Skip to main content
Infection and Immunity logoLink to Infection and Immunity
. 2001 Jun;69(6):4019–4026. doi: 10.1128/IAI.69.6.4019-4026.2001

Improved Pattern for Genome-Based Screening Identifies Novel Cell Wall-Attached Proteins in Gram-Positive Bacteria

Robert Janulczyk 1,*, Magnus Rasmussen 1,*
Editor: E I Tuomanen1
PMCID: PMC98464  PMID: 11349071

Abstract

With a large number of sequenced microbial genomes available, tools for identifying groups or classes of proteins have become increasingly important. Here we present an improved pattern for the identification of cell wall-attached proteins (CWPs), a group of proteins with diverse and important functions in gram-positive bacteria. This tripartite pattern is based on analysis of 65 previously described cell wall-attached proteins and takes into account the three principal requirements for cell wall sorting; a sortase target region (LPXTGX), a membrane-spanning region, and a charged stop-transfer tail. In five different genomes of gram-positive bacteria, the tripartite pattern identified a total of 35 putative CWPs, 19 of which were novel. The specificity and sensitivity of the tripartite pattern are higher than those of the classical pattern, which is based solely on the sortase target region. Several putative CWPs with atypical sortase target regions were identified. In the complete genome of the important human pathogen Streptococcus pyogenes, the tripartite pattern identified 14 putative CWPs. Seven of the putative S. pyogenes proteins were novel, and two of these were a 5′ nucleotidase and a pullulanase. This study represents the first whole-genome screening for CWPs, and we conclude that the tripartite pattern is highly suitable for this purpose. Identification of CWPs using this pattern offers important possibilities in the study of the pathogenesis and physiology of gram-positive bacteria.


More than 30 microbial genomes have been completely sequenced, and sequencing of many more is in progress (20). The public availability of completed genomes provides researchers in life sciences with new possibilities to address important biological issues. However, the annotation of complete genome sequences frequently fails to classify a significant proportion (40 to 60%) of gene products (20). These new challenges may be approached in silico. For example, analyses of functionally or structurally related proteins allow classification into families and subfamilies (29, 42), and such efforts may result in the identification of sequence motifs (46). (The terms “motif” and “pattern” are used according to the guidelines in the PROSITE documentation, which can be found at the website of ExPASy [www.expasy.ch/tools].) Traditionally, a collection of patterns are applied to a single protein in order to identify the presence of motifs, which offers the possibility of making structural or functional predictions. Conversely, a well-defined pattern could facilitate classification of gene products at the genome level (8).

The bacterial surface is a crucial site of interaction between microbe and host. Bacterial surface proteins constitute a diverse group of molecules with important functions, such as adhesion, signaling, and defense mechanisms. Moreover, surface proteins are potential drug or vaccine targets. Surface proteins in gram-positive bacteria are typically lipoproteins (52) or cell wall-attached proteins (CWPs) (27, 35). CWPs of gram-positive bacteria have a conserved COOH-terminal region containing a hexapeptide sequence known as the LPXTGX motif (18). The LPXTGX motif is followed by a hydrophobic stretch of amino acids and a short charged tail, all three of which are necessary for efficient sorting of a protein to the cell wall (49). A membrane-associated enzyme called sortase catalyzes the transpeptidation of the threonine residue in the motif to the amino acid cross bridge of the peptidoglycan cell wall (15, 33, 34, 36, 47, 53–55). Homologues of the srtA gene, which encodes the sortase, have been found in many genomes of gram-positive bacteria, indicating that this mechanism of sorting is universal among gram-positive bacteria (33). The hydrophobic region next to the LPXTGX motif traverses the plasma membrane, while the charged tail probably acts as a stop-transfer signal, retaining the protein at the bacterial surface until further processing occurs (48, 49).

This work attempted to refine and develop the previously described motif that distinguishes CWPs. We suggest a tripartite motif, which takes into account the three principal requirements for efficient sorting. The pattern devised for this motif was used in a screening of the complete Streptococcus pyogenes genome, and a number of novel putative CWPs were identified. Compared to the classical pattern (LPXTGX), the tripartite pattern has increased sensitivity and specificity as shown by analysis of six bacterial genomes. The procedures employed do not require extensive bioinformatics resources and are thus readily accessible to the research community.

MATERIALS AND METHODS

The collection of 65 COOH-terminal sorting signals was from a recent review (Table 1 in reference 35). Translation of genome sequences and searches with the tripartite and LPXTGX patterns were performed using MacVector (Oxford Molecular Ltd., version 6.5.3). The website of the University of Oklahoma's Advanced Center for Genome Technology was used to access genomes of S. pyogenes, Staphylococcus aureus (NCTC 8325), and Streptococcus mutans (UA159). The genomes of Enterococcus faecalis (V583) and Streptococcus pneumoniae (type 4) were obtained from The Institute for Genomic Research website. The Escherichia coli (K-12) genome was obtained from the University of Wisconsin—Madison website. BLASTp (version 2.0) searches were performed at the National Center for Biotechnology Information website. The tBLASTn searches of the S. pyogenes genomes were done using either the BLAST server at Oklahoma University (strain SF370) or the server at the Sanger Centre, University of Newcastle (strain Manfredo). Signal sequence predictions were made using the SignalP (version 1.1) program at the website of the Center for Biological Sequence Analysis (37). Only proteins where the SignalP combined cleavage site score (Y) exceeded the threshold were considered positive. PROSITE scans for detection of motifs in novel CWPs were made at the website of Pole Bio-Informatique Lyonnais.

