Skip to main content
Cell Discovery logoLink to Cell Discovery
. 2023 Feb 13;9:18. doi: 10.1038/s41421-023-00523-5

Structure and dynamics of the EGFR/HER2 heterodimer

Xue Bai 1,#, Pengyu Sun 2,3,#, Xinghao Wang 2,3,#, Changkun Long 1,#, Shuyun Liao 4,#, Song Dang 2, Shangshang Zhuang 2,3, Yongtao Du 2,3, Xinyi Zhang 2,3, Nan Li 2, Kangmin He 2,3,✉, Zhe Zhang 1,4,✉
PMCID: PMC9925823  PMID: 36781849

Abstract

HER2 belongs to the human epidermal growth factor receptor tyrosine kinase family. Its overexpression or hyperactivation is a leading cause for multiple types of cancers. HER2 functions mainly through dimerization with other family members, such as EGFR. However, the molecular details for heterodimer assembly have not been completely understood. Here, we report cryo-EM structures of the EGF- and epiregulin-bound EGFR/HER2 ectodomain complexes at resolutions of 3.3 Å and 4.5 Å, respectively. Together with the functional analyses, we demonstrate that only the dimerization arm of HER2, but not that of EGFR, is essential for their heterodimer formation and signal transduction. Moreover, we analyze the differential membrane dynamics and transient interactions of endogenous EGFR and HER2 molecules in genome-edited cells using single-molecule live-cell imaging. Furthermore, we show that the interaction with HER2 could allow EGFR to resist endocytosis. Together, this work deepens our understanding of the unique structural properties and dynamics of the EGFR/HER2 complex.

Subject terms: Cryoelectron microscopy, Oncogenes, Growth factor signalling

Introduction

The proteins in the human epidermal growth factor receptor (HER or ErbB) family are some of the most thoroughly studied receptor tyrosine kinases. This family consists of four members, namely EGFR (also known as HER1), HER2, HER3, and HER4. Ligand-induced homo- or hetero-dimerization of HER proteins initiates a downstream phosphorylation signaling cascade, which stimulates cell growth, proliferation, and differentiation1. These four HER proteins are highly associated with tumorigenesis, with EGFR and HER2 considered the most potent oncoproteins. Their overexpression is implicated in many types of cancers, including breast, lung, and gastroesophageal. Antibody- and tyrosine kinase inhibitor-based therapies targeting these two receptors have been widely used in the clinical treatment of various malignancies and are already among the most successful targeted tumor therapies to date2,3.

HER2 is unique within the HER family in that it does not have known ligands and cannot assemble into ligand-dependent homodimers. Thus, to facilitate downstream signaling, it must either form heterodimers with other HER proteins once their specific ligands have bound or self-assemble into ligand-independent homodimer under the condition of overexpression1,4–6. Among the HER2-containing heterodimers, EGFR/HER2 and HER2/HER3 are the most relevant combinations due to their impacts on cellular functions and disease3,7–14. The HER family homodimerization mechanisms related to extracellular ligand-binding and intracellular kinase domains have been well studied15–22; however, the molecular mechanisms for HER2 heterodimerization with other family members remain elusive. The cryo-EM structure of the HER2/HER3 complex was reported recently23, providing some initial insight into HER2-containing dimers. However, to comprehensively elucidate the structural and functional properties of distinct heterodimers, it is necessary to further investigate the EGFR/HER2 complex.

Here, we report the cryo-EM structures of the EGFR/HER2 ectodomain complex with two EGFR ligands — epidermal growth factor (EGF) and epiregulin (EREG) — at resolutions of 3.3 Å and 4.5 Å, respectively. These two structures are almost identical and present as asymmetric heterodimers. Our biochemical and cell-based experiments demonstrate that only the dimerization arm (DA) of HER2 is crucial for its heterodimerization with EGFR and subsequent initiation of downstream signals, while that of EGFR is dispensable. Using CRISPR/Cas9 genome-editing and single-molecule imaging techniques, we further explore the diffusion dynamics and interactions of endogenous EGFR and HER2 at the plasma membrane of two human breast cancer cell lines. Unlike EGFR, HER2 does not change its membrane dynamics or undergo endocytosis upon EGF activation; moreover, it helps to retain EGFR on the plasma membrane. Therefore, HER2 likely resists the rapid endocytosis and degradation of EGFR after activation, prolongs the downstream phosphorylation signals to promote cell growth and proliferation, and ultimately results in tumorigenesis. Taken together, these findings deepen our understanding of the structural and pathological properties of the EGFR/HER2 heterodimer.

