showing positive neurons in the ventral portion of the tuberal nucleus rostral to the neurohypophysis. (i) Section through the rostral pretectum showing a compact group of positive cells located in a central region (outlined arrow). (j) Section through the caudal diencephalon showing a group of positive neurons in the nucleus of the medial longitudinal fascicle (outlined arrow). For abbreviations, see the list. Scale bars, 50 µm
FIGURE 4.

Photomicrographs of transverse sections of the hindbrain and spinal cord of a young adult sea lamprey showing the expression of PmCRH mRNA in neurons by ISH. (a–d) Sections through the isthmus and details showing groups of large PmCRH‐expressing neurons in the dorsal region (outlined arrows) and small neurons in the ventral region (arrows in c and d). The asterisk in (d) indicates a small portion of the giant isthmic neuron I1. (e and f) Sections at the level of entrance of the trigeminal nerve (asterisk in e) and the trigeminal motor nucleus (mV in f) showing positive neurons (outlined arrows) in lateral and medial reticular regions, respectively. (g) Section showing positive neurons (outlined arrow) in the octavolateralis region at the level of the glossopharyngeal motor nucleus (asterisk). (h and i) Sections showing positive neurons in the medial rhombencephalic reticular nucleus at rostral and caudal levels, respectively. Asterisks, giant axons of the medial longitudinal fascicle. (j and k) Section and detail showing a positive neuron (arrows) in the rostral spinal cord. Asterisk in (j), medial longitudinal fascicle. For abbreviations, see the list. Scale bars, 50 µm (b, d–j), 125 µm (a and c), 12.5 µm (k)
FIGURE 5.

Fluorescent photomicrographs of selected sections of the brain of an adult sea lamprey showing PmCRH‐ir cells and fibers. (a and b) Photomicrograph, and detail, of the mPO nucleus. Arrow points to medial dendrites. (c) Section showing neurons in the paraventricular nucleus (arrow) and the projection towards the hypophysis (angled arrow). (d) Section through the ventral tuberal region showing small positive neurons (arrow). (e) Section showing a scattered group of neurons in the posterior entopeduncular nucleus/prethalamus region (arrows) and numerous fibers. (f and g) Sections through the pretectum showing a compact group of cells (arrows) in the central region. (h) Section through the optic tectum showing PmCRH‐ir fibers in its inner half. (i) Section through the dorsal limit between the midbrain and hindbrain showing numerous positive fibers in the dorsal isthmic commissure. (j) Section though the group of large positive neurons (arrow) in the dorsal isthmus near the giant isthmic cell. (k) Section through the ventral isthmus showing abundant positive fibers except in the interpeduncular nucleus neuropil. (l) Section of the hindbrain tegmentum showing many positive fibers near the midline caudal to the interpeduncular nucleus. (m) Section of the rostral spinal cord showing a positive neuron (arrow) and low density of positive fibers. (f) is a confocal photomicrograph with a blue nuclear contrast. In (a), (d), and (j) medial is at the right, in (c), (e), (f), and (h) medial is at the left. For abbreviations, see the list. Scale bars, 50 µm (a, c, d, e, f, h, i, j, k, l, m), 25 µm (b, g)
FIGURE 6.

(a and b) Photomicrographs of transverse sections of the forebrain of a young adult sea lamprey showing the different distribution of neurons expressing PmCRH mRNA (labeled in blue) in the preoptic‐paraventricular region (a and b) and TH immunoreactivity (in brown) in the ventral preoptic region (a) and nucleus of the postoptic commissure (b). (c and d) Sections through the preoptic region and hypothalamus showing the different distribution of neurons expressing PmCRHBP mRNA (in blue) and CRH immunoreactivity (in brown). Open arrows point to the ventricular surface. For abbreviations, see the list. Scale bars, 50 µm
FIGURE 7.

Photomicrographs of transverse sections of the brain of a lamprey larva (100 mm long) showing the distribution of PmCRH‐expressing neurons by ISH. (a) Section of the left olfactory bulb (OB) showing some positive neurons in the medial glomerular region. Inset, detail of cells. (b and c) Sections of the forebrain showing positive neurons in the mPO nucleus. (d) Section showing positive neurons in the paraventricular nucleus (outlined arrow). (e) Section at the level of rostral pretectum showing a group of positive neurons near the meningeal surface (outlined arrow). Inset, detail of these pretectal cells. (f) Section at the level of the nucleus of the medial longitudinal fascicle showing positive neuron (outlined arrow). Inset, detail of these cells. (g and h) Sections of the isthmus at rostral (g) and caudal (h) levels showing positive cells in the superior rhombencephalic reticular nucleus (outlined arrows). (i) Section at the level of the facial motor nucleus showing scarce positive neurons (outlined arrow) in the medial rhombencephalic reticular nucleus. For abbreviations, see the list. Scale bars, 50 µm
FIGURE 8.

Fluorescence photomicrographs of transverse sections of the larval brain showing the distribution of cells and fibers immunoreactive for PmCRH. (a–c) Sections of the mPO nucleus at rostral and a more caudal level showing cell bodies (arrows) and the fiber tract (angled arrow) coursing toward the neurohypophysis. In inset, note medial processes (arrow) of positive neurons. (d) Section through the paraventricular nucleus and rostral neurohypophysis. (e) Confocal photomicrograph of a section through the hypothalamus showing accumulation of immunoreactive fibers in the posterior neurohypophysis. Note the scant fibers in the hypothalamus. In blue, nuclear contrast. (f) Section through the diencephalon showing immunoreactive cells (arrow) in the nucleus of the medial longitudinal fascicle and many positive fibers. (g) Section through the midbrain showing abundant PmCRH‐ir fibers in the tegmentum and torus semicircularis. (h) Section through the caudal hindbrain showing abundant fibers in basal regions but scant PmCRH‐ir fibers in the alar region (dV and DCN). (i) Section through the rostral spinal cord showing abundant PmCRH‐ir fibers and a PmCRH‐ir neuron (arrow). For abbreviations, see the list. Scale bars, 50 µm (a, b, d, e, f, g, h) 25 µm (c and i)
FIGURE 9.

Photomicrographs of transverse sections of the spinal cord (only 1 half of the cord is shown) of adult (a and b) and larval (c and d) sea lampreys at different spinal cord levels (5th gill: a and c; caudal spinal cord: b and d). Note that the dorsal column shows almost no PmCRH‐ir fibers and that most of them are located in the lateral portion of the spinal cord (arrows). The central canal (cc) is always to the left. Figures a–d have been converted to B&W from red fluorescence to facilitate visualization. Scale bars, 150 µm (a), 75 µm (b, c, d)
FIGURE 10.

Photomicrographs of transverse sections of lamprey prolarvae showing the distribution of neurons expressing PmCRH mRNA (a–c) and PmCRH immunoreactivity (d–f). (a) Section through the forebrain of a P25 prolarvae showing a group of PmCRH positive neurons in the primordium of the mPO/paraventricular nucleus dorsal to the postoptic commissure. (b and c) Sections of the hindbrain of a P25 prolarvae showing groups of positive neurons in the dorsal isthmus (b) and ventral region caudal to the otic vesicle (c). Note the notochord (n) at these levels. (d) Section of the caudal forebrain of a P30 prolarvae at the level of the eyes showing PmCRH‐immunoreactive neurons in the mantle layer (Nmlf, outlined arrow) and numerous positive fibers in the marginal layer neuropil. Note also intense immunoreactivity in the primordium of the neurohypophysis (Nh). Angled arrows point to the pigment cell layer of the retina, which is close to the brain surface. (e) Section at the level of the isthmus of a P30 prolarvae showing large PmCRH‐ir dorsal neurons (arrows) and smaller and paler ventral neurons (arrowheads). Note also abundant fibers in the marginal layer. (f) Section through the spinal cord of a P30 prolarvae showing abundant PmCRH‐ir fibers in the marginal layer. Figures d–f have been converted to B&W from red fluorescence to facilitate visualization. For abbreviations, see the list. Scale bars, 50 µm (a, b. c), 25 µm (d, e, f)
FIGURE 11.

Photomicrographs showing PmCRH‐ir neurons in the rhombencephalon retrogradely labeled after injection of neurobiotin in the spinal cord. (a and b) Cells in the superior rhombencephalic reticular formation (isthmus) double‐labeled for PmCRH and neurobiotin (arrows), axons of giant neurons labeled with neurobiotin (angled arrows), and PmCRH‐ir cells (arrowheads). Insets (a’, a’’, b’ and b’’), detail of double labeled cells in single channels (red, PmCRH; green: neurobiotin). Asterisk in b‐b’ indicates a dendrite of a giant isthmic neuron. (c and d) Double‐labeled neurons (arrows) in the middle rhombencephalic reticular formation among numerous perikarya and axons (angled arrows) of neurobiotin‐labeled reticulospinal cells. Insets (c’, c’’, d’, d’’), single channel details of double labeled cells. Red channel, PmCRH; green channel: neurobiotin. For abbreviations, see the list
3.1.1. Adult and juvenile lampreys
Olfactory bulbs
In the olfactory bulbs, both in postmetamorphic juveniles and upstream migrating adults, PmCRH‐expressing cells are scattered or in small groups in the granular layer close the glomerular layer (Figures 1a and 3a). These cells are small or medium sized, but the specific cell type could not be determined. The topographical relation of these groups with glomeruli varied around the bulb, some glomeruli showing associated conspicuous PmCRH‐expressing populations and other glomeruli lacking them or showing scarce positive cells.
Telencephalic lobes
In the telencephalic lobes of postmetamorphic juveniles and upstream migrating adults, a band of PmCRH‐expressing cells was observed extending between the lateral part of the striatum and the ventral region of the pallium, away from the ventricle (Figures 1b,c and 3b,c). These cells do not occupy the dense band of striatal neurons but lie externally to it (for a characterization of the lamprey striatum, see Pombal et al., 1997).
Preoptic region and hypothalamus
The most conspicuous PmCRH‐expressing population in juvenile/adult lampreys was observed in the preoptic region. A large group of PmCRH‐expressing cells with high staining intensity by ISH and immunofluorescence was observed in the magnocellular preoptic nucleus (mPO) (Figures 1, 3, and 5a,b), whereas the medial preoptic nucleus that separates it from the PmCRH‐expressing striatal population lacks PmCRH‐expressing cells. The band of PmCRH‐expressing mPO cells extends from the dorsolateral (caudal) zone to the medial wall of the preoptic recess forming a dense population. Most cells are in a cell band separated by a layer of neuropil from the subependymal cells, which only shows scarce PmCRH‐expressing cells. Combination with TH immunohistochemistry reveals that TH‐ir neurons and PmCRH‐expressing cells occupy ventral and dorsal locations in the wall of lateral preoptic recesses, respectively, without intermixing (Figure 6a). PmCRH immunohistochemistry reveals that the labeled mPO cells send lateral processes that extend to the hypothalamus ventrocaudally toward the neurohypophysis (Figure 5a,b). In addition, these cells (or at least a part of them) send a medial process toward the surface of the preoptic recess (Figure 5a,b). The band of PmCRH‐expressing mPO cells extends caudally from the dorsal region of the preoptic recess to the paraventricular nucleus (Figures 1, 3, 6b, and 5c), which shows cells, like those of the mPO, also sending medial processes toward the ventricle and ventrolateral processes to the same lateroventral hypothalamic fiber region. The conspicuous band of PmCRH‐ir axons coursed through the ventrolateral hypothalamus, which showed a high density of these fibers (Figure 5c).
In the hypothalamus, small PmCRH‐expressing cells were also observed in the ventral tuberal nucleus rostral to the neurohypophysis (Figures 1, 3, and 5d). These small cells are scattered near the ventricle.