Partial or whole-genome screening was conducted by translating genomic DNA sequences in all six reading frames to generate amino acid files, to which the patterns were applied. The sequence analysis software used was incapable of excluding matches containing stop codons within the motif, and these matches were thus excluded manually. A match was considered false positive if not located within an open reading frame (ORF) encoding a putative protein of at least 100 amino acids. Moreover, if the match was located within an ORF but more than 50 amino acids from the COOH-terminus of the putative protein, it was also considered a false-positive hit. Remaining matches were regarded as true positives.

RESULTS

Construction of a tripartite pattern by analysis of COOH-terminal sorting signals.

A recently published list of 65 CWPs from 19 different gram-positive bacteria was used to obtain a set of COOH-terminal sorting signals (35). COOH-terminal amino acid sequences from each protein were tentatively divided into three parts for further analysis: a sortase target region, a membrane-spanning region, and a charged tail region. The sortase target region consists of six amino acids, where the first residue corresponds to leucine in the LPXTGX motif. The first and second positions of this region were completely conserved in all 65 CWPs and contained leucine and proline, respectively. In positions 3 to 6, a variety of amino acids were found (Fig. 1A). Amino acids that occurred more than once in a particular position were considered appropriate for inclusion in a new pattern (Fig. 1A). For each position, more than 90% of the variation was thus included. The membrane-spanning region contains at least 15 amino acids, which is sufficient to traverse the membrane (48). Most proteins contained a gap of variable length between the sortase target region and the first hydrophobic amino acid. We therefore chose to define the membrane-spanning region in relation to the charged tail. Thus, the 15 amino acids preceding a COOH-terminal cluster of charged residues (K or R) were considered membrane spanning for the purpose of this analysis. There are no theoretical or experimental indications that specific positions in the membrane-spanning region are important. Thus, the amino acid distribution was calculated for the membrane-spanning region as a whole (Fig. 1B). The nine most frequent amino acids together represented more than 95% of the 15 positions in the 65 CWPs. Finally, the charged tail region, starting (+1) with a lysine or arginine residue immediately following the membrane-spanning region, was analyzed. Since several proteins had a charged tail of four or five amino acids only, an amino acid distribution was calculated for the first five positions (Fig. 1C). The results showed that the first three positions were dominated by lysine or arginine residues. This is in accordance with experimental data showing that two of three consecutive residues in the charged tail must be lysine or arginine to allow efficient sorting (48).

FIG. 1.

FIG. 1

Analysis of the cell wall sorting signal in 65 CWPs. (A) Amino acid distribution in positions 3 to 6 of the sortase target region. Amino acids included in the novel pattern are in underlined boldface. (B) Amino acid distribution in the membrane-spanning region. Amino acids included in the novel pattern are in bold. (C) Amino acid distribution in the first five positions of the charged tail.

Based on the analysis of known CWPs, a pattern in three parts was constructed (Table 1). An overall consideration was that the pattern should properly identify all proteins in the original data set as CWPs. In addition to this requirement the pattern had to be specific. Several variant patterns were tested in preliminary analyses of the S. pyogenes genome and the original set of CWPs (data not shown). It became evident that most known CWPs contain membrane-spanning domains significantly longer than the minimum 15 amino acids used to define this region. By allowing three mismatches it was possible to extend the region to 17 residues. The first part of the tripartite pattern is similar to the classical LPXTGX pattern but is less strict, as it allows one mismatch and includes variant residues in positions 4 and 5. The choice to include alanine in position 4 has experimental support, as a T→A substitution does not affect sorting of staphylococcal protein A (49). The reduced stringency in the first part is balanced by requiring 14 of 17 residues for the membrane-spanning domain and 2 of 3 residues for the charged tail. A sequence must contain all three parts of the motif in order to be identified by the pattern.

TABLE 1.

The classical LPXTGX pattern and the tripartite pattern

Type Patterna Thresholdb
Classical L-P-X-T-G-[STGADE] 6/6
Tripartite L-P-[SKTAQEHLDN]-[TA]-[GN]-[EDASTV]- 5/6
X(0,8)-[VIFAGTSML](17)- 14/17
[RK]-[RK](2) 2/3
a

Alternative residues are in brackets. Underlined residues are mandatory. The gap X(0,8) between parts 1 and 2 is from 0 to 8 amino acids. Numbers in parentheses indicate repeated occurrences of the preceding residue. 

b

Values are presented as the required threshold for a hit/total number of residues in the pattern. 

Specificity and sensitivity of the tripartite pattern.

When applied to the set of 65 previously described CWPs, the sensitivity of the tripartite pattern was 98%, compared to 80% for the LPXTGX pattern (the tripartite pattern fails to properly classify the S. mutans dextranase, due to its unusually long gap). The tripartite and the LPXTGX patterns were used to search for genes encoding CWPs in the entire genome of S. pyogenes. In addition, a partial screening was performed on the genomes of E. faecalis, S. aureus, S. mutans, S. pneumoniae, and E. coli (the gap length between the first and second part of the tripartite pattern was increased to 11 amino acids for the analysis of S. mutans, since at least one CWP [dextranase] from this species has a longer gap). In all the genomes of gram-positive bacteria, both patterns identified genes encoding putative CWPs, of which approximately 50% were previously described (Table 2). In total, the tripartite pattern identified 35 genes and the LPXTGX pattern identified 29 genes encoding putative or known CWPs. Thus, the sensitivity of the tripartite pattern was 21% higher than that of the LPXTGX pattern. For all gram-positive bacterial genomes analyzed, the tripartite pattern had a higher sensitivity than the classical pattern. Also, the specificity of the tripartite pattern was higher (8 false positives) than that of the LPXTGX pattern (24 false positives) (Table 2). In one particular case, a putative protein containing the LPXTGX motif in its COOH-terminal part was considered false positive. This protein, which was not identified by the tripartite pattern, lacked both a hydrophobic region and a charged tail; thus, it cannot be attached to the cell wall (48). For comparison, the genome of the gram-negative bacterium E. coli was included, and neither pattern identified proteins containing gram-positive sorting signals in their COOH-terminal part. We made several attempts to increase the sensitivity of the tripartite pattern by allowing more mismatches in the three different parts of the pattern. However, this invariably led to a decreased specificity without apparent gain of sensitivity (data not shown).