Results

Architecture of the EGFR/HER2 ectodomain complex

Full-length EGFR and HER2 were coexpressed in HEK293S GnTI– cells. Using fluorescence-detection size-exclusion chromatography (FSEC), we showed that EGF stimulation effectively induced the homodimerization of EGFR, but could not trigger the formation of the EGFR/HER2 complex (Fig. 1a); this result indicates that the interaction between EGFR and HER2 is much weaker than that of the EGFR homodimer, which is consistent with previous findings24. To stabilize the EGFR/HER2 complex, we substituted the C-terminal kinase and tail domains of EGFR and HER2 with a pair of basic and acidic coiled-coil peptides25–27. The FSEC results for the coiled-coil constructs showed the appearance of a HER2 dimer peak in the presence of EGF (Fig. 1b). Since HER2 does not form homodimers, this peak, therefore, represents the EGFR/HER2 heterodimer. We then purified this heterodimer using a tandem affinity purification strategy and performed the following cryo-EM study.

Fig. 1. Cryo-EM structure of the EGF-bound EGFR/HER2 ectodomain complex.

Fig. 1

a, b Detection of the EGFR/HER2 dimer using FSEC. GFP- and mCherry-tags are attached to the C-termini of EGFR and HER2, respectively. HER2_DT is the tail-deleted form with a substituted MBP-tag. EGFR_JM and HER2_JM constructs only contain the ectodomain, transmembrane domain, part of the juxtamembrane domain, and the coiled-coil (CC) peptide. The basic and acidic CC peptides are attached to EGFR_JM and HER2_JM, respectively. The red pentagram in b indicates the peak position of EGFR_JM/HER2_JM dimer. c Cryo-EM map of the EGF-bound EGFR/HER2 ectodomain complex shown in two views. EGFR, EGF, and HER2 are colored in green, marine, and magenta, respectively. d Overall structure of the EGF-bound EGFR/HER2 heterodimer in ribbon presentation. The color code is the same as that in c. The four domains of EGFR and HER2 ectodomains are indicated with Roman numerals. The DAs of Domain II are also labeled.

During 3D classification, both the EGF-bound EGFR/HER2 heterodimer and EGFR homodimer were present in our dataset, in nearly equal particle amounts. Unlike the perpendicular orientation of the EGFR homodimer, the ectodomains of the EGFR/HER2 heterodimer were tilted with respect to the detergent micelles (Supplementary Fig. S1); this structural discrepancy between the homo- and hetero-dimers helped to distinguish between these two subclasses. Finally, the complex structures of the EGF-bound EGFR/HER2 and homodimeric EGFR ectodomains were refined to 3.3 Å and 3.8 Å resolution, respectively (Fig. 1c, d; Supplementary Figs. S1–S3 and Table S1). The structure of the EGFR homodimer resembles other previously reported ones15,28,29 (Supplementary Fig. S3f–h), indicating that the coiled-coil peptides in our constructs would not affect the regular assembly of the receptor dimers. The relatively lower resolution of the EGFR homodimer compared to the EGFR/HER2 heterodimer might be caused by its intrinsic flexibility29 or the destabilization by the electrostatic repulsion between the C-terminal basic coiled-coil peptides.

The EGFR–EGF/HER2 dimer adopted a heart-shaped structure, similar to the dimer structures of other family members (Fig. 1d). EGF wedged into the cleft between Domains I and III of EGFR, stabilizing it in the extended conformation and exposing the dimerization interface of Domain II. Accordingly, Domain II of EGFR resembled the canonical bent conformation (Fig. 2a) seen in other dimer structures15,16,18. On the other side of the complex, HER2 retained the same conformation as in its monomer form or in complex with HER3 (Fig. 2b), consistent with its ligand-independent manner for signal transduction23,30–32. Since Domain II of HER2 was presented in the unbent conformation, it dimerized with EGFR in an asymmetric manner (Figs. 1c, d and 2c), consistent with that of the NRG1β-bound HER2/HER3, EREG-bound human EGFR, and Spitz-bound Drosophila EGFR complexes17,18,23. It is well known that different EGFR ligands induce distinct EGFR homodimer formations. Particularly, the high-affinity ligands EGF and TGFα stabilize the symmetric dimer, but the low-affinity ligand EREG generates the asymmetric one15,16,18. Thus, to verify whether different EGFR ligands might also affect the architecture of the EGFR/HER2 dimer, we further analyzed a 4.5 Å cryo-EM structure of the EREG-bound EGFR/HER2 complex (Fig. 2d; Supplementary Fig. S4 and Table S1). This structure is almost identical to the EGF-bound EGFR/HER2 complex, with a root-mean-square deviation (RMSD) of 0.63 Å (Fig. 2e), implying that the asymmetric EGFR/HER2 heterodimer is a common structure resulting from various EGFR ligands. Since the asymmetric EGFR homodimer has been shown to initiate a more sustained signal compared to the symmetric one18, the EGFR/HER2 heterodimer might exert its oncogenic effect through a similar mechanism to promote cell proliferation and transformation33,34.