Diencephalon
The lamprey diencephalon is composed of three prosomeres (p1–p3; Pombal & Puelles, 1999). In the diencephalon, a band of PmCRH‐expressing cells were scattered in the ventral (anterior) region of the prethalamus (p3)/posterior entopeduncular nucleus (Figures 1, 3, and 5e), with some cells near or accompanying the hypothalamic paraventricular organ. This PmCRH‐expressing population does not extend caudally till the conspicuous dopaminergic nucleus of the posterior tubercle (as seen with combined TH immunohistochemistry, not shown). The location of cells of this population in the hypothalamus or prethalamus is difficult to assess, since they are intermingled with most dorsal TH‐ir CSF‐contacting cells of the paraventricular organ (hypothalamic), but some cells are in the thick cell layers typical of the prethalamus, just lateral to the paraventricular organ, or widely scattered in the neuropil lateral to it forming a loose population. The location of these scattered cells may correspond in part to the posterior entopeduncular area or posterior hypothalamus of Pombal and Puelles (1999).
In the pretectum (alar p1) of juveniles and adults, a small compact group of PmCRH‐expressing cells was observed in a dorsocentral region of neuropil and cells (Figures 1, 3, and 5f,g). The location of this PmCRH‐expressing group is like that of a group of pretectal cells that projects to the habenula and parapineal ganglion reported with tracing methods (Section 4), but the possible identity will need to be assessed experimentally. Some PmCRH‐expressing small neurons were also observed in the basal region of p1 (nucleus of the medial longitudinal fascicle) (Figures 1g and 3j).
Rhombencephalon
In the rhombencephalon (hindbrain), the most conspicuous PmCRH‐expressing cells were observed in the isthmus (Figures 1, 4, and 5j), but sparser populations of PmCRH‐expressing reticular neurons were observed along almost the entire hindbrain (Figures 1j,k and 4e–i). In the isthmus, a group of large or medium‐sized neurons strongly expressing PmCRH was observed close to the giant Müller isthmic cell (also called I1 cell) (Figures 1i and 4a–d). More ventrally, some small positive cells were also observed (Figure 4c,d). The difference in size of dorsal and ventral cells was remarkable (Figures 4c,d). From just caudal to the trigeminal motor nucleus, a scattered population of PmCRH‐expressing neurons was observed along most of the hindbrain medial to visceromotor nuclei or in the medial reticular region (Figures 1j,k and 4e–i). These PmCRH‐expressing neurons were small or medium‐sized.
Spinal cord
Only occasional PmCRH‐expressing cells were observed in the rostral spinal cord, close to the obex (Figures 1, 4, and 5m). No PmCRH cells were observed at more caudal spinal cord levels (at the level of the 5th gill, midbody region or most caudal spinal cord; Figure 9a,b).
3.1.2. Larval and prolarval lampreys
Telencephalon
The larval telencephalon was almost devoid of PmCRH‐expressing cells. In the olfactory bulbs of larvae of about 100 mm in length (3–4 years old), a few PmCRH‐expressing cells were observed associated with medial glomeruli, with other bulbar regions lacking such cells (Figures 2a and 7a). No positive cells were observed in the olfactory bulb primordia of prolarvae examined, or in the striatum and pallium of larvae and prolarvae.
Preoptic region and hypothalamus
The mPO‐paraventricular population of PmCRH‐expressing cells is conspicuous in larvae of around 100 mm in length (Figures 2, 7, and 8a–d). As in adults, many axons coursed toward the neurohypophysis, and medial dendrites directed toward the ventricle are also observed in many positive cells (Figure 8a–e). In 15‐day posthatching (P15) prolarvae, the preopto‐paraventricular population was not observed yet with ISH or immunofluorescence, but in P25‐P30 prolarvae a group of PmCRH‐expressing cells was observed in sections of the prosencephalon at transverse levels just dorsorostral to the postoptic commissure (Figure 10a). These sections show the ventral surface of the brain next to the preoral epithelium without intervening notochord and a scant marginal layer outside the comparatively thick mantle. PmCRH immunofluorescence in P25 and P30 prolarvae showed positive cells in this mPO/paraventricular nucleus location (not shown) and intense fluorescence in the primordial neurohypophysis (Figure 10d). By comparison of sections containing PmCRH‐expressing cells with those of previous studies of our group with GABA, PCNA, and HNK‐1 immunohistochemistry (Meléndez‐Ferro et al., 2003; Meléndez‐Ferro, Pérez‐Costas, et al., 2002; Villar‐Cheda et al., 2006), we identify this population as a primordium of the preopto‐paraventricular population observed in older life stages. Unlike in adults, no PmCRH expression was observed in cells of the ventral hypothalamus of larvae or prolarvae.
Diencephalon
In larvae or prolarvae, no prethalamo‐PEN‐hypothalamic PmCRH‐expressing population was observed. In the pretectum of larvae of about 100 mm in length, a small compact group of faintly stained PmCRH‐expressing cells was observed located close to the meninges lateral to the subcommissural organ (Figures 2e and 7e), instead of occupying a central position in the pretectum as observed in adults. Some PmCRH‐expressing small neurons were also observed in the nucleus of the medial longitudinal fascicle of larvae (Figures 2, 7, and 8f) and in P30 prolarvae (Figure 10d). No PmCRH‐expressing cell populations were observed in the thalamus or the midbrain (mesencephalon) of the larval sea lamprey.
Rhombencephalon
Two PmCRH‐expressing main hindbrain populations were distinguishable in larvae. The most conspicuous is in the isthmus near the giant I1 isthmic cell and rostrally to the trigeminal motor nucleus (Figures 2g,h and 7g,h). Other neurons were observed in the medial rhombencephalic reticular nucleus, at levels of the facial motor nucleus (Figures 2i and 7i). In P15‐P30 prolarvae, two prominent hindbrain populations are clearly separated, one large‐celled located in the dorsal isthmus and the other with smaller cells near the ventral midline caudally to the ear vesicle (Figure 10b,c, e), which indicates that they originate in different neural primordia. The caudal cells appear to be the primordium of the PmCRH‐expressing reticular cells observed scattered in middle levels of the larval hindbrain. A third hindbrain population of PmCRH‐expressing neurons is also observed in prolarvae near the ventral midline of the isthmus. With PmCRH immunohistochemistry, the differences in size and staining intensity between dorsal and ventral isthmic cells were also appreciable (Figure 10e).
Spinal cord
Similar to adults, in the rostral spinal cord of larvae, a few occasional PmCRH‐expressing cells were observed (Figures 2j and 8i). No PmCRH‐expressing cells were observed in more caudal regions of the spinal cord (at the level of the 5th gill, midbody region or most caudal spinal cord; Figure 9c,d).
3.2. Distribution of PmCRH‐ir fibers in adults and larvae
3.2.1. Telencephalon
The use of anti‐PmCRH antibody immunofluorescence allowed studying the regional distribution of PmCRH positive fibers in the brain of adults and larvae, together with some observations on the organization of fibers in prolarvae. The density of PmCRH‐ir fibers in brains of larvae (around 100 mm in length) and adults varies largely among regions. In the telencephalon of adult lampreys, fine PmCRH‐ir fibers are seen in the olfactory bulb, and thicker PmCRH‐ir fibers are scattered in the pallium (not shown). In the medial pallium (which developed mainly in adults), a band of fine PmCRH‐ir fibers is seen in the neuropil near the periventricular layer of neurons that is characteristic of the lamprey medial pallium. In larvae, the olfactory bulb, pallium, and subpallium are mostly devoid of PmCRH‐ir fibers.
3.2.2. Preoptic region, hypothalamus, and hypophysis
In the preoptic region and rostral hypothalamus of larvae, the numerous PmCRH‐ir fibers coursing in the preoptic‐paraventricular‐hypophysial tract form the most outstanding tract in the brain (Figure 8a–e). PmCRH‐ir fibers are not present in the caudal hypothalamus and mammillary region. Lateral to the preoptic nucleus, many PmCRH‐ir fibers were also appreciable. In adults, these tracts are remarkable, as well as the numerous fibers of the tuberal neuropil (Figure 5a–e). In the larval diencephalon, most fibers course in the neuropil at middle heights (Figure 8f) but lack in the habenula and pineal complex. In the diencephalon of adults, most PmCRH‐ir fibers are seen in the thalamus and the prethalamus lateral to the PmCRH‐expressing cells, avoiding the optic tract. In addition, the adult pretectum shows abundant PmCRH‐ir fibers in the region containing the PmCRH‐expressing cells (Figure 5f) and in a positive tract in the transition with the habenula. Some PmCRH‐ir fibers cross the midline in the posterior commissure.
3.2.3. Mesencephalon
In the larval mesencephalon, most fibers run longitudinally in the tegmentum, whereas the optic tectum, which is immature in larvae, show scant fibers (Figure 8g). In adults, the optic tectum shows more numerous PmCRH‐ir fibers, coursing in the inner cell and fibers layer, but not in outer tectal layers (Figure 5h). In the caudal tectum, however, numerous PmCRH‐ir fibers innervate this region, which has some differential features with rostral regions and probably correspond with a specialized superficial region of the torus semicircularis (Sobrido‐Cameán, Yáñez‐Guerra, Deber, Freire‐Delgado, et al., 2021). Abundant PmCRH‐ir fibers also cross the midline at this caudal level forming a very conspicuous dorsal commissure (Figure 5i). This PmCRH‐ir commissure located between the isthmus and midbrain was also appreciable in larvae near the dorsolateral meningeal border.
3.2.4. Rhombencephalon and spinal cord
In the isthmus of larvae and adults, there are many fibers at most dorso‐ventral levels, lacking in the interpeduncular nucleus neuropil (Figure 5k) that extends as a paired ventral neuropil region till the end of the trigeminal motor nucleus (see Yáñez & Anadón, 1994). In the rest of the rhombencephalon, PmCRH‐ir fibers are scarce in the dorsal regions (octavolateralis area and dorsal column nucleus) but are abundant in the remainder neuropil regions (Figure 8h). Most PmCRH‐ir fibers appear to course longitudinally based on their appearance in transverse sections, but at the level of the Mauthner cell (transition between the rhombomeres 3 and 4), there is a small but well‐defined commissure of PmCRH‐ir fibers crossing as arcuate fibers in the dorsal zone of the raphe. In adults, the pattern is similar (Figure 5k,l), with visceromotor nuclei lacking PmCRH‐ir fibers, and scarce fibers in sensory areas (octavolateralis region, dorsal column nucleus, and descending trigeminal nucleus).
Immunofluorescence experiments revealed numerous PmCRH‐ir fibers in the spinal cord at levels caudal to the obex (5th gill, midbody and caudal spinal cord; Figure 9a–d) except in the dorsal column (Figure 9a–d) and descending trigeminal root (Figure 8i).
In P15‐P30 prolarvae, abundant PmCRH‐ir fibers were observed in the marginal layer of basal regions of the brain and spinal cord (Figure 10d–f), most fibers appearing to course longitudinally. In the hindbrain, the isthmic neuropil region was densely innervated by PmCRH‐ir fibers from prolarval stages. In prolarvae, the spinal cord marginal layer also shows PmCRH‐ir fibers (Figure 10f).
3.3. Origin of descending PmCRH‐ir spinal fibers
In the spinal cord of larvae and adults only a few PmCRH‐expressing neurons were observed in the lateral horn of the rostral region (close to the obex; see above). But at more caudal spinal cord levels, only PmCRH‐ir fibers are observed (see above). To investigate the origin of these PmCRH‐ir fibers, we combined PmCRH immunofluorescence, and tracing experiments were done in larvae of about 100 mm in length. Combination of retrograde transport of neurobiotin from the spinal cord injected at the level of the 5th gill opening and PmCRH immunohistochemistry revealed retrogradely labeled small hindbrain reticular neurons that were also PmCRH positive (Figure 11), that is, indicating that these positive cells project to the spinal cord. These cells were located periventricularly mainly in the superior (isthmic) and medial rhombencephalic reticular nuclei near the midline, with conspicuous double labeled cells seen in the isthmus (in the dorsal PmCRH‐ir population). A few descending PmCRH cells were occasionally observed in the nucleus of the medial longitudinal fascicle (caudal diencephalon).