TABLE 2.

Comparison of patterns used for detection of CWPs

Organism Motif No. positivea No. false positiveb
No ORF ORF
E. coli (10% of 4.64 Mbp) Tripartite 0 (0) 2 0
LPXTGX 0 (0) 8 0
E. faecalis (21% of 3.38 Mbp) Tripartite 8 (3) 1 0
LPXTGX 7 (3) 4 1
S. aureus (11% of 2.8 Mbp) Tripartite 6 (4) 0 0
LPXTGX 5 (4) 0 1
S. mutans (647 kbp) Tripartite 3 (2) 0 1
LPXTGX 2 (2) 2 2
S. pneumoniae (21% of 2.16 Mbp) Tripartite 4 (1) 1 1
LPXTGX 3 (1) 0 1
S. pyogenes (100% of 1.85 Mbp) Tripartite 14 (6) 2 0
LPXTGX 12 (5) 4 1
All (4.41 Mbp) Tripartite 35 (16) 6 2
LPXTGX 29 (15) 18 6
a

Number of hits where the match is found in the COOH-terminal region of a putative protein. Numbers in parentheses are the numbers of positive hits that represent previously described CWPs. 

b

Number of hits where the match is not located in a predicted ORF or not in the COOH-terminal region of the putative protein encoded by such an ORF. 

The CWPs encoded by an S. pyogenes genome.

In the complete genome of the S. pyogenes M1 strain SF370, the tripartite pattern identified 14 genes encoding putative CWPs (Table 3). Twelve of these genes were identified using the LPXTGX pattern. The tripartite pattern successfully identified the six previously known CWPs (11, 21, 30, 31, 39, 44, 45, 59) expected to be present in the SF370 strain. In addition, the tripartite pattern identified a putative CWP containing a subtilase type of serine protease motif (3). This protein is similar to the C5a peptidase of Streptococcus agalactiae and S. pyogenes (11, 12). A fragment of this serine protease was recently described to be present in culture supernatant of S. pyogenes (28). Recently, an LPXTGX-containing hyaluronidase (HylA) in S. pyogenes was described (24). In S. pneumoniae, a similar hyaluronidase containing a typical cell wall sorting signal has been proposed to be cell wall attached (5, 25). The patterns used here failed to detect HylA in S. pyogenes, but a tBLASTn search with HylA showed that hylA is present in the SF370 strain. The gene encodes a HylA protein lacking the cell wall sorting region. However, immediately downstream from the stop codon of hylA, a sequence encoding a characteristic cell wall sorting signal was present. Also, in the S. pyogenes strain Manfredo, a single stop codon separated the hylA gene from a sequence encoding a cell wall attachment signal.

TABLE 3.

Putative and known CWPs in the complete genome of S. pyogenes

Identification Size (aa)a Repeats COOH terminus Reference or comment(s)b
Previously identified proteins
 M1 484 Yes LPSTGETANPFFTAAALTVMATAGVAAVVKRKEEN 21
 GRAB 217 Yes LPTTGEESNPFFTAAALAIMVSTGVLVVSSKCKEN 45
 OrfX 379 Yes LPSTGEKAQPLFIATMTLMSLFGSLLVTKRQKETKK 39
 C5a peptidase 1,175 Yes LPTTNDKDTNRLHLLKLVMTTFFLGLVAHIFKTKRTED 11
 Serine protease 1,647 No LPSTGEKMGLKLRIVGLVLLGLTCVFSRKKSTKD 28
 SclA 348 Yes LPATGEQANPFFTAAAVAVMTTAGVLAVTKRKENN 44, 30
 SclB 228 Yes LPATGETTNPFFTAAAVAIMTTAGVVAVAKRQENN 31, 59; M. Rasmussen and L. Björck, submitted for publication
Proteins with suggested function
 SntA 670 No LPITGDNYKMSPIMTILALISLGGLNAFIKKRKS Probable 5′ nucleotidases in Deinococcus radiodurans, E = 2 × 10−57
 SpuA 1,165 No LPKTGEASSKGLLAAGIALLLLAISLLMKRQKD Alkaline amylopullulanase in Bacillus sp. E = 0 (D78258)
Proteins with unknown function
 Cwp1 313 No LPQTGERFSYYPVLLGLMILGLTPIMIPKKINN No significant match
 Cwp2 910 No LPKTGDSLVYVITLLGTASLLVPILLLTKGKKES (i) Probable secreted protein in Streptomyces coelicolor, E = 8 × 10−86 (T36922); (ii) Hypothetical protein in Treponema pallidum, E = 2 × 10−68 (AE001229)
 Cwp3 215 No LPSTGEMVSYVSALGIVLVATITLYSIYKKLKTSK Unknown protein in S. pyogenes, E = 3 × 10−19 (U49397)
 Cwp4 1,008 No LPRTGSKGSFVYGILGYTSVALLSLITAIKKKKY (i) Surface antigen BspA in Bacteroides forsythus, E = 4 × 10−21 (T31094); (ii) PcpA in S. pneumoniae, E = 3 × 10−7 (Z82001)
 Cwp5 2,059 Yes LPKSGDANSIVLVGLGVMSLLLGMVLYSKKKESKD (i) Extracellular matrix binding protein in Abiotrophia defectiva, E = 2 × 10−61 (T31110); (ii) EF protein in S. suis, E = 5 × 10−49 (S33441)
a

aa, amino acids. 

b

For previously identified proteins, relevant references are given. Previously unknown proteins were used as queries in a BLAST search of the GenBank database. The best hits are listed, with accession numbers and expect (E) values. 