Fig. 2. Structural comparison of different HER family proteins.

Fig. 2

a Superposition of the individual EGFR subunit structures in different dimers. EGFR in our EGFR/HER2 dimer (green) is superimposed with the bent EGFR protomer structures in EGF (cyan; PDB code: 1IVO)-, TGFα (orange; PDB code: 1MOX)-, and EREG (magenta; PDB code: 5WB7)-bound EGFR dimers. The RMSDs between our EGFR and the other three structures are 1.82 Å, 2.20 Å, and 1.72 Å, respectively. b Superposition of the individual HER2 subunit structures. HER2 in our EGFR/HER2 dimer (magenta) is overlaid with its monomer structure (rat) (cyan; PDB code: 1N8Y), as well as its structure in complex with Pertuzumab Fab (orange; PDB code: 1S78) or HER3 (green; PDB code: 7MN5). The RMSDs between our HER2 and the other three structures are 1.41 Å, 2.15 Å, and 1.34 Å, respectively. c Superposition of our EGFR/HER2 structure (blue) with the currently reported three asymmetric HER dimers (golden), namely, NRG1β-bound HER2/HER3 (left; PDB code: 7MN5; RMSD 1.95 Å), EREG-bound EGFR (middle; PDB code: 5WB7; RMSD 1.73 Å), and Spitz-bound Drosophila EGFR (dEGFR) (right; PDB code: 3LTG; RMSD 2.68 Å). d Cryo-EM map of the EREG-bound EGFR/HER2 ectodomain complex. EGFR, EREG, and HER2 are colored green, light blue, and magenta, respectively. e Superposition of the EGF (blue)- and EREG (yellow)-bound EGFR/HER2 structures.

Unequal contribution of the DA for EGFR/HER2 assembly

Although the formation of HER family dimers is mainly mediated by Domain II, the interaction details are distinct for symmetric and asymmetric dimers18. The symmetric dimer relies heavily on DA-mediated contacts. Alternatively, the asymmetric dimer exhibits more interactions in the N-terminal region (Fig. 3a, b; Supplementary Fig. S5). Specifically, for the EGFR/HER2 complex, both the N- and C-terminal regions of Domain II interacted more closely with their counterparts relative to the EGFR homodimer, burying 884 Å2 and 412 Å2 surface areas, respectively (Fig. 3b–d). In comparison, the buried surface areas (BSAs) for the corresponding regions of the EGFR homodimer are only 535 Å2 and 327 Å2 (Supplementary Fig. S5). Strikingly, the DAs of EGFR and HER2 adopted different conformations. The DA of HER2 was inserted properly into its binding pocket on EGFR and made extensive polar and nonpolar interactions (Fig. 3e), whereas the tip region of the EGFR DA was almost dissociated from HER2, maintaining little contact with Domain III (Fig. 3f). Moreover, the EGFR DA was more flexible than HER2 DA, evident by its weaker cryo-EM densities and higher B-factor values (Fig. 3a, g). As a result, the total BSA between the DAs was only 1395 Å2 in the EGFR/HER2 complex (910 Å2 on the HER2 DA side and 485 Å2 on the EGFR DA side), which is less than that of the EGFR homodimer (1769 Å2) (Fig. 3b; Supplementary Fig. S5). Notably, in different asymmetric HER family dimers, the DA of the unbent subunit takes a similar conformation, fitting well into its binding pocket on the adjacent bent subunit (Fig. 3h); however, DAs of the bent subunits display diverse structures and loosely interact with the unbent subunit (Fig. 3h), indicating this bent arm might be insignificant for dimer formation. In fact, the bent subunit of the HER3 DA has already been shown to be unnecessary for its interaction with HER223. Therefore, we wanted to investigate whether the DAs of EGFR and HER2 also contribute differently to their dimer assembly.

Fig. 3. Interaction details between EGFR and HER2.