3.4. Distribution of CRHBP‐expressing cell populations in the lamprey central nervous system
We studied the distribution of PmCRHBP‐expressing cell populations in the brain of the sea lamprey employing specific PmCRHBP probes for ISH. The distribution of PmCRHBP‐expressing cells in lampreys was clearly different from that of PmCRH‐expressing perikarya, being mainly located in the septum, striatum, preoptic nucleus, hypothalamus, pineal complex, isthmic/rhombencephalic reticular regions, and in the spinal cord. Schematic drawings showing the distribution of PmCRHBP‐expressing neurons in the brain of adult and larval sea lampreys are presented in Figures 12 and 15, respectively. Photomicrographs of brain sections showing ISH results in adults are presented in Figures 13 and 14, in larvae in Figure 16a–f, and in prolarvae in Figure 16g–i.
FIGURE 12.

(a–h) Schematic drawings of transverse sections of the brain of an adult sea lamprey showing the distribution of PmCRHBP‐expressing neurons (at the right) and the anatomical structures (at left). The levels of sections are indicated in the figurine of the lateral view of the brain. For abbreviations, see the list. Scale bars, 200 µm (a–h), 1 mm (figurine)
FIGURE 15.

(a–e) Schematic drawings of transverse sections of the brain of a sea lamprey larva (about 100 mm long) showing the distribution of PmCRHBP‐expressing neurons (at the right) and the anatomical references (at left). The levels of sections are indicated in the figurine of the lateral view of the brain. For abbreviations, see the list. Scale bars, 200 µm (a–e)
FIGURE 13.

Photomicrographs of transverse sections of the forebrain of a young adult sea lamprey showing neurons expressing PmCRHBP mRNA revealed by ISH. (a and b) Panoramic view and detail of the olfactory bulb and septal‐terminal lamina region showing numerous positive neurons in the septum. (c and d) Panoramic view and detail of the telencephalon and preoptic region showing PmCRHBP‐expressing neurons in the striatum and outer zone of the mPO nucleus. (e and f) Panoramic view of the hypothalamus and diencephalon and detail of the tuberal nucleus population of positive neurons. (g) Section through the epithalamus showing positive cells in the outer wall of the pineal organ (P) and a few cells in the parapineal organ (PP). Asterisks, vesicle lumen. For abbreviations, see the list. Scale bars, 50 µm (b, d, f, g), 125 µm (a, c, e)
FIGURE 14.

Photomicrographs of transverse sections of the hindbrain of a young adult sea lamprey showing neurons expressing PmCRHBP mRNA revealed by ISH. (a–e) Panoramic views of the isthmus region showing abundance of PmCRHBP positive neurons. Note that the isthmus region appears below the mesencephalon (which is free of CRHBP‐ expressing cells) at rostral levels. (f–h) Details of positive cells in rostral, intermediate and caudal isthmic levels. (i–m) Panoramic views of sections of the hindbrain between rhombomere 2 and 6 showing differences in distribution PmCRHBP‐expressing neurons along the medulla: i–j, level of the trigeminal motor nucleus (rhombomeres 2–3); k–l, levels of the octaval nerve entrance and facial motor nucleus (rhombomeres 4–5); m, level of the motor glossopharyngeal nucleus (rhombomere 6). (n and o) Section and detail at the level of transition of the hindbrain to the spinal cord, caudal to the calamus, showing positive neurons (arrowed) in the dorsal column nucleus. (p and q) Panoramic view and detail of the spinal cord showing a few PmCRHBP positive neurons (arrows). Asterisks in (n), (p), and (q) indicate the medial longitudinal fasciculus. For abbreviations, see the list. Scale bars, 125 µm (a, b, c, d, e, i, j, k, l, m, n, p), 50 µm (f, g, h, o, q)
FIGURE 16.

Photomicrographs of transverse sections of the brain of a larval sea lamprey (100 mm long) (a–f) and of a P15 prolarvae (g–i) showing neurons expressing PmCRHBP mRNA revealed by ISH. (a) Section through the telencephalon at the level of the lamina terminal showing positive neurons in the septum (arrow). (b) Section through the hypothalamus showing a periventricular band of positive cells in the tuberal nucleus (outlined arrow). (c–e) Sections through the isthmus region (from rostral to caudal) showing groups of dorsal (outlined arrows in d and e) and ventral (arrows) positive neurons with different appearances. (f) Section at the level of the octaval nerve entrance showing abundant positive neurons in the medial rhombencephalic reticular nucleus. Asterisk in (f) indicates a large reticulospinal neuron. (g) Section through the prosencephalon of a P15 prolarvae showing a dense population of PmCRHBP‐expressing neurons corresponding to the tuberal nucleus. (h and i) Sections through the isthmus showing groups of PmCRHBP‐expressing neurons. For abbreviations, see the list. Scale bars, 50 µm
3.4.1. Adults and juveniles
In juveniles, the most rostral PmCRHBP‐expressing cells were observed in the walls of the septum (Figures 12a and 13a,b). This population extended to the preoptic nucleus with cells scattered in a location lateral to the main band of PmCRH‐expressing cells (mPO/paraventricular nucleus) (Figures 12b and 13c,d). Both cell populations (PmCRHBP‐ and PmCRH‐expressing) scarcely intermingle in the preoptic region, as shown by double PmCRH immunohistochemistry/PmCRHBP ISH (Figure 6c). In addition, a small population of PmCRHBP‐expressing cells was observed in the striatum, located in the characteristic cell band and extending toward the periventricular zone of the ventral pallium (Figures 12a,b and 13c,d). In the hypothalamus (anterior tuber and tuberal region), a long band of PmCRHBP‐expressing cells was observed in intermediate‐dorsal region from the nucleus of the postoptic commissure till the rostral level of the hypophysis (Figures 12c and 13e,f). Most cells are located within the dense rows of cells parallel to and away from the ependyma, but a few cells are located among ependymal cells. Again, this location is different from that of PmCRH‐expressing cells of the posterior entopeduncular nucleus (Figure 6d) or from those of the tuberal region, which are located in the most ventral tuberal region (see above). In the diencephalic roof, numerous PmCRHBP‐expressing cells were observed in the walls of the parapineal and pineal organs (Figures 12a,b and 13g). In the pineal vesicle, most of positive cells are distributed in the dorsal (outer) wall, whereas in the parapineal vesicle they mostly are in a lateroventral region.
In the isthmus‐first rhombomere of adults (which lies rostral to the trigeminal motor nucleus), different populations of PmCRHBP‐expressing cells were observed (Figures 12d,e and 14a–h). The most dorsal was a rather compact group of cells located in the periventricular layer of cells at an intermediate dorso‐ventral level close to the giant I1 cell. A second group, much more numerous than the former, occupies a more ventral location and is clearly differentiated by the scattered distribution of many cells away the periventricular layer through a lateral wing‐like area. In this ventral group, smaller sized and paler cells were also observed close to the ventral ependymal layer. More scattered populations of PmCRHBP positive cells were observed in the rhombencephalon caudal to the isthmus‐first rhombomere till the rostral spinal cord (Figures 12f,g and 14j). These cells are located in basal plate‐derived regions medial to the visceromotor nuclei and in the reticular formation close to the medial longitudinal fascicle. These cells are scarce at levels of the trigeminal motor nucleus (rhombomeres 2–3), increase clearly in number at levels of the facial motor nucleus (rhombomeres 5–6) (Figures 12f and 14i–l), and disappear in more caudal hindbrain levels (Figure 14m). At the transition with spinal levels, some PmCRHBP positive cells were also observed in the nucleus of the dorsal column (Figures 12g and 14n,o). In the rostral spinal cord, PmCRHBP‐expressing cells are observed from the hindbrain‐spinal transition, with a few cells per section located below the central canal and in the lateral horn (gray matter) (Figures 12h and 14p,q).
3.4.2. Larvae
In larvae of about 100 mm in length, some PmCRHBP‐expressing cells were observed in the septum (Figures 15a and 16a), and occasional cells in the preoptic nucleus (Figure 15b). The hypothalamic population of PmCRHBP‐expressing cells was numerous in the tuberal region (Figures 15c and 16b). In the pineal complex, PmCRHBP‐expressing cells were observed in the walls of the parapineal and pineal vesicles (Figure 15b). Two isthmic groups were recognizable in these larvae (Figures 15d and 16c–e). The dorsal isthmic PmCRHBP‐expressing cells are located near the I1 giant neuron, and the ventral population is more scattered and extended laterally. In addition, scattered PmCRHBP‐expressing cells were observed in the rhombencephalic reticular region caudal to the trigeminal nerve entrance till caudal levels (Figures 15e and 16f). In the rostral spinal cord, scarce positive cells are scattered in the gray matter without a defined location.
3.4.3. Prolarvae
No positive cells were observed in the preoptic region or in the septal primordium of prolarvae. In P15‐P25 prolarvae, three well defined groups of PmCRHBP‐expressing cells were observed in the mantle layer of the brain, and a few positive small cells were appreciable in the pineal vesicle. The most rostral PmCRHBP positive group consists of a compact cell cluster in the cell mantle that is located in the primordium of the hypothalamus at intermediate dorso‐ventral levels (Figure 16g). This level is recognizable in transverse sections because it is caudal to the postoptic commissure, being also distinctive that ventrally the brain is close to the preoral epithelium without intervening notochord. At the level of the isthmus/first rhombomere (see Meléndez‐Ferro et al., 2003), two groups of PmCRHBP‐expressing neurons were already present in prolarvae, one more rostral and in intermediate dorso‐ventral level, and the other located in the ventral region of the mantle layer slightly caudal to the former (Figure 16h,i). In head sections at this level, the notochord tissue was clearly appreciable between the brain and the preoral epithelium. Caudal to these isthmic groups, PmCRHBP‐expressing cells were observed in the most ventral hindbrain/spinal region, laterally to the small floor plate. In these prolarvae, the limits between the hindbrain and the rostral spinal cord are difficult to assess, but some of these cells appear to be in spinal levels.
4. DISCUSSION
In this study, we analyzed in several life stages of the sea lamprey the distribution of PmCRH‐ and PmCRHBP‐expressing cells using ISH with probes specific for these mRNAs. For PmCRH, we also generated a specific antibody (as shown by ELISA experiments) raised against a synthetic peptide with the putative sequence of the mature PmCRH peptide. Complementary experiments included double stainings (PmCRH immunohistochemistry with TH immunohistochemistry or PmCRHBP ISH), as well as experiments with a combination of PmCRH immunohistochemistry with retrograde transport of neurobiotin from the spinal cord. Previous studies showed expression of CRH and CRHBP mRNA in extracts of the whole sea lamprey brain at different life stages by RT‐qPCR (Endsin et al., 2017), but not its neuronal distribution as shown here. As far as we are aware, our results present the first report about the organization of CRH‐ and CRHBP‐expressing neurons in the brain of any jawless vertebrate.