Two novel putative CWPs with pronounced similarities to previously characterized proteins were identified. The first protein, designated SntA (streptococcal nucleotidase A), shows a high degree of similarity to 5′ nucleotidases and contains a 5′ nucleotidase motif (61). Several reports have indicated that this enzyme can be surface associated in bacteria and may serve nutritional needs (2, 60, 61). The second protein is a putative pullulanase that we designate SpuA (streptococcal pullulanase A). Pullulanase is an enzyme that hydrolyzes α-1,6 linkages in pullulan and other branched carbohydrates (56). Pullulanases are found at the cell surface in several bacterial species (9, 10, 16, 41). The SpuA in S. pyogenes shows a high degree of similarity to the α-1,6 hydrolyzing region of the amylopullulanase from Bacillus spp., and the putative catalytic site is completely conserved between these proteins (22). However, the S. pyogenes enzyme is smaller and lacks the amylase region of the Bacillus enzyme, which catalyzes the hydrolysis of α-1,4 linkages (22).

Five putative proteins without pronounced similarities to proteins in databases were also identified, and for the purpose of this work they were designated Cwp1 to Cwp5. The proteins with the highest similarities to Cwp1 to Cwp5 were mostly bacterial cell surface-associated proteins, but at this point it is not possible to suggest a function for the S. pyogenes proteins. Homologues to Cwp1 to Cwp5 were present in the genome of S. pyogenes strain Manfredo. They all had cell wall sorting signals, but the Cwp3 homologue in strain Manfredo contained an atypical sequence that could be identified only with the tripartite pattern.

Identification of putative proteins containing atypical sortase target regions.

Analogous to the screening performed on S. pyogenes, the partial screening of genomes from S. pneumoniae, E. faecalis, S. aureus, and S. mutans resulted in identification of CWPs not detected by the classical pattern. Among the 35 proteins found, seven proteins contained an atypical sortase target region (Table 4). All proteins contained a typical membrane-spanning region and charged tail. All but one (Cwp5) had putative signal sequences. Databases were searched for proteins similar to these atypical CWPs, and the most similar proteins were all bacterial surface proteins, or potentially surface attached (Bacillus amylopullulanase). Among the putative CWPs with an atypical sortase target region, the pullulanase of S. pneumoniae and the C5a peptidase of S. pyogenes were previously described as surface located (9, 57). The S. pneumoniae pullulanase is homologous to SpuA in S. pyogenes (see above). Deviations from the classical sortase target region were found in positions 4, 5, and 6. The putative CWP in S. aureus and the Cwp3 homologue from S. pyogenes strain Manfredo contained alanine in position 4, which is fully compatible with efficient sorting (49). Like the C5a peptidase, which is a known CWP, the putative CWP in E. faecalis has asparagine in position 5 (11, 57, 58). Cwp5 contains a serine instead of a threonine in position 4. Opacity factor, a CWP found in certain serotypes of S. pyogenes, also shows this variation (43). These examples show that use of the tripartite pattern increases the possibility of performing accurate and complete genome screenings.

TABLE 4.

Atypical sortase target regions

Organism Protein size (aa)a SignalPb Sequencec Identification or similarityd
E. faecalis 951 Yes (1–19) LPMTNT Aggregation substance in Enterococcus faecium, E = 2 × 10−4 (U91527)
S. aureus 635 Yes (1–37) LPKAGE Lmp1 in Mycoplasma hominis, E = 3 × 10−11 (X81475)
S. mutans 507 Yes (1–35) LPDTGV Cell surface antigen SpaA in Streptococcus sobrinus, E = 7 × 10−4 (A43607)
S. pneumoniae 1,269 Yes (1–32) LPNTGI SpuA (9)
S. pyogenes 1,175 Yes (1–25) LPTTND C5a peptidase (11)
S. pyogenes 2,059 No LPKSGD Cwp5
S. pyogenes 189 Yes (1–20) LPLAGE Cwp3 homologue, strain Manfredo
a

aa, amino acids. 

b

Computer prediction of signal peptide sequence. Numbers in parentheses indicate the position of the leader peptide. 

c

The six amino acid residues of the sortase target region. Residues that do not conform to the classical pattern are underlined. 

d

Results from BLAST search of GenBank databases. Accession numbers and expect (E) values are shown. For previously described proteins, relevant references are given. 