Fig. 3

a Cryo-EM map of the interface between Domain IIs of EGFR and HER2 shown in two views. b Structure of the EGFR/HER2 interface in ribbon presentation. EGFR is colored in green and HER2 is in magenta. The BSAs of different regions are indicated. c–f Interaction details between EGFR and HER2 as indicated in the insets of b. Residues involved in their interaction are shown with side chains. Black dashed lines represent hydrogen bond or salt bridge interactions (< 4.5 Å). g B-factor distribution of the DAs in the EGFR–EGF/HER2 structure. h Comparison of the structures of DAs in different HER dimers. From left to right: EGFR–EGF (PDB code: 1IVO), dEGFR–Spitz (PDB code: 3LTG), EGFR–EREG (PDB code: 5WB7), EGFR–EGF/HER2 (this study), and HER2/HER3–NRG-1β (PDB code: 7MN5). The DAs of the symmetric EGFR dimer exhibit the same conformation. For asymmetric dimers, the DAs of the unbent subunit pack closely with its counterpart, mimicking that of the symmetric EGFR dimer, whereas those of the bent subunit display various structures. The distances between DAs of the bent subunits and their partners are indicated.

To verify this point, we replaced the DA regions of full-length EGFR (residues 266–281) and tail-deleted HER2 (residues 270–285) with glycine–serine (GS) linkers (EGFR-GS and HER2-GS) and detected their interaction using a pull-down assay (Fig. 4). Our results showed that both DAs of individual EGFR protomers were crucial for EGF-induced EGFR dimer formation (Fig. 4a), consistent with their symmetric organization (Fig. 3h). However, for EGF- or EREG-induced asymmetric EGFR/HER2 dimer assembly, only the unbent subunit of the HER2 DA is required, but the bent subunit of the EGFR DA is dispensable (Fig. 4b, c). Next, we examined the impact of these EGFR and HER2 variants on downstream signaling. To rule out the influence of endogenous receptors, we performed the experiment in the EGFR knockout SUM159 human triple-negative breast cancer cell line, which has very low HER2 expression (Supplementary Fig. S6a, b). We coexpressed different variants of full-length EGFR and HER2 in these cells; upon EGF stimulation, HER2-GS, but not EGFR-GS, significantly reduced the phosphorylation of HER2 (Fig. 4d). Since the phosphorylation of HER2 depends solely upon its heterodimerization with EGFR, these results further confirmed that only the HER2 DA is important for the EGFR/HER2 heterodimer assembly and downstream signal transduction. Although EGFR-GS did not affect the phosphorylation of HER2, it severely disrupted the phosphorylation of EGFR (Fig. 4d), consistent with its critical role in EGFR homodimer formation15,35,36.

Fig. 4. Functional significance of the DA of EGFR or HER2 for their dimer assembly.

Fig. 4

a Pull-down assay to verify the significance of DAs for EGF-induced EGFR dimerization. The mCherry-tagged EGFR was associated with the mCherry-nanobody (Nb) resin, and GFP-tagged EGFR was used as input for this assay. b, c Pull-down assay to verify the significance of DAs for EGF- (b) or EREG-induced (c) EGFR/HER2 interaction. The mCherry-tagged HER2 was associated with the mCherry-Nb resin, and GFP-tagged EGFR was used as input for this assay. d Detection of the phosphorylation levels of EGFR, HER2, and AKT upon EGF stimulation. Different EGFR and HER2 variants were transfected to the EGFR-knockout SUM159 cells. e Pull-down assay to verify the significance of DAs for EREG-induced EGFR dimerization.

The structures of the two DAs in asymmetric HER family homodimers — namely, the EREG-bound human EGFR and Spitz-bound Drosophila EGFR — are also distinct (Fig. 3h), mimicking that of the heterodimers17,18. To investigate the role of the DA in asymmetric homodimer assembly, we analyzed the EREG-induced EGFR dimerization using a pull-down assay. We found that replacing one DA of EGFR with GS linkers drastically abolished the dimerization of EGFR (Fig. 4e), similar to that of the EGF-induced EGFR homodimerization (Fig. 4a), but different from the EGFR/HER2 (Fig. 4b, c) and HER2/HER3 heterodimerization23. This result suggested that the unequal contribution of DAs is only a factor in HER2-containing asymmetric dimer assembly, but not in asymmetric EGFR dimer formation. In fact, in the asymmetric HER family dimers, the relative distances between the DA of the bent subunit and its counterparts are different, such that the HER2-containing dimers are much further away (Fig. 3h). Therefore, from a structural point of view, it makes sense that the EGFR or HER3 DAs contribute minimally to their interaction with HER2.