Regarding the distribution of neurons in the sea lamprey brain and rostral spinal cord, our results reveal that PmCRH‐ and PmCRHBP‐expressing cells represent separate populations with distinct distributions, and thus this neuropeptide and its binding protein are probably synthesized and released by two different systems. Note, however, that the single CRHBP of mammals binds both CRH and Ucn1 with sub‐nanomolar affinity (Ketchesin, Stinnett, et al., 2017), and in Xenopus CRHBP binds with high affinity to CRH‐like peptides (Valverde et al., 2001). Thus, it is probable that PmCRHBP could bind to several members of the CRH family of lampreys. The brain distribution of the mRNA of another member of the CRH gene family (Ucn3) has been recently studied by our group (Sobrido‐Cameán, Anadón, et al., 2021). Comparison of Ucn3 distribution results in sea lamprey with present PmCRH distribution reveals important differences between the distributions of these substances. Since we could only study the distribution of PmCRH fibers, the relation between the CRHergic cells with that of Ucn3‐ or PmCRHBP‐expressing axons was not determined. Moreover, the mode of secretion of CRHBP by neurons in vertebrates (constitutive or regulated) is not yet clear.
The lamprey CRHergic preopto‐paraventricular‐neurohypophysial system was outstanding in larvae and adult lampreys, but not in P15 prolarvae. Many neurons belonging to the lamprey mPO and its caudal continuation as the paraventricular nucleus express PmCRH mRNA in both larvae and adults. PmCRH immunohistochemistry shows that cells of this continuous cell population send axons toward the tuberal hypothalamus and reach the neurohypophysis since prolarval stages, where presumably form terminal endings on the meningeal surface. Recently, CRH‐ir neurons have been reported with immunohistochemistry in the preoptic nucleus and periventricular preoptic nucleus of a hagfish (Amano et al., 2016). This preoptic CRH neurosecretory system appears well conserved in teleost fishes (rainbow trout: Ando et al., 1999; zebrafish: Alderman & Bernier, 2007; Japanese eel: Amano et al., 2014), although in mammals (and probably also in reptiles and birds) the homologous nuclei are two separate entities, the supraoptic and the paraventricular nuclei, both with neurons producing CRH and sending axons to the hypophysis (Keegan et al., 1994; Wamsteeker Cusulin et al., 2013). Unlike in mammals, the preopto‐paraventricular CRHergic neurons of sea lamprey (at least in part) appear to be of CSF‐contacting type, a type of neuron common in the lamprey hypothalamus (Barreiro‐Iglesias et al., 2017).
The release of CRH by fibers of the hypothalamo‐hypophysial tract in the lamprey neurohypophysis is thought to promote the secretion of adrenocorticotropin (ACTH) by the adenohypophysis, although there are no direct experimental results supporting this hypothesis (Roberts et al., 2014). In the sea lamprey and other lampreys, two different hormone precursors of the pituitary hormones melanotropin (MSH) and ACTH have been identified, proopiomelanotropin and proopiocortin, respectively (Ficele et al., 1998). This is unlike the single common precursor proopiomelanocortin gene present in most gnathostomes, except in various teleosts in which this gene is duplicated (Alsop & Vijayan, 2009). In the sea lamprey and other lamprey species, these precursors, as their derived peptides MSH and ACTH, are expressed in cells of different parts of the adenohypophysis (pars intermedia and pars proximalis), both in larvae and adults, although with high quantitative variation between larvae, transforming lampreys and different adult phases (Ficele et al., 1998; Nozaki et al., 2008, 1995; Takahashi et al., 2006). Older studies revealed that both stress and ACTH injection affect cells of the interrenal tissue (adrenocortical homologue) of sea lampreys (Hardisty, 1972; Youson, 1972). Thus, the hypothalamo‐hypophysial‐interrenal (adrenal) axis appears to be conserved between agnathans and gnathostomes, indicating that it appeared in common ancestors of all vertebrates. Paradoxically, the lamprey interrenal tissue does not synthesize the stress hormones cortisol or corticosterone and thus the function of this tissue as a producer of stress hormones is unclear (Roberts et al., 2014). A steroid molecule found in blood (11‐deoxycortisol) has been proposed as the corticosteroid hormone of lampreys, although its regulation and sites of synthesis are not yet known (Close et al., 2010). Recent data indicate that 11‐deoxycortisol is involved in hydromineral balance (Shaughnessy et al., 2020) and is elevated by stress, activating gluconeogenesis (Shaughnessy & McCormick, 2021). A study in a hagfish, however, has detected cortisol and corticosterone in plasma (Amano et al., 2016), which is an intriguing difference with their reported absence in lampreys.
Neurogenetic studies in mice have determined that the CRH‐expressing neurosecretory neurons of the paraventricular nucleus appear in a primordial embryonic brain region (supraopto‐paraventricular primordium) expressing the gene Orthopedia (otp) (Acampora et al., 1999; Morales‐Delgado et al., 2014). This transcription factor is also essential for restricting the fate of other categories of neuroendocrine neurons (vasotocinergic, TRHergic: Acampora et al., 1999). Knocking‐out the otp gene in mice embryos precludes the appearance of CRH‐expressing populations, indicating a dependence on this transcription factor in the specification of cells of this region (Acampora et al., 1999; Morales‐Delgado et al., 2014). In adult mice, the CRH‐expressing paraventricular population is activated by stress (Wamsteeker Cusulin et al., 2013). otp is also expressed in the corresponding band that gives rise to the preoptic CRH population in zebrafish (Herget et al., 2014). This subdivision, named in mammals as the paraventricular or supraoptoparaventricular area in prosomeric models, is currently ascribed to the alar region of the hypothalamus (Morales‐Delgado et al., 2014). An alternative model suggests that it is part of an optic‐related region that is outstanding in fishes (Yamamoto et al., 2017). Although the expression of otp is not known in the lamprey brain, most probably the PmCRH‐expressing population of the magnocellular preopto‐paraventricular band is homologous to that of teleosts and mammals. This region also contains abundant vasotocinergic and TRHergic neurons in lampreys (Goossens et al., 1977; De Andrés et al., 2002; Pombal & Puelles, 1999). Our results with double staining with PmCRH ISH and TH immunohistochemistry further reveal the mutual exclusion of cellular territories of PmCRH and TH expression in dorsal and ventral zones of the periventricular region of the lateral optic recess, respectively.
An additional PmCRH‐expressing hypothalamic population of small cells appears in the ventral tuberal region of the hypothalamus in adults, although not in larval lampreys. The significance of this tuberal population and the possibility that these cells may be related with the hypophysis were not determined. The presence of CRHergic hypothalamic populations outside the preopto‐paraventricular region was also reported in the so‐called ventral hypothalamus of Lepisosteus and zebrafish and in the nucleus lateralis tuberis of Oreochromis mossambicus (tilapia) (Alderman & Bernier, 2007; Grone & Maruska, 2015), which might correspond to those of the lamprey ventral tuberal region. While in Lepisosteus and in tilapia only a CRH gene (CRH1 or CRHb, respectively) is expressed there, in zebrafish both CRHa and CRHb are expressed.
Several PmCRH‐expressing populations unrelated to the hypophysis were observed in the lamprey brain, some of them appearing early in prolarvae (in the isthmus or caudal hindbrain), and others appearing at more advanced stages (large larvae or adults). Among the late appearing PmCRH‐expressing populations are those found in the telencephalon (olfactory bulb and pallio‐striatal populations). In the olfactory bulb, PmCRH‐expressing neurons are very scant in larvae and more numerous in adults. In adults, immunohistochemistry also shows very thin PmCRH‐ir fibers branching in the olfactory bulb granular layer but not, or scarcely, in olfactory glomeruli. This suggests that these neurons are not typical granule cells involved in local circuits of the olfactory bulb. No cells or CRH‐ir fibers were observed in the olfactory bulb of a hagfish (Amano et al., 2016), which is unlike that observed here in the sea lamprey. However, CRH‐ir neurons were reported in the glomerular layer of the olfactory bulb of the teleost fish Oreochromis mossambicus (Pepels et al., 2002) and of mammals, where they appear in the external plexiform layer (Garcia et al., 2016; Peng et al., 2017; Wang et al., 2021). Studies in mice have shown that these neurons act in local circuits via release of CRH, being essential for shaping olfactory circuits (Garcia et al., 2016). In mouse olfactory bulb, CRH expression first appears postnatally (Garcia et al., 2016), whereas our results suggest late expression in lamprey larvae. Anyway, correspondences between CRHergic cell types of the olfactory bulb of lampreys and mammalians need further clarification.
With regard to the telencephalic lobes, a sparse population of PmCRH‐expressing cells extends between the striatum and ventral pallium, but it is only present in adult lampreys (both young and mature). Again, this suggests that they are related to some functions specific to adult life. Interestingly, this CRHergic population is topographically closely related with a population of cells expressing PmCRHBP in adults, suggesting functional relationship between these two populations. This codistribution reminds the populations of CRH‐ and CRHBP‐expressing cells reported in the ventral nucleus of the zebrafish subpallium (Alderman & Bernier, 2007). In tilapia, however, the largest CRHergic population in the brain was observed in the lateral nucleus of the subpallium (Pepels et al., 2002). By its location, the lamprey striato‐pallial PmCRH‐expressing population may remind the CRHergic neurons reported in the amygdala of mammals (Peng et al., 2017; Potter et al., 1992), which is involved in stress control, or to caudo‐putamen neurons (Wang et al., 2021), but functions of the lamprey striatum in stress control are unknown. Also, the absence of proper pallial CRHergic cells in the sea lamprey reveals important differences with mammals, which show abundant CRHergic neurons in some cortical regions (Garcia et al., 2016; Peng et al., 2017; Potter et al., 1992; Wang et al., 2021). Furthermore, immunohistochemistry reveals that most of the pallium of lampreys (dorsal, lateral) shows scant CRHergic innervation, although the medial pallium of adults shows a more abundant innervation near the periventricular region. In the teleost fish tilapia, very numerous CRH‐ir fibers were observed in the rostral pole of the pallium, possibly coming from a subpallial (Vl) population of CRH‐ir neurons (Pepels et al., 2002). Although a subpallial (striatal) population of PmCRH‐expressing neurons is present in adult sea lamprey, no territory densely innervated by PmCRH‐ir fibers as that reported in tilapia was observed in the pallium.
The lamprey prethalamus (alar diencephalon) shows populations of PmCRH‐expressing neurons in adults, but not in larval stages. A small pretectal PmCRH‐expressing group observed in adults and large larvae is located in the same pretectal region of a small pretecto‐habenular group reported with tracing methods (Stephenson‐Jones et al., 2012; Yáñez et al., 1999), suggesting that PmCRH is involved in these habenular circuits. However, PmCRH immunohistochemistry only shows scant PmCRH‐ir fibers in the habenula and parapineal ganglion. The most abundant PmCRH‐expressing diencephalic population is the prethalamic one, which is distributed sparsely close to the dorsal (caudal) hypothalamus, whereas the other is found in the pretectum. Cells of the lamprey prethalamus (formerly ventral thalamus) project to the hindbrain and spinal cord, and this region is considered as premotor (El Manira et al., 1997). However, we did not find PmCRH‐expressing prethalamic cells with spinal projections in our combined tracing experiments. A third diencephalic PmCRH‐expressing population is found in the nucleus of the medial longitudinal fascicle. Cells of this nucleus project to the rhombencephalic reticular formation (Capantini et al., 2017), and fibers from PmCRH‐expressing cells of this region, together with those originated in the isthmic and hindbrain reticular cells, might form part of longitudinal tracts observed with immunohistochemistry.