DISCUSSION

Analysis of whole genomes, i.e., similarity searches or targeted gene identification, has become an integral part of research in the life sciences. In microbiology, genomics may help to identify virulence factors, as well as drug or vaccine targets (50, 51). However, the readiness with which sequence information can be utilized is often hampered by limited annotation. The number of unclassified genes is steadily increasing, and there is a need for new tools for functional and structural classification of genes and gene products (4). The use of specific and sensitive patterns is one way to classify putative proteins into groups or families. In this work we present a refined pattern that readily detects CWPs of gram-positive bacteria, and we have successfully applied this pattern in whole-genome screening procedures. CWPs comprise a diverse group of bacterial surface proteins, sharing a common theme of cell wall sorting (35). Several studies have shown that isogenic mutants lacking specific CWPs are attenuated in virulence in animal models (1, 13). A sortase mutant in S. aureus, which missorts all CWPs, was significantly attenuated in virulence compared to the corresponding wild-type strain (32). Also, surface proteins are potential vaccine targets, and a recent study convincingly showed the strength of genome screening as an initial step in the identification of vaccine candidates (38). Among the CWPs discussed in this work, the M protein has been used for the development of a multivalent group A streptococcal vaccine (14). Moreover, the pneumococcal pullulanase is immunogenic and highly conserved, making it a potential target for vaccine development (9). Cell wall sorting signals have also been used to create fusion proteins with heterologous antigens, which can thus be expressed in a gram-positive commensal for oral vaccination (17, 40). Moreover, CWPs from gram-positive bacteria are known to interact with human proteins and as such may be used as biotechnological tools. For example, protein A of S. aureus (19), protein G of group C and G streptococci (7), and protein L of Peptostreptococcus magnus (6) are widely used as tools for purification or detection of immunoglobulins. The pattern described herein presents an opportunity to identify novel CWPs, which may be virulence factors or vaccine targets or which may be used as biotechnological tools. Presumably, the complete set of CWPs in any gram-positive bacterium can be obtained by using the tripartite motif. Optimization of the pattern may be needed for certain species in order to approach completeness. For this purpose, the most evident modification is to increase the gap length, as selected CWPs exceed the maximum gap of eight residues. For S. mutans and S. aureus, there are such examples, and a marginal gain of sensitivity may be accomplished by increasing the gap. Such a change (maximum gap = 11) was made in the partial screening of S. mutants, which allowed identification of dextranase. In the complete screening of S. pyogenes, an increase in gap (data not shown) did not result in additional hits. Another strategy could be to exclude the membrane-spanning domain, which is the most loosely defined component, thus operating with a bipartite motif. This will greatly increase the number of false-positive hits but may possibly offer a somewhat higher sensitivity.

A common theme of previously described CWPs is the presence of repeated sequences, sometimes involved in protein-protein interactions (35). Only one of the seven novel putative CWPs identified in S. pyogenes contained such repeats. Instead, at least four CWPs were predicted to have enzymatic activity. From our data on the S. pyogenes repertoire of CWPs it seems that cell wall-attached enzymes are more common than previously recognized. Whole-genome analyses of other genomes from gram-positive bacteria are needed to support this speculation. From partial screenings of four other gram-positive genomes it is clear that many novel CWPs remain to be discovered. Less than 50% of CWPs identified here have been described previously. Our data imply that the number of CWPs varies considerably between different species of gram-positive bacteria. However, such extrapolations from data on partial screening procedures are difficult, since it became apparent from the screening of the S. pyogenes genome that CWP-encoding genes are not evenly distributed on the chromosome. On the contrary, we identified clusters of CWP-encoding genes in the genomes of S. pyogenes, S. aureus, and E. faecalis (data not shown).

Since the discovery that CWPs contain a conserved LPXTGX motif, it has become increasingly apparent that variations within the motif exist. An early report indicated that there is an absolute requirement for the proline residue, but not threonine, in the LPXTGX motif for efficient sorting to occur (49). The lack of absolute conservation within the motif is supported by the fact that several well-known CWPs, like the C5a peptidase and opacity factor of S. pyogenes and the β-antigen of Streptococcus agalactiae, deviate from the classical motif in positions 4, 5, and 6, respectively (11, 23, 26, 43). If the tripartite pattern presented here is utilized in whole-genome analyses, the list of atypical sortase target sequences can be expanded. Such a list of atypical sequences can serve as a base for detailed studies on sortase specificity. Despite sequence conservation of the srtA gene, which encodes the sortase (33), small variations in sortase specificity might exist among different species of gram-positive bacteria. Also, the amino acid composition and length of the transmembrane part or the charged tail may vary between different gram-positive bacteria. Genome-based identification of additional CWPs by the use of the tripartite pattern should provide important information on these topics. In conclusion, the use of this pattern could be an easily accessible and important tool in the discovery of novel CWPs in gram-positive bacteria, which will help to address a number of important biological issues.

ACKNOWLEDGMENTS

This work was supported by the Swedish Medical Research Council (project 7480) and the Foundation of Kock and Österlund.

We acknowledge the Streptococcal Genome Sequencing project and the Staphylococcus aureus genome sequencing project at the University of Oklahoma. We acknowledge The Institute for Genomic Research for providing sequence data on E. faecalis and S. pneumoniae. We also acknowledge the Sanger Centre for sequence data on S. pyogenes strain Manfredo, produced in collaboration with Mike Kehoe at the University of Newcastle. We are indebted to Lars Björck for fruitful discussions and critical reading of the manuscript.

Both authors contributed equally to this study.

ADDENDUM IN PROOF

An interesting discussion on sortase and sortase-like proteins is found in a recent publication by M. J. Pallen, A. C. Lam, M. Antonio, and K. Dunbar (Trends Microbiol. 9:97–101, 2001). The work suggests that small changes in the tripartite pattern may be needed for certain bacterial species. Notably, a few bacterial species do not seem to have an absolute requirement for leucine and proline in positions 1 and 2 of the sortase target region.

REFERENCES

  • 1.Ashbaugh C D, Warren H B, Carey V J, Wessels M R. Molecular analysis of the role of the group A streptococcal cysteine protease, hyaluronic acid capsule, and M protein in a murine model of human invasive soft-tissue infection. J Clin Investig. 1998;102:550–560. doi: 10.1172/JCI3065. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Baiocchi C, Pesi R, Turriani M, Tozzi M G, Camici M, Ipata P L. Membrane-bound 5′-nucleotidase/nucleoside phosphotransferase from Bacillus cereus. Int J Biochem. 1993;25:1625–1629. doi: 10.1016/0020-711x(93)90521-f. [DOI] [PubMed] [Google Scholar]
  • 3.Barr P J. Mammalian subtilisins: the long-sought dibasic processing endoproteases. Cell. 1991;66:1–3. doi: 10.1016/0092-8674(91)90129-m. [DOI] [PubMed] [Google Scholar]
  • 4.Benton D. Bioinformatics—principles and potential of a new multidisciplinary tool. Trends Biotechnol. 1996;14:261–272. doi: 10.1016/0167-7799(96)10037-8. [DOI] [PubMed] [Google Scholar]
  • 5.Berry A M, Lock R A, Thomas S M, Rajan D P, Hansman D, Paton J C. Cloning and nucleotide sequence of the Streptococcus pneumoniae hyaluronidase gene and purification of the enzyme from recombinant Escherichia coli. Infect Immun. 1994;62:1101–1108. doi: 10.1128/iai.62.3.1101-1108.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Björck L. Protein L. A novel bacterial cell wall protein with affinity for Ig L chains. J Immunol. 1988;140:1194–1197. [PubMed] [Google Scholar]
  • 7.Björck L, Kronvall G. Purification and some properties of streptococcal protein G, a novel IgG-binding reagent. J Immunol. 1984;133:969–974. [PubMed] [Google Scholar]
  • 8.Böhm S, Frishman D, Mewes H W. Variations of the C2H2 zinc finger motif in the yeast genome and classification of yeast zinc finger proteins. Nucleic Acids Res. 1997;25:2464–2469. doi: 10.1093/nar/25.12.2464. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Bongaerts R J M, Heinz H-P, Hadding U, Zysk G. Antigenicity, expression, and molecular characterization of surface-located pullulanase of Streptococcus pneumoniae. Infect Immun. 2000;68:7141–7143. doi: 10.1128/iai.68.12.7141-7143.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Charalambous B M, Keen J N, McPherson M J. Collagen-like sequences stabilize homotrimers of a bacterial hydrolase. EMBO J. 1988;7:2903–2909. doi: 10.1002/j.1460-2075.1988.tb03148.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Chen C, Cleary P P. Complete nucleotide sequence of the streptococcal C5a peptidase gene of Streptococcus pyogenes. J Biol Chem. 1990;265:3161–3167. [PubMed] [Google Scholar]
  • 12.Chmouryguina I, Suvorov A, Ferrieri P, Cleary P P. Conservation of the C5a peptidase genes in group A and B streptococci. Infect Immun. 1996;64:2387–2390. doi: 10.1128/iai.64.7.2387-2390.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Courtney H S, Hasty D L, Li Y, Chiang H C, Thacker J L, Dale J B. Serum opacity factor is a major fibronectin-binding protein and a virulence determinant of M type 2 Streptococcus pyogenes. Mol Microbiol. 1999;32:89–98. doi: 10.1046/j.1365-2958.1999.01328.x. [DOI] [PubMed] [Google Scholar]
  • 14.Dale J B. Multivalent group A streptococcal vaccine designed to optimize the immunogenicity of six tandem M protein fragments. Vaccine. 1999;17:193–200. doi: 10.1016/s0264-410x(98)00150-9. [DOI] [PubMed] [Google Scholar]
  • 15.Dhar G, Faull K F, Schneewind O. Anchor structure of cell wall surface proteins in Listeria monocytogenes. Biochemistry. 2000;39:3725–3733. doi: 10.1021/bi992347o. [DOI] [PubMed] [Google Scholar]
  • 16.Erra-Pujada M, Debeire P, Duchiron F, O'Donohue M J. The type II pullulanase of Thermococcus hydrothermalis: molecular characterization of the gene and expression of the catalytic domain. J Bacteriol. 1999;181:3284–3287. doi: 10.1128/jb.181.10.3284-3287.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Fischetti V A, Medaglini D, Pozzi G. Gram-positive commensal bacteria for mucosal vaccine delivery. Curr Opin Biotechnol. 1996;7:659–666. doi: 10.1016/s0958-1669(96)80079-6. [DOI] [PubMed] [Google Scholar]
  • 18.Fischetti V A, Pancholi V, Schneewind O. Conservation of a hexapeptide sequence in the anchor region of surface proteins from gram-positive cocci. Mol Microbiol. 1990;4:1603–1605. doi: 10.1111/j.1365-2958.1990.tb02072.x. [DOI] [PubMed] [Google Scholar]
  • 19.Forsgren A, Sjöquist J. Protein A from Staphylococcus aureus. I. Pseudo-immune reaction with human γ-globulin. J Immunol. 1966;97:822–827. [PubMed] [Google Scholar]
  • 20.Fraser C M, Eisen J A, Salzberg S L. Microbial genome sequencing. Nature. 2000;406:799–803. doi: 10.1038/35021244. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Harbaugh P M, Podbielski A, Hugl S, Cleary P P. Nucleotide substitutions and small-scale insertion produce size and antigenic variation in group A streptococcal M1 protein. Mol Microbiol. 1993;8:981–991. doi: 10.1111/j.1365-2958.1993.tb01642.x. [DOI] [PubMed] [Google Scholar]
  • 22.Hatada Y, Igarashi K, Ozaki K, Ara K, Hitomi J, Kobayashi T, Kawai S, Watabe T, Ito S. Amino acid sequence and molecular structure of an alkaline amylopullulanase from Bacillus that hydrolyzes alpha-1,4 and alpha-1,6 linkages in polysaccharides at different active sites. J Biol Chem. 1996;271:24075–24083. doi: 10.1074/jbc.271.39.24075. [DOI] [PubMed] [Google Scholar]