Single-molecule dynamics and interactions of endogenous EGFR and HER2 at the plasma membrane

Given that the EGFR/HER2 heterodimer is relatively unstable in our biochemical assays (Fig. 1a), it is intriguing to investigate their dynamics and interaction in live cells. The cancer-associated alterations of HER2 are more frequently related to its amplification and overexpression2,37,38; thus, we decided to comparatively characterize the membrane dynamics of endogenous EGFR and HER2 in two human breast cancer cell lines with either very low or very high HER2 expression — SUM15939 or SK-BR-340, respectively (Supplementary Fig. S6a). We first employed the CRISPR/Cas9 genome-editing tool to fuse HaloTag to the endogenous EGFR or HER2 (EGFR-Halo or HER2-Halo) (Supplementary Fig. S6), labeled the cells with bright and photostable Janelia Fluor dyes (JFX dyes)41, and tracked the diffusion dynamics of stochastically labeled EGFR-Halo spots (0.16 ± 0.02 and 0.19 ± 0.04 fluorescent spots per μm2 on SUM159 and SK-BR-3 cells, respectively) or HER2-Halo spots (0.17 ± 0.02 and 0.18 ± 0.04 fluorescent spots per μm2 on SUM159 and SK-BR-3 cells, respectively) at a fast imaging rate (33 Hz) using TIRF microscopy (Fig. 5a; Supplementary Fig. S7a and Videos S1–S4). Automatic single particle detection and tracking revealed that most of the EGFR molecules exhibited free or mobile diffusion at the plasma membranes of both SUM159 and SK-BR-3 cells (Fig. 5a–c; Supplementary Fig. S7a and Videos S1–S4). Photobleaching of stochastically labeled EGFR-Halo or HER2-Halo spots showed that they were mainly single molecules (Supplementary Fig. S8a, b). Consistent with the imaging results obtained from other cell lines42–44, EGF stimulation, especially at high concentrations, decreased the diffusion rates of EGFR molecules in SUM159 and SK-BR-3 cells, as shown by the mean square displacement (MSD) and diffusion coefficient (D) analyses (Fig. 5b, c). In contrast, the diffusive behaviors of endogenous HER2 in these two cells were not significantly affected by EGF treatment (Fig. 5b, c). The different dynamics of EGFR and HER2 molecules at the plasma membrane upon EGF activation implied that the EGFR/HER2 heterodimer might not be stable within the cells as well.

Fig. 5. Single-molecule analyses of the diffusion dynamics and interactions of endogenous EGFR and HER2 in cancer cells.

Fig. 5

a Live-cell single-molecule imaging and tracking of endogenous (en) EGFR-Halo and HER2-Halo molecules at the plasma membrane of SUM159 cells genome-edited for EGFR-Halo/HER2-mEGFP or HER2-Halo/EGFR-mEGFP (labeled by JFX650-HaloTag ligand). Shown are representative single frames and tracking traces of time-lapse series acquired in the cells treated without or with EGF (100 ng/mL) by TIRF microscopy. b MSD-Δt plots (left two panels) and diffusion coefficients (middle panel) of EGFR-Halo tracks (n = 115, 109, and 110 cells from 4 independent experiments) and HER2-Halo tracks (n = 117, 119, 120 cells from four independent experiments) from genome-edited SUM159 cells treated with 0, 10, or 100 ng/mL EGF and imaged by TIRF microscopy. The right panel shows fractions of tracks classified as mobile, confined, or immobile (n = 4 independent experiments). c SK-BR-3 cells genome-edited for EGFR-Halo or HER-Halo were labeled by JFX650-HaloTag ligand, treated with 0, 10, or 100 ng/mL EGF, and imaged by TIRF microscopy. MSD-Δt plots (left two panels) and diffusion coefficients (middle panel) of EGFR-Halo tracks (n = 150, 156, and 158 cells from 4 independent experiments) or HER-Halo tracks (n = 152, 149, 153 cells from 4 independent experiments), and fractions of tracks classified as mobile, confined, or immobile (right panel, n = 4 independent experiments) are shown. d SUM159 cells genome-edited for both EGFR-SNAP and HER2-Halo were labeled by JFX650-SNAP-tag ligand and JFX549-HaloTag ligand, treated without or with EGF, and then imaged by TIRF microscopy. The representative single frame and tracking traces (co-localized trajectories are highlighted in blue) of the time-lapse series of a cell treated with 100 ng/mL EGF were shown on the left. Individual 3D trajectories (top) and distances (bottom) between EGFR-SNAP and HER2-Halo as a function of time are shown in the middle panels. The relative fractions of HER2 tracks that interact with EGFR in cells treated with 0, 10, or 100 ng/mL EGF are shown on the right (n = 73, 77, and 77 cells from 2 independent experiments). e SUM159 cells genome-edited for EGFR-SNAP were transiently expressed with HaloTag