Regarding the absence of PmCRH‐expressing cells in the lamprey mesencephalon, this is in contrast with the presence of CRH‐expressing cells in the midbrain of tilapia (periventricular layer of the optic tectum; Pepels et al., 2002). Anyway, the observation of dense innervation by CRHergic fibers in the caudal midbrain tectum of adult sea lampreys is interesting, as well as the conspicuous caudal commissure. This caudal tectal region may represent in fact a specialized portion of the torus semicircularis, as suggested on the base of studies of distribution of glycine (Villar‐Cerviño et al., 2008) and Ucn3 (Sobrido‐Cameán, Anadón, et al., 2021). In addition, this caudal region is innervated by afferents from the octavolateralis region (De Arriba Pérez, 2007), as the topologically similar torus semicircularis of Xenopus located just caudal to the optic tectum in the tectal lamina (Morona & González, 2009). Other midbrain regions also show rich innervation by CRHergic fibers, but whether they are en‐passant fibers that contact midbrain neurons was not established. With regard to the binding protein, no PmCRHBP‐expressing cell was observed in the lamprey midbrain, and innervation by positive fibers from other areas is not known.
The lamprey isthmus/first rhombomere region contains abundant PmCRH‐expressing neurons since the earliest developmental stages investigated, which originate in two different clusters, dorsal and intermediate‐ventral. Even in prolarvae, the morphology of cells is different in the dorsal and intermediate‐ventral populations, and these differences are also appreciable in adults. Interestingly, the isthmus/first rhombomere also contains the largest population of PmCRHBP‐expressing cells, which also appears as two well‐separated cell clusters in prolarvae. Our results suggest a close developmental, topographical, and functional relation between these PmCRH‐ and PmCRHBP‐expressing isthmic/superior rhombencephalic populations. This lamprey isthmic region is an important functional hindbrain center that controls locomotion, although more often it is called as “mesencephalic locomotor region” (MLR) (Brocard & Dubuc, 2003; Grätsch et al., 2019; Sirota et al., 2000), which leads to anatomical confusion (see Villar‐Cerviño et al., 2008). Comparison of maps of cells in “MLR” levels presented in Grätsch et al. (2019) with those of present results also confirms that most of these cells are clearly isthmic, not mesencephalic. Physiological studies reveal that projections from neurons of this region to neurons of the middle rhombencephalic reticular nucleus can activate or stop locomotion via glutamatergic transmission (Grätsch et al., 2019). The abundance of PmCRH‐ and PmCRHBP‐expressing cells of this region suggests that these neurons could be involved in stress control of locomotion. The isthmus/first rhombomere of the sea lamprey shows abundant serotonergic cells from prolarvae to adulthood (Abalo et al., 2007; Barreiro‐Iglesias, Villar‐Cerviño, Anadón, et al., 2008; Cornide‐Petronio et al., 2013), with groups ventral, intermediate, and dorsal, which in part are codistributed with PmCRH‐ and PmCRHBP‐expressing neurons. The possibility of colocation of serotonin with PmCRH or PmCRHBP in these cells was not investigated. In the mammalian isthmus, an important population of CRH‐expressing cells is found in the Barrington's nucleus, which is close to the locus coeruleus containing noradrenergic neurons. The Barrington's nucleus is an important micturition center in rodents projecting axons to the lumbosacral spinal cord (Valentino et al., 2000; Verstegen et al., 2017), being part of a sympatho‐adrenomedullary stress system (Chaves et al., 2021). However, lampreys have no bladder like that of mammals, and probably their isthmic CRHergic populations are involved in other roles. Hindbrain levels contain other PmCRH‐expressing neurons generally in reticular areas. In mammals, CRHergic cells are also observed in the parabrachial nucleus, the tegmental nucleus, ventrolateral medulla, medial vestibular nucleus, and inferior olivary complex (Chaves et al., 2021; Peng et al., 2017). However, correspondence with lamprey hindbrain PmCRH‐expressing populations is unclear. Moreover, the sea lamprey lacks catecholaminergic populations in the rostral rhombencephalon and does not have a locus coeruleus homologue (Barreiro‐Iglesias, Laramore, et al., 2010), and lacks an inferior olivary nucleus, whose CRHergic cells project to the cerebellum in mammals (which is also absent in lampreys; see Lamanna et al., 2022).
Prompted by the abundance of PmCRH‐ir fibers coursing longitudinally along the brain and spinal cord, we performed some experiments of neural tracing with neurobiotin combined with PmCRH immunofluorescence. Our results show double labeled CRHergic cells in the superior and medial rhombencephalic reticular nuclei and occasionally in the diencephalon (nucleus of the medial longitudinal fascicle). Descending fibers are probably early appearing, judging from the abundance of CRHergic fibers in the prolarval spinal cord, but target cells are not known.
4.1. Early appearance of PmCRH‐ and PmCRHBP‐expressing hindbrain populations
The presence of conspicuous PmCRH‐ and PmCRHBP‐expressing cells in the rostral hindbrain was noted in the brains of P15 prolarvae, the first developmental stage studied, suggesting that these populations appeared in earlier stages. The hindbrain PmCRH‐expressing populations appear earlier than those in the preoptic region, which is in line with gradients of maturation observed in the brain of lampreys for other neurotransmitters as GABA and serotonin (Abalo et al., 2007; Meléndez‐Ferro et al., 2003; Meléndez‐Ferro, Pérez‐Costas, et al., 2002). The precedence of hindbrain PmCRH‐expressing populations in lamprey brain is in contrast with observations in the zebrafish, in which the preoptic neurons are those appearing first (Chandrasekar et al., 2007). Also, the delayed appearance of striatal PmCRH‐expressing neurons in lampreys till juvenile stages contrasts with the earlier appearance of subpallial, preoptic, and posterior tubercle CRH neurons than hindbrain neurons in zebrafish embryos (Chandrasekar et al., 2007). This comparison reveals marked heterochrony between zebrafish and lampreys, which would be related to the extended larval life of lampreys showing major differences with the adult phases. Differential regulation in CRH neuronal populations was also reported in mouse embryos (Keegan et al., 1994), with cells in the paraventricular nucleus, Barrington's nucleus, olivary complex, and amygdaloid primordia appearing on embryonic day 13.5, whereas CRH mRNA is not detectable in the cortex until after birth.
4.2. Comparison of CRHBP and CRH distributions
CRHBP is a phylogenetically ancient peptide whose presence has been demonstrated in all major vertebrate groups from fish to mammals (Endsin, 2013; Seasholtz et al., 2002), although its brain distribution has been only shown in mammals (Potter et al., 1992). In mammals, this protein binds with high affinity equally to CRH and UCN1 and sequesters these ligands away from the receptor; this modifies the action of these factors on their receptor with a variety of effects on various targets (for review see Seasholtz et al., 2002). We showed for the first time the distribution of PmCRHBP in the brain of a lamprey. Our results show a limited brain distribution of PmCRHBP‐expressing cells in adults, with positive neurons mainly located in the septum, striatum, preoptic nucleus, dorsal hypothalamus, pineal and parapineal organs, dorsal and ventral isthmus, and some additional rhombencephalic populations. Only some of these areas with PmCRHBP‐expressing neurons also show PmCRH‐expressing cells (striatum, preoptic‐paraventricular nucleus and isthmus). On the other hand, studies in the rat (Potter et al., 1992) show huge numbers of CRHBP positive cells in forebrain regions that lack these cells in the sea lamprey, such as the olfactory bulb, cortex (general cortex, pyriform cortex, and hippocampus), amygdaloid complex. Also, important CRHBP expression is found in both the superior and inferior collicules, and in the principal trigeminal sensory nucleus (Potter et al., 1992), which in lamprey are free of PmCRHBP positive neurons. These authors have shown that most cells in nuclei expressing both substances do not colocalize them. This appears to be the case in most lamprey brain regions, but the possibility that both proteins were co‐expressed by some cells in regions showing both substances (as in the isthmus) cannot be ruled out. With regard to the nature of CRHBP‐expressing cells in the mammalian prefrontal cortex, some studies indicate that they are preferentially GABAergic neurons that also express somatostatin (Ketchesin, Huang, et al., 2017). Comparison of distribution of PmCRHBP with those of cells expressing each of the three somatostatin genes reported in lamprey (Sobrido‐Cameán, Yáñez‐Guerra, Deber, Freire‐Delgado, et al., 2021), however, does not show close correspondence with any of them. From a comparative point of view, the lack of similar studies in other vertebrates precludes to propose a phylogenetic hypothesis that would be based on mere speculation.
4.3. CRHBP in the pineal complex
Lampreys show a pineal complex that consists of a pineal organ (vesicle) and a parapineal organ (vesicle plus ganglion), which show different organization, maturation patterns, and brain connections (see Barreiro‐Iglesias et al., 2017; Meléndez‐Ferro, Villar‐Cheda, et al., 2002; Pombal et al., 1999; Yáñez et al., 1999). PmCRHBP, but not PmCRH, is expressed in cells of the pineal vesicle of the sea lamprey since prolarval stages. These cells correspond by location to dorsal photoreceptors that express alpha‐transducin, beta‐arrestin and parapinopsin but not to those ventral photoreceptors expressing rhodopsin (Barreiro‐Iglesias et al., 2017; Kawano‐Yamashita et al., 2015). This suggests PmCRHBP expression and release by parapinopsin pineal photoreceptors that are sensible to color of light. Axonal projections from long‐axon pineal photoreceptors to the pretectum and optic tectum have been reported in lampreys (Pombal et al., 1999), and thus the pineal organ might send PmCRHBP‐expressing projections to the dorsal diencephalon and midbrain. Neural cells of the parapineal vesicle only project to the adjacent parapineal ganglion (Yáñez et al., 1999), which is a specialized region of the left habenula, and thus probably these cells exert there a local function. Interestingly, a small pretectal nucleus projects to the parapineal ganglion and habenula (Stephenson‐Jones et al., 2012; Yáñez et al., 1999). By location and morphology, this population strongly reminds the PmCRH population in the same region. Whether the PmCRH‐expressing pretectal cells are the same that send axons to the parapineal ganglion and habenula should be assessed in the future.
5. CONCLUSIONS
Present results reveal for the first time the location and organization of CRH‐ and CRHBP‐expressing neurons in the brain of a jawless vertebrate. Our results show that, in the sea lamprey, PmCRH‐ and PmCRHBP‐expressing cells represent separate populations with distinct distributions, and thus PmCRH and its binding protein are synthesized and released by two different cell systems. The analysis of the distribution of both PmCRH and PmCRHBP at different life stages (prolarval, larval, juvenile, and adult) revealed different timings in the appearance of the different juvenile/adult populations. These developmental changes might be related to the complex/long‐life cycle of lampreys: 5–7 years for larval development and with big changes in life after metamorphosis, from filter‐feeding larvae that live burrowed in the river sediment to adult parasitic animals.
Since PmCRH and PmCRHBP are expressed by different populations, future studies should investigate how these two systems are integrated and regulated. Our results provide an anatomical basis for future functional studies on the roles of CRH and CRHBP in the CNS of lampreys.
AUTHOR CONTRIBUTIONS
Concept/design: Antón Barreiro‐Iglesias. Acquisition of data: Daniel Sobrido‐Cameán and Laura González‐Llera. Data analysis/interpretation: Daniel Sobrido‐Cameán, Laura González‐Llera, Ramón Anadón, and Antón Barreiro‐Iglesias. Drafting of the manuscript: Daniel Sobrido‐Cameán, Ramón Anadón, Antón Barreiro‐Iglesias. Critical revision of the manuscript: Daniel Sobrido‐Cameán, Laura González‐Llera, Ramón Anadón, and Antón Barreiro‐Iglesias.
CONFLICT OF INTEREST
The authors declare no conflict of interest.
ACKNOWLEDGMENTS
The authors thank the staff of Ximonde Biological Station for providing the lampreys used in this study, and the Microscopy Service (University of Santiago de Compostela) and Dr. Mercedes Rivas Cascallar for confocal microscope facilities and help. Grant PID2020‐115121GB‐I00 funded by MCIN/AEI/10.13039/501100011033 to A. Barreiro‐Iglesias. Grant ED431C 2021/18 funded by the Xunta de Galicia. The European Molecular Biology Organization (EMBO) granted a long‐term EMBO fellowship to D. Sobrido‐Cameán (ALTF 62–2021).