  • 23.Heden L O, Frithz E, Lindahl G. Molecular characterization of an IgA receptor from group B streptococci: sequence of the gene, identification of a proline-rich region with unique structure and isolation of N-terminal fragments with IgA-binding capacity. Eur J Immunol. 1991;21:1481–1490. doi: 10.1002/eji.1830210623. [DOI] [PubMed] [Google Scholar]
  • 24.Hynes W L, Dixon A R, Walton S L, Aridgides L J. The extracellular hyaluronidase gene (hylA) of Streptococcus pyogenes. FEMS Microbiol Lett. 2000;184:109–112. doi: 10.1111/j.1574-6968.2000.tb08999.x. [DOI] [PubMed] [Google Scholar]
  • 25.Jedrzejas J M, Mewbourne R B, Chantalat L, McPherson D T. Expression and purification of Streptococcus pneumoniae hyaluronate lyase from Escherichia coli. Prot Expr Purif. 1998;13:83–89. doi: 10.1006/prep.1997.0864. [DOI] [PubMed] [Google Scholar]
  • 26.Jerlestrom P G, Chhatwal G S, Timmis K N. The IgA-binding beta antigen of the c protein complex of group B streptococci: sequence determination of its gene and detection of two binding regions. Mol Microbiol. 1991;5:843–849. doi: 10.1111/j.1365-2958.1991.tb00757.x. [DOI] [PubMed] [Google Scholar]
  • 27.Kehoe M A. Cell-wall-associated proteins in Gram-positive bacteria. New Comp Biochem. 1994;27:217–261. [Google Scholar]
  • 28.Lei B, Mackie S, Lukomski S, Musser J M. Identification and immunogenicity of group A Streptococcus culture supernatant proteins. Infect Immun. 2000;68:6807–6818. doi: 10.1128/iai.68.12.6807-6818.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Linton K J, Higgins C F. The Escherichia coli ATP-binding cassette (ABC) proteins. Mol Microbiol. 1998;28:5–13. doi: 10.1046/j.1365-2958.1998.00764.x. [DOI] [PubMed] [Google Scholar]
  • 30.Lukomski S, Nakashima K, Abdi I, Cipriano V I, Ireland R M, Reid S D, Adams G G, Musser J M. Identification and characterization of the scl gene encoding a group A Streptococcus extracellular protein virulence factor with similarity to human collagen. Infect Immun. 2000;68:6542–6553. doi: 10.1128/iai.68.12.6542-6553.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Lukomski S, Nakashima K, Abdi I, Cipriano V J, Shelvin B J, Graviss E A, Musser J M. Identification and characterization of a second collagen-like protein made by group A Streptococcus: control of production at the level of translation. Infect Immun. 2001;69:1729–1738. doi: 10.1128/IAI.69.3.1729-1738.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Mazmanian S K, Liu G, Jensen E R, Lenoy E, Schneewind O. Staphylococcus aureus sortase mutants defective in the display of surface proteins and in the pathogenesis of animal infections. Proc Natl Acad Sci USA. 2000;97:5510–5515. doi: 10.1073/pnas.080520697. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Mazmanian S K, Liu G, Ton-That H, Schneewind O. Staphylococcus aureus sortase, an enzyme that anchors surface proteins to the cell wall. Science. 1999;285:760–763. doi: 10.1126/science.285.5428.760. [DOI] [PubMed] [Google Scholar]
  • 34.Navarre W W, Schneewind O. Proteolytic cleavage and cell wall anchoring at the LPXTG motif of surface proteins in gram-positive bacteria. Mol Microbiol. 1994;14:115–121. doi: 10.1111/j.1365-2958.1994.tb01271.x. [DOI] [PubMed] [Google Scholar]
  • 35.Navarre W W, Schneewind O. Surface proteins of gram-positive bacteria and mechanisms of their targeting to the cell wall envelope. Microbiol Mol Biol Rev. 1999;63:174–229. doi: 10.1128/mmbr.63.1.174-229.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Navarre W W, Ton-That H, Faull K F, Schneewind O. Anchor structure of staphylococcal surface proteins. II. COOH-terminal structure of muramidase and amidase-solubilized surface protein. J Biol Chem. 1998;273:29135–29142. doi: 10.1074/jbc.273.44.29135. [DOI] [PubMed] [Google Scholar]
  • 37.Nielsen H, Engelbrecht J, Brunak S, von Heijne G. Identification of prokaryotic and eukaryotic signal peptides and prediction of their cleavage sites. Prot Eng. 1997;10:1–6. doi: 10.1093/protein/10.1.1. [DOI] [PubMed] [Google Scholar]
  • 38.Pizza M, Scarlato V, Masignani V, Giuliani M M, Arico B, Comanducci M, Jennings G T, Baldi L, Bartolini E, Capecchi B, Galeotti C L, Luzzi E, Manetti R, Marchetti E, Mora M, Nuti S, Ratti G, Santini L, Savino S, Scarselli M, Storni E, Zuo P, Broeker M, Hundt E, Knapp B, Blair E, Mason T, Tettelin H, Hood D W, Jeffries A C, Saunders N J, Granoff D M, Venter J C, Moxon E R, Grandi G, Rappuoli R. Identification of vaccine candidates against serogroup B meningococcus by whole-genome sequencing. Science. 2000;287:1816–1820. doi: 10.1126/science.287.5459.1816. [DOI] [PubMed] [Google Scholar]
  • 39.Podbielski A, Woischnik M, Pohl B, Schmidt K H. What is the size of the group A streptococcal vir regulon? The Mga regulator affects expression of secreted and surface virulence factors. Med Microbiol Immunol. 1996;185:171–181. doi: 10.1007/s004300050028. [DOI] [PubMed] [Google Scholar]