Sobrido‐Cameán, D. , González‐Llera, L. , Anadón, R. , & Barreiro‐Iglesias, A. (2023). Organization of the corticotropin‐releasing hormone and corticotropin‐releasing hormone‐binding protein systems in the central nervous system of the sea lamprey Petromyzon marinus . Journal of Comparative Neurology, 531, 58–88. 10.1002/cne.25412
DATA AVAILABILITY STATEMENT
Antibodies and histological data generated during this research are available from the corresponding author upon reasonable request.
REFERENCES
- Abalo, X. M. , Villar‐Cheda, B. , Meléndez‐Ferro, M. , Pérez‐Costas, E. , Anadón, R. , & Rodicio, M. C. (2007). Development of the serotonergic system in the central nervous system of the sea lamprey. Journal of Chemical Neuroanatomy, 34(1–2), 29–46. 10.1016/j.jchemneu.2007.03.010 [DOI] [PubMed] [Google Scholar]
- Acampora, D. , Postiglione, M. P. , Avantaggiato, V. , Di Bonito, M. , Vaccarino, F. M. , Michaud, J. , & Simeone, A. (1999). Progressive impairment of developing neuroendocrine cell lineages in the hypothalamus of mice lacking the Orthopedia gene. Genes & Development, 13(21), 2787–2800. 10.1101/gad.13.21.2787 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Alderman, S. L. , & Bernier, N. J. (2007). Localization of corticotropin‐releasing factor, urotensin I, and CRF‐binding protein gene expression in the brain of the zebrafish, Danio rerio . Journal of Comparative Neurology, 502(5), 783–793. 10.1002/cne.21332 [DOI] [PubMed] [Google Scholar]
- Alsop, D. , & Vijayan, M. (2009). The zebrafish stress axis: Molecular fallout from the teleost‐specific genome duplication event. General and Comparative Endocrinology, 161(1), 62–66. 10.1016/j.ygcen.2008.09.011 [DOI] [PubMed] [Google Scholar]
- Amano, M. , Amiya, N. , Yokoyama, T. , Onikubo, K. , Yamamoto, N. , & Takahashi, A. (2016). Immunohistochemical detection of corticotropin‐releasing hormone (CRH) in the brain and pituitary of the hagfish, Eptatretus burgeri . General and Comparative Endocrinology, 236, 174–180. 10.1016/j.ygcen.2016.07.018 [DOI] [PubMed] [Google Scholar]
- Amano, M. , Mizusawa, N. , Okubo, K. , Amiya, N. , Mizusawa, K. , Chiba, H. , Yamamoto, N. , & Takahashi, A. (2014). Cloning of corticotropin‐releasing hormone (CRH) precursor cDNA and immunohistochemical detection of CRH peptide in the brain of the Japanese eel, paying special attention to gonadotropin‐releasing hormone. Cell and Tissue Research, 356(1), 243–251. 10.1007/s00441-013-1784-6 [DOI] [PubMed] [Google Scholar]
- Ando, H. , Hasegawa, M. , Ando, J. , & Urano, A. (1999). Expression of salmon corticotropin‐releasing hormone precursor gene in the preoptic nucleus in stressed rainbow trout. General and Comparative Endocrinology, 113(1), 87–95. 10.1006/gcen.1998.7182 [DOI] [PubMed] [Google Scholar]
- Bale, T. L. , Contarino, A. , Smith, G. W. , Chan, R. , Gold, L. H. , Sawchenko, P. E. , Koob, G. F. , Vale, W. W. , & Lee, K. F. (2000). Mice deficient for corticotropin‐releasing hormone receptor‐2 display anxiety‐like behaviour and are hypersensitive to stress. Nature Genetics, 24(4), 410–414. 10.1038/74263 [DOI] [PubMed] [Google Scholar]
- Barreiro‐Iglesias, A. , Anadón, R. , & Rodicio, M. C. (2010). New insights on the neuropeptide Y system in the larval lamprey brain: Neuropeptide Y immunoreactive neurons, descending spinal projections and comparison with tyrosine hydroxylase and GABA immunoreactivities. Neuroscience, 167(2), 396–413. 10.1016/j.neuroscience.2010.02.030 [DOI] [PubMed] [Google Scholar]
- Barreiro‐Iglesias, A. , Fernández‐López, B. , Sobrido‐Cameán, D. , & Anadón, R. (2017). Organization of alpha‐transducin immunoreactive system in the brain and retina of larval and young adult sea lamprey (Petromyzon marinus), and their relationship with other neural systems. Journal of Comparative Neurology, 525(17), 3683–3704. 10.1002/cne.24296 [DOI] [PubMed] [Google Scholar]
- Barreiro‐Iglesias, A. , Laramore, C. , Shifman, M. I. , Anadón, R. , Selzer, M. E. , & Rodicio, M. C. (2010). The sea lamprey tyrosine hydroxylase: CDNA cloning and in situ hybridization study in the brain. Neuroscience, 168(3), 659–669. 10.1016/j.neuroscience.2010.04.025 [DOI] [PubMed] [Google Scholar]
- Barreiro‐Iglesias, A. , & Rodicio, M. C. (2012). Las lampreas como modelo animal en estudios de regeneración tras lesión medular [Lampreys as an animal model in regeneration studies after spinal cord injury]. Revista De Neurologia, 55(3), 157–166. [PubMed] [Google Scholar]
- Barreiro‐Iglesias, A. , Villar‐Cerviño, V. , Anadón, R. , & Rodicio, M. C. (2008). Development and organization of the descending serotonergic brainstem‐spinal projections in the sea lamprey. Journal of Chemical Neuroanatomy, 36(2), 77–84. 10.1016/j.jchemneu.2008.06.001 [DOI] [PubMed] [Google Scholar]
- Barreiro‐Iglesias, A. , Villar‐Cerviño, V. , Villar‐Cheda, B. , Anadón, R. , & Rodicio, M. C. (2008). Neurochemical characterization of sea lamprey taste buds and afferent gustatory fibers: Presence of serotonin, calretinin, and CGRP immunoreactivity in taste bud bi‐ciliated cells of the earliest vertebrates. Journal of Comparative Neurology, 511(4), 438–453. 10.1002/cne.21844 [DOI] [PubMed] [Google Scholar]
- Behan, D. P. , Grigoriadis, D. E. , Lovenberg, T. , Chalmers, D. , Heinrichs, S. , Liaw, C. , & De Souza, E. B. (1996). Neurobiology of corticotropin releasing factor (CRF) receptors and CRF‐binding protein: Implications for the treatment of CNS disorders. Molecular Psychiatry, 1(4), 265–277. [PubMed] [Google Scholar]
- Brocard, F. , & Dubuc, R. (2003). Differential contribution of reticulospinal cells to the control of locomotion induced by the mesencephalic locomotor region. Journal of Neurophysiology, 90(3), 1714–1727. 10.1152/jn.00202.2003 [DOI] [PubMed] [Google Scholar]
- Cai, W. , Egertová, M. , Zampronio, C. G. , Jones, A. M. , & Elphick, M. R. (2021). Molecular identification and cellular localization of a corticotropin‐releasing hormone‐type neuropeptide in an echinoderm. Neuroendocrinology, 10.1159/000517087 [DOI] [PubMed] [Google Scholar]
- Capantini, L. , von Twickel, A. , Robertson, B. , & Grillner, S. (2017). The pretectal connectome in lamprey. Journal of Comparative Neurology, 525(4), 753–772. 10.1002/cne.24102 [DOI] [PubMed] [Google Scholar]
- Cardoso, J. C. R. , Bergqvist, C. A. , Félix, R. C. , & Larhammar, D. (2016). Corticotropin‐releasing hormone family evolution: Five ancestral genes remain in some lineages. Journal of Molecular Endocrinology, 57(1), 73–86. 10.1530/JME-16-0051 [DOI] [PubMed] [Google Scholar]
- Cardoso, J. C. R. , Bergqvist, C. A. , & Larhammar, D. (2020). Corticotropin‐releasing hormone (CRH) gene family duplications in lampreys correlate with two early vertebrate genome doublings. Frontiers in Neuroscience, 14, 672. 10.3389/fnins.2020.00672 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Chandrasekar, G. , Lauter, G. , & Hauptmann, G. (2007). Distribution of corticotropin‐releasing hormone in the developing zebrafish brain. Journal of Comparative Neurology, 505(4), 337–351. 10.1002/cne.21496 [DOI] [PubMed] [Google Scholar]
- Chaves, T. , Fazekas, C. L. , Horváth, K. , Correia, P. , Szabó, A. , Török, B. , Bánrévi, K. , & Zelena, D. (2021). Stress adaptation and the brainstem with focus on corticotropin‐releasing hormone. International Journal of Molecular Sciences, 22(16), 9090. 10.3390/ijms22169090 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Close, D. A. , Yun, S. S. , McCormick, S. D. , Wildbill, A. J. , & Li, W. (2010). 11‐deoxycortisol is a corticosteroid hormone in the lamprey. PNAS, 107(31), 13942–13947. 10.1073/pnas.0914026107 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Cornide‐Petronio, M. E. , Anadón, R. , Barreiro‐Iglesias, A. , & Rodicio, M. C. (2013). Serotonin 1A receptor (5‐HT1A) of the sea lamprey: CDNA cloning and expression in the central nervous system. Brain Structure & Function, 218(5), 1317–1335. 10.1007/s00429-012-0461-y [DOI] [PubMed] [Google Scholar]
- De Andrés MdelC, A. R. , Manso, M. J. , & González, M. J. (2002). Distribution of thyrotropin‐releasing hormone immunoreactivity in the brain of larval and adult sea lampreys, Petromyzon marinus L. Journal of Comparative Neurology, 453(4), 323–335. 10.1002/cne.10385 [DOI] [PubMed] [Google Scholar]
- De Arriba Pérez, M. C. (2007). Conexiones del techo óptico. Organización y desarrollo en lamprea y expresión de genes implicados en la vía retinotectal en pez cebra. Ph.D. Thesis, University of Vigo, Vigo, Spain.
- De Groef, B. , Van der Geyten, S. , Darras, V. M. , & Kühn, E. R. (2006). Role of corticotropin‐releasing hormone as a thyrotropin‐releasing factor in non‐mammalian vertebrates. General and Comparative Endocrinology, 146(1), 62–68. 10.1016/j.ygcen.2005.10.014 [DOI] [PubMed] [Google Scholar]
- Delarbre, C. , Gallut, C. , Barriel, V. , Janvier, P. , & Gachelin, G. (2002). Complete mitochondrial DNA of the hagfish, Eptatretus burgeri: The comparative analysis of mitochondrial DNA sequences strongly supports the cyclostome monophyly. Molecular Phylogenetics and Evolution, 22(2), 184–192. 10.1006/mpev.2001.1045 [DOI] [PubMed] [Google Scholar]
- El, A. , Pombal, M. A. , & Grillner, S. (1997). Diencephalic projection to reticulospinal neurons involved in the initiation of locomotion in adult lampreys Lampetra fluviatilis . Journal of Comparative Neurology, 389(4), 603–616. [PubMed] [Google Scholar]
- Endsin, M. J. (2013). Identification and characterization of developmentally regulated components of the stress axis in Petromyzon marinus . MS Thesis, University of Regina, Regina, Saskatchewan.
- Endsin, M. J. , Michalec, O. , Manzon, L. A. , Lovejoy, D. A. , & Manzon, R. G. (2017). CRH peptide evolution occurred in three phases: Evidence from characterizing sea lamprey CRH system members. General and Comparative Endocrinology, 240, 162–173. 10.1016/j.ygcen.2016.10.009 [DOI] [PubMed] [Google Scholar]
- Ficele, G. , Heinig, J. A. , Kawauchi, H. , Youson, J. H. , Keeley, F. W. , & Wright, G. M. (1998). Spatial and temporal distribution of proopiomelanotropin and proopiocortin mRNA during the life cycle of the sea lamprey: A qualitative and quantitative in situ hybridization study. General and Comparative Endocrinology, 110(2), 212–225. 10.1006/gcen.1998.7071 [DOI] [PubMed] [Google Scholar]
- Forey, P. , & Janvier, P. (1993). Agnathans and the origins of jawed vertebrates. Nature, 361, 129–134. 10.1038/361129a0 [DOI] [Google Scholar]
- Fox, J. H. , & Lowry, C. A. (2013). Corticotropin‐releasing factor‐related peptides, serotonergic systems, and emotional behavior. Frontiers in Neuroscience, 7, 169. 10.3389/fnins.2013.00169 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Furlong, R. F. , & Holland, P. W. (2002). Bayesian phylogenetic analysis supports monophyly of ambulacraria and of cyclostomes. Zoological Science, 19(5), 593–599. 10.2108/zsj.19.593 [DOI] [PubMed] [Google Scholar]
- Garcia, I. , Bhullar, P. K. , Tepe, B. , Ortiz‐Guzman, J. , Huang, L. , Herman, A. M. , Chaboub, L. , Deneen, B. , Justice, N. J. , & Arenkiel, B. R. (2016). Local corticotropin releasing hormone (CRH) signals to its receptor CRHR1 during postnatal development of the mouse olfactory bulb. Brain Structure & Function, 221(1), 1–20. 10.1007/s00429-014-0888-4 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Goossens, N. , Dierickx, K. , & Vandesande, F. (1977). Immunocytochemical demonstration of the hypothalamo‐hypophysial vasotocinergic system of Lampetra fluviatilis . Cell and Tissue Research, 177(3), 317–323. 10.1007/BF00220307 [DOI] [PubMed] [Google Scholar]
- Grätsch, S. , Auclair, F. , Demers, O. , Auguste, E. , Hanna, A. , Büschges, A. , & Dubuc, R. (2019). A brainstem neural substrate for stopping locomotion. Journal of Neuroscience, 39(6), 1044–1057. 10.1523/JNEUROSCI.1992-18.2018 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Grone, B. P. , & Maruska, K. P. (2015). Divergent evolution of two corticotropin‐releasing hormone (CRH) genes in teleost fishes. Frontiers in Neuroscience, 9, 365. 10.3389/fnins.2015.00365 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Hardisty, M. W. (1972). Quantitative and experimental studies on the interrenal tissues of the upstream migrant stage of the river lamprey, Lampetra fluviatilis L. General and Comparative Endocrinology, 18(3), 501–514. 10.1016/0016-6480(72)90030-5 [DOI] [PubMed] [Google Scholar]
- Herget, U. , Wolf, A. , Wullimann, M. F. , & Ryu, S. (2014). Molecular neuroanatomy and chemoarchitecture of the neurosecretory preoptic‐hypothalamic area in zebrafish larvae. Journal of Comparative Neurology, 522(7), 1542–1564. 10.1002/cne.23480 [DOI] [PubMed] [Google Scholar]
- Jaferi, A. , & Bhatnagar, S. (2007). Corticotropin‐releasing hormone receptors in the medial prefrontal cortex regulate hypothalamic‐pituitary‐adrenal activity and anxiety‐related behavior regardless of prior stress experience. Brain Research, 1186, 212–223. 10.1016/j.brainres.2007.07.100 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Kawano‐Yamashita, E. , Koyanagi, M. , Wada, S. , Tsukamoto, H. , Nagata, T. , & Terakita, A. (2015). Activation of transducin by bistable pigment parapinopsin in the pineal organ of lower vertebrates. PLoS One, 10(10), e0141280. 10.1371/journal.pone.0141280 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Keegan, C. E. , Herman, J. P. , Karolyi, I. J. , O'Shea, K. S. , Camper, S. A. , & Seasholtz, A. F. (1994). Differential expression of corticotropin‐releasing hormone in developing mouse embryos and adult brain. Endocrinology, 134(6), 2547–2555. 10.1210/endo.134.6.8194481 [DOI] [PubMed] [Google Scholar]
- Ketchesin, K. D. , Huang, N. S. , & Seasholtz, A. F. (2017). Cell type‐specific expression of corticotropin‐releasing hormone‐binding protein in GABAergic interneurons in the prefrontal cortex. Frontiers in Neuroanatomy, 11, 90. 10.3389/fnana.2017.00090 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Ketchesin, K. D. , Stinnett, G. S. , & Seasholtz, A. F. (2017). Corticotropin‐releasing hormone‐binding protein and stress: From invertebrates to humans. Stress (Amsterdam, Netherlands), 20(5), 449–464. 10.1080/10253890.2017.1322575 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Kuratani, S. , & Ota, G. K. (2008). The primitive versus derived traits in the developmental program of the vertebrate head: Views from cyclostome developmental studies. Journal of Experimental Zoology Part B: Molecular and Developmental Evolution, 310(4), 294–314. 10.1002/jez.b.21190 [DOI] [PubMed] [Google Scholar]
- Lamanna, F. , Hervas‐Sotomayor, F. , Oel, A. P. , Jandzik, D. , Sobrido‐Cameán, D. , Martik, M. L. , Green, S. A. , Brüning, T. , Mößinger, K. , Schmidt, J. , Schneider, C. , Sepp, M. , Murat, F. , Smith, J. J. , Bronner, M. E. , Rodicio, M. C. , Barreiro‐Iglesias, A. , Meulemans, D. , Arendt, D. , & Kaessmann, H. (2022). Reconstructing the ancestral vertebrate brain using a lamprey neural cell type atlas. BioRxiv. 2022.02.28.482278. 10.1101/2022.02.28.482278 [DOI]
- Lovejoy, D. A. , & de Lannoy, L. (2013). Evolution and phylogeny of the corticotropin‐releasing factor (CRF) family of peptides: Expansion and specialization in the vertebrates. Journal of Chemical Neuroanatomy, 54, 50–56. 10.1016/j.jchemneu.2013.09.006 [DOI] [PubMed] [Google Scholar]
- Meléndez‐Ferro, M. , Pérez‐Costas, E. , Villar‐Cheda, B. , Abalo, X. M. , Rodríguez‐Muñoz, R. , Rodicio, M. C. , & Anadón, R. (2002). Ontogeny of gamma‐aminobutyric acid‐immunoreactive neuronal populations in the forebrain and midbrain of the sea lamprey. Journal of Comparative Neurology, 446(4), 360–376. 10.1002/cne.10209 [DOI] [PubMed] [Google Scholar]
- Meléndez‐Ferro, M. , Pérez‐Costas, E. , Villar‐Cheda, B. , Rodríguez‐Muñoz, R. , Anadón, R. , & Rodicio, M. C. (2003). Ontogeny of gamma‐aminobutyric acid‐immunoreactive neurons in the rhombencephalon and spinal cord of the sea lamprey. Journal of Comparative Neurology, 464(1), 17–35. 10.1002/cne.10773 [DOI] [PubMed] [Google Scholar]
- Meléndez‐Ferro, M. , Villar‐Cheda, B. , Abalo, X. M. , Pérez‐Costas, E. , Rodríguez‐Muñoz, R. , Degrip, W. J. , Yáñez, J. , Rodicio, M. C. , & Anadón, R. (2002). Early development of the retina and pineal complex in the sea lamprey: Comparative immunocytochemical study. Journal of Comparative Neurology, 442(3), 250–265. 10.1002/cne.10090 [DOI] [PubMed] [Google Scholar]
- Miguel, T. T. , & Nunes‐de‐Souza, R. L. (2011). Anxiogenic and antinociceptive effects induced by corticotropin‐releasing factor (CRF) injections into the periaqueductal gray are modulated by CRF1 receptor in mice. Hormones and Behavior, 60(3), 292–300. 10.1016/j.yhbeh.2011.06.004 [DOI] [PubMed] [Google Scholar]
- Morales‐Delgado, N. , Castro‐Robles, B. , Ferrán, J. L. , Martinez‐de‐la‐Torre, M. , Puelles, L. , & Díaz, C. (2014). Regionalized differentiation of CRH, TRH, and GHRH peptidergic neurons in the mouse hypothalamus. Brain Structure & Function, 219(3), 1083–1111. 10.1007/s00429-013-0554-2 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Morona, R. , & González, A. (2009). Immunohistochemical localization of calbindin‐D28k and calretinin in the brainstem of anuran and urodele amphibians. Journal of Comparative Neurology, 515(5), 503–537. 10.1002/cne.22060 [DOI] [PubMed] [Google Scholar]
- Murakami, Y. , & Kuratani, S. (2008). Brain segmentation and trigeminal projections in the lamprey; with reference to vertebrate brain evolution. Brain Research Bulletin, 75(2–4), 218–224. 10.1016/j.brainresbull.2007.10.057 [DOI] [PubMed] [Google Scholar]
- Murakami, Y. , Uchida, K. , Rijli, F. M. , & Kuratani, S. (2005). Evolution of the brain developmental plan: Insights from agnathans. Developmental Biology, 280(2), 249–259. 10.1016/j.ydbio.2005.02.008 [DOI] [PubMed] [Google Scholar]
- Nozaki, M. , Ominato, K. , Shimotani, T. , Kawauchi, H. , Youson, J. H. , & Sower, S. A. (2008). Identity and distribution of immunoreactive adenohypophysial cells in the pituitary during the life cycle of sea lampreys, Petromyzon marinus . General and Comparative Endocrinology, 155(2), 403–412. 10.1016/j.ygcen.2007.07.012 [DOI] [PubMed] [Google Scholar]
- Nozaki, M. , Takahashi, A. , Amemiya, Y. , Kawauchi, H. , & Sower, S. A. (1995). Distribution of lamprey adrenocorticotropin and melanotropins in the pituitary of the adult sea lamprey, Petromyzon marinus . General and Comparative Endocrinology, 98(2), 147–156. 10.1006/gcen.1995.1055 [DOI] [PubMed] [Google Scholar]
- Peng, J. , Long, B. , Yuan, J. , Peng, X. , Ni, H. , Li, X. , Gong, H. , Luo, Q. , & Li, A. (2017). A quantitative analysis of the distribution of CRH neurons in whole mouse brain. Frontiers in Neuroanatomy, 11, 63. 10.3389/fnana.2017.00063 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Pepels, P. P. , Meek, J. , Wendelaar Bonga, S. E. , & Balm, P. H. (2002). Distribution and quantification of corticotropin‐releasing hormone (CRH) in the brain of the teleost fish Oreochromis mossambicus (tilapia). Journal of Comparative Neurology, 453(3), 247–268. 10.1002/cne.10377 [DOI] [PubMed] [Google Scholar]
- Pierre, J. , Mahouche, M. , Suderevskaya, E. I. , Repérant, J. , & Ward, R. (1997). Immunocytochemical localization of dopamine and its synthetic enzymes in the central nervous system of the lamprey Lampetra fluviatilis . Journal of Comparative Neurology, 380(1), 119–135. [PubMed] [Google Scholar]
- Pombal, M. A. , El Manira, A. , & Grillner, S. (1997). Organization of the lamprey striatum‐transmitters and projections. Brain Research, 766(1–2), 249–254. 10.1016/s0006-8993(97)00701-4 [DOI] [PubMed] [Google Scholar]
- Pombal, M. A. , & Puelles, L. (1999). Prosomeric map of the lamprey forebrain based on calretinin immunocytochemistry, Nissl stain and ancillary markers. Journal of Comparative Neurology, 414(3), 391–422. [PubMed] [Google Scholar]