  • 40.Pozzi G, Contorni M, Oggioni M R, Manganelli R, Tommasino M, Cavalieri F, Fischetti V A. Delivery and expression of a heterologous antigen on the surface of streptococci. Infect Immun. 1992;60:1902–1907. doi: 10.1128/iai.60.5.1902-1907.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Pugsley A P, Kornacker M G. Secretion of the cell surface lipoprotein pullulanase in Escherichia coli. Cooperation or competition between the specific secretion pathway and the lipoprotein sorting pathway. J Biol Chem. 1991;266:13640–13645. [PubMed] [Google Scholar]
  • 42.Quentin Y, Fichant G, Denizot F. Inventory, assembly and analysis of Bacillus subtilis ABC transport systems. J Mol Biol. 1999;287:467–484. doi: 10.1006/jmbi.1999.2624. [DOI] [PubMed] [Google Scholar]
  • 43.Rakonjac J V, Robbins J C, Fischetti V A. DNA sequence of the serum opacity factor of group A streptococci: identification of a fibronectin-binding domain. Infect Immun. 1995;63:622–631. doi: 10.1128/iai.63.2.622-631.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Rasmussen M, Edén A, Björck L. SclA, a novel collagen-like surface protein of Streptococcus pyogenes. Infect Immun. 2000;68:6370–6377. doi: 10.1128/iai.68.11.6370-6377.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Rasmussen M, Müller H-P, Björck L. Protein GRAB of Streptococcus pyogenes regulates proteolysis at the bacterial cell surface by binding α2-macroglobulin. J Biol Chem. 1999;274:15336–15344. doi: 10.1074/jbc.274.22.15336. [DOI] [PubMed] [Google Scholar]
  • 46.Saurin W, Köster W, Dassa E. Bacterial binding protein-dependent permeases: characterization of distinctive signatures for functionally related integral cytoplasmic membrane proteins. Mol Microbiol. 1994;12:993–1004. doi: 10.1111/j.1365-2958.1994.tb01087.x. [DOI] [PubMed] [Google Scholar]
  • 47.Schneewind O, Fowler A, Faull K F. Structure of the cell wall anchor of surface proteins in Staphylococcus aureus. Science. 1995;268:103–106. doi: 10.1126/science.7701329. [DOI] [PubMed] [Google Scholar]
  • 48.Schneewind O, Mihaylova-Petkov D, Model P. Cell wall sorting signals in surface proteins of gram-positive bacteria. EMBO J. 1993;12:4803–4811. doi: 10.1002/j.1460-2075.1993.tb06169.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Schneewind O, Model P, Fischetti V A. Sorting of protein A to the staphylococcal cell wall. Cell. 1992;70:267–281. doi: 10.1016/0092-8674(92)90101-h. [DOI] [PubMed] [Google Scholar]
  • 50.Smith D R. Microbial pathogen genomes—new strategies for identifying therapeutics and vaccine targets. Trends Biotechnol. 1996;14:290–293. doi: 10.1016/0167-7799(96)10038-X. [DOI] [PubMed] [Google Scholar]
  • 51.Strauss E J, Falkow S. Microbial pathogenesis: genomics and beyond. Science. 1997;276:707–711. doi: 10.1126/science.276.5313.707. [DOI] [PubMed] [Google Scholar]
  • 52.Sutcliffe I, Russell R R B. Lipoproteins of gram-positive bacteria. J Bacteriol. 1995;177:1123–1128. doi: 10.1128/jb.177.5.1123-1128.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Ton-That H, Faull K F, Schneewind O. Anchor structure of staphylococcal surface proteins. A branched peptide that links the carboxyl terminus of proteins to the cell wall. J Biol Chem. 1997;272:22285–22292. doi: 10.1074/jbc.272.35.22285. [DOI] [PubMed] [Google Scholar]
  • 54.Ton-That H, Liu G, Mazmanian S K, Faull K F, Schneewind O. Purification and characterization of sortase, the transpeptidase that cleaves surface proteins of Staphylococcus aureus at the LPXTG motif. Proc Natl Acad Sci USA. 1999;96:12424–12429. doi: 10.1073/pnas.96.22.12424. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55.Ton-That H, Mazmanian S K, Faull K F, Schneewind O. Anchoring of surface proteins to the cell wall of Staphylococcus aureus. Sortase catalyzed in vitro transpeptidation reaction using LPXTG peptide and NH2-Gly(3) substrates. J Biol Chem. 2000;275:9876–9881. doi: 10.1074/jbc.275.13.9876. [DOI] [PubMed] [Google Scholar]
  • 56.Vihinen M, Mantsala P. Microbial amylolytic enzymes. Crit Rev Biochem Mol Biol. 1989;24:329–418. doi: 10.3109/10409238909082556. [DOI] [PubMed] [Google Scholar]
  • 57.Wexler D E, Chenoweth D E, Cleary P P. Mechanism of action of the group A streptococcal C5a inactivator. Proc Natl Acad Sci USA. 1985;82:8144–8148. doi: 10.1073/pnas.82.23.8144. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Wexler D E, Nelson R D, Cleary P P. Human neutrophil chemotactic response to group A streptococci: bacteria-mediated interference with complement-derived chemotactic factors. Infect Immun. 1983;39:239–246. doi: 10.1128/iai.39.1.239-246.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Whatmore A M. Streptococcus pyogenes sclB encodes a putative hypervariable surface protein with a collagen-like repetitive structure. Microbiology. 2001;147:419–429. doi: 10.1099/00221287-147-2-419. [DOI] [PubMed] [Google Scholar]
  • 60.Zagursky R J, Ooi P, Jones K F, Fiske M J, Smith R P, Green B A. Identification of a Haemophilus influenzae 5′-nucleotidase protein: cloning of the nucA gene and immunogenicity and characterization of the NucA protein. Infect Immun. 2000;68:2525–2534. doi: 10.1128/iai.68.5.2525-2534.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Zimmermann H. 5′-Nucleotidase: molecular structure and functional aspects. Biochem J. 1992;285:345–365. doi: 10.1042/bj2850345. [DOI] [PMC free article] [PubMed] [Google Scholar]

Articles from Infection and Immunity are provided here courtesy of American Society for Microbiology (ASM)

RESOURCES