- Pombal, M. A. , Yáñez Yáñez, J. , Marín, O. , González, A. , & Anadónón, R. (1999). Cholinergic and GABAergic neuronal elements in the pineal organ of lampreys, and tract‐tracing observations of differential connections of pinealofugal neurons. Cell and Tissue Research, 295(2), 215–223. 10.1007/s004410051227 [DOI] [PubMed] [Google Scholar]
- Potter, E. , Behan, D. P. , Linton, E. A. , Lowry, P. J. , Sawchenko, P. E. , & Vale, W. W. (1992). The central distribution of a corticotropin‐releasing factor (CRF)‐binding protein predicts multiple sites and modes of interaction with CRF. PNAS, 89(9), 4192–4196. 10.1073/pnas.89.9.4192 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Roberts, B. W. , Didier, W. , Rai, S. , Johnson, N. S. , Libants, S. , Yun, S. S. , & Close, D. A. (2014). Regulation of a putative corticosteroid, 17,21‐dihydroxypregn‐4‐ene,3,20‐one, in sea lamprey, Petromyzon marinus . General and Comparative Endocrinology, 196, 17–25. 10.1016/j.ygcen.2013.11.008 [DOI] [PubMed] [Google Scholar]
- Schneider, C. A. , Rasband, W. S. , & Eliceiri, K. W. (2012). NIH Image to ImageJ: 25 years of image analysis. Nature Methods, 9(7), 671–675. 10.1038/nmeth.2089 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Seasholtz, A. F. , Valverde, R. A. , & Denver, R. J. (2002). Corticotropin‐releasing hormone‐binding protein: Biochemistry and function from fishes to mammals. Journal of Endocrinology, 175(1), 89–97. 10.1677/joe.0.1750089 [DOI] [PubMed] [Google Scholar]
- Shaughnessy, C. A. , Barany, A. , & McCormick, S. D. (2020). 11‐Deoxycortisol controls hydromineral balance in the most basal osmoregulating vertebrate, sea lamprey (Petromyzon marinus). Science Reports, 10(1), 12148. 10.1038/s41598-020-69061-4 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Shaughnessy, C. A. , & McCormick, S. D. (2021). 11‐Deoxycortisol is a stress responsive and gluconeogenic hormone in a jawless vertebrate, the sea lamprey (Petromyzon marinus). Journal of Experimental Biology, 224(11), jeb241943. 10.1242/jeb.241943 [DOI] [PubMed] [Google Scholar]
- Sirota, M. G. , Di Prisco, G. V. , & Dubuc, R. (2000). Stimulation of the mesencephalic locomotor region elicits controlled swimming in semi‐intact lampreys. European Journal of Neuroscience, 12(11), 4081–4092. 10.1046/j.1460-9568.2000.00301.x [DOI] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , Anadón, R. , & Barreiro‐Iglesias, A. (2021). Expression of urocortin 3 mRNA in the central nervous system of the sea lamprey Petromyzon marinus . Biology (Basel), 10(10), 978. 10.3390/biology10100978 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , & Barreiro‐Iglesias, A. (2022). Morpholino studies shed light on the signaling pathways regulating axon regeneration in lampreys. Neural Regeneration Research, 17(7), 1475–1477. 10.4103/1673-5374.330597 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , Tostivint, H. , Mazan, S. , Rodicio, M. C. , Rodríguez‐Moldes, I. , Candal, E. , Anadón, R. , & Barreiro‐Iglesias, A. (2020). Differential expression of five prosomatostatin genes in the central nervous system of the catshark Scyliorhinus canicula . Journal of Comparative Neurology, 528(14), 2333–2360. 10.1002/cne.24898 [DOI] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , Yáñez‐Guerra, L. A. , Deber, A. , Freire‐Delgado, M. , Cacheiro‐Vázquez, R. , Rodicio, M. C. , Tostivint, H. , Anadón, R. , & Barreiro‐Iglesias, A. (2021). Differential expression of somatostatin genes in the central nervous system of the sea lamprey. Brain Structure & Function, 226(4), 1031–1052. 10.1007/s00429-021-02224-9 [DOI] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , Yáñez‐Guerra, L. A. , Deber, A. , Rodicio, M. C. , & Barreiro‐Iglesias, A. (2021). Expression of kisspeptin 1 in the brain of the adult sea lamprey Petromyzon marinus . Life, 11(11), 1174. 10.3390/life11111174 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , Yáñez‐Guerra, L. A. , Lamanna, F. , Conde‐Fernández, C. , Kaessmann, H. , Elphick, M. R. , Anadón, R. , Rodicio, M. C. , & Barreiro‐Iglesias, A. (2019). Galanin in an agnathan: Precursor identification and localisation of expression in the brain of the sea Lamprey Petromyzon marinus . Frontiers in Neuroanatomy, 13, 83. 10.3389/fnana.2019.00083 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Sobrido‐Cameán, D. , Yáñez‐Guerra, L. A. , Robledo, D. , López‐Varela, E. , Rodicio, M. C. , Elphick, M. R. , Anadón, R. , & Barreiro‐Iglesias, A. (2020). Cholecystokinin in the central nervous system of the sea lamprey Petromyzon marinus: Precursor identification and neuroanatomical relationships with other neuronal signalling systems. Brain Structure & Function, 225(1), 249–284. 10.1007/s00429-019-01999-2 [DOI] [PubMed] [Google Scholar]
- Stephenson‐Jones, M. , Floros, O. , Robertson, B. , & Grillner, S. (2012). Evolutionary conservation of the habenular nuclei and their circuitry controlling the dopamine and 5‐hydroxytryptophan (5‐HT) systems. PNAS, 109(3), E164–173. 10.1073/pnas.1119348109 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Takahashi, A. , Nakata, O. , Moriyama, S. , Nozaki, M. , Joss, J. M. , Sower, S. A. , & Kawauchi, H. (2006). Occurrence of two functionally distinct proopiomelanocortin genes in all modern lampreys. General and Comparative Endocrinology, 148(1), 72–78. 10.1016/j.ygcen.2005.09.003 [DOI] [PubMed] [Google Scholar]
- Todorovic, C. , Jahn, O. , Tezval, H. , Hippel, C. , & Spiess, J. (2005). The role of CRF receptors in anxiety and depression: Implications of the novel CRF1 agonist cortagine. Neuroscience and Biobehavioral Reviews, 29(8), 1323–1333. 10.1016/j.neubiorev.2005.04.014 [DOI] [PubMed] [Google Scholar]
- Vale, W. , Spiess, J. , Rivier, C. , & Rivier, J. (1981). Characterization of a 41‐residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta‐endorphin. Science, 213(4514), 1394–1397. 10.1126/science.6267699 [DOI] [PubMed] [Google Scholar]
- Valentino, R. J. , Kosboth, M. , Colflesh, M. , & Miselis, R. R. (2000). Transneuronal labeling from the rat distal colon: Anatomic evidence for regulation of distal colon function by a pontine corticotropin‐releasing factor system. Journal of Comparative Neurology, 417(4), 399–414. [PubMed] [Google Scholar]
- Valverde, R. A. , Seasholtz, A. F. , Cortright, D. N. , & Denver, R. J. (2001). Biochemical characterization and expression analysis of the Xenopus laevis corticotropin‐releasing hormone binding protein. Molecular and Cellular Endocrinology, 173(1–2), 29–40. 10.1016/s0303-7207(00)00437-8 [DOI] [PubMed] [Google Scholar]
- Verstegen, A. M. J. , Vanderhorst, V. , Gray, P. A. , Zeidel, M. L. , & Geerling, J. C. (2017). Barrington's nucleus: Neuroanatomic landscape of the mouse “pontine micturition center.” Journal of Comparative Neurology, 525(10), 2287–2309. 10.1002/cne.24215 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Villar‐Cerviño, V. , Abalo, X. M. , Villar‐Cheda, B. , Meléndez‐Ferro, M. , Pérez‐Costas, E. , Holstein, G. R. , Martinelli, G. P. , Rodicio, M. C. , & Anadón, R. (2006). Presence of glutamate, glycine, and gamma‐aminobutyric acid in the retina of the larval sea lamprey: Comparative immunohistochemical study of classical neurotransmitters in larval and postmetamorphic retinas. Journal of Comparative Neurology, 499(5), 810–27. 10.1002/cne.21136 [DOI] [PubMed] [Google Scholar]
- Villar‐Cerviño, V. , Barreiro‐Iglesias, A. , Anadón, R. , & Rodicio, M. C. (2008). Distribution of glycine immunoreactivity in the brain of adult sea lamprey (Petromyzon marinus). Comparison with gamma‐aminobutyric acid. Journal of Comparative Neurology, 507(3), 1441–1463. 10.1002/cne.21634 [DOI] [PubMed] [Google Scholar]
- Villar‐Cheda, B. , Pérez‐Costas, E. , Meléndez‐Ferro, M. , Abalo, X. M. , Rodríguez‐Muñoz, R. , Anadón, R. , & Rodicio, M. C. (2006). Cell proliferation in the forebrain and midbrain of the sea lamprey. Journal of Comparative Neurology, 494(6), 986–1006. 10.1002/cne.20851 [DOI] [PubMed] [Google Scholar]
- Wamsteeker Cusulin, J. I. , Füzesi, T. , Watts, A. G. , & Bains, J. S. (2013). Characterization of corticotropin‐releasing hormone neurons in the paraventricular nucleus of the hypothalamus of Crh‐IRES‐Cre mutant mice. PLoS One, 8(5), e64943. 10.1371/journal.pone.0064943 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Wang, Y. , Hu, P. , Shan, Q. , Huang, C. , Huang, Z. , Chen, P. , Li, A. , Gong, H. , & Zhou, J. N. (2021). Single‐cell morphological characterization of CRH neurons throughout the whole mouse brain. BMC Biology, 19(1), 47. 10.1186/s12915-021-00973-x [DOI] [PMC free article] [PubMed] [Google Scholar]
- Yamamoto, K. , Bloch, S. , & Vernier, P. (2017). New perspective on the regionalization of the anterior forebrain in Osteichthyes. Development Growth and Differentiation, 59(4), 175–187. 10.1111/dgd.12348 [DOI] [PMC free article] [PubMed] [Google Scholar]
- Yáñez, J. , & Anadón, R. (1994). Afferent and efferent connections of the habenula in the larval sea lamprey (Petromyzon marinus L.): An experimental study. Journal of Comparative Neurology, 345(1), 148–160. 10.1002/cne.903450112 [DOI] [PubMed] [Google Scholar]
- Yáñez, J. , Pombal, M. A. , & Anadón, R. (1999). Afferent and efferent connections of the parapineal organ in lampreys: A tract tracing and immunocytochemical study. Journal of Comparative Neurology, 403(2), 171–189. 10.1002/(sici)1096-9861(19990111)403:2<171::aid-cne3>3.0.co;2-m [DOI] [PubMed] [Google Scholar]
- Youson, J. H. (1972). Structure and distribution of interstitial cells (presumptive interrenal cells) in the opisthonephric kidneys of larval and adult sea lamprey, Petromyzon marinus L. General and Comparative Endocrinology, 19(1), 56–68. 10.1016/0016-6480(72)90006-8 [DOI] [PubMed] [Google Scholar]
- Yuan, Y. , Wu, W. , Chen, M. , Cai, F. , Fan, C. , Shen, W. , Sun, W. , & Hu, J. (2019). Reward inhibits paraventricular CRH neurons to relieve stress. Current Biology, 29(7), 1243–1251. e4. 10.1016/j.cub.2019.02.048 [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Data Availability Statement
Antibodies and histological data generated during this research are available from the corresponding author upon reasonable request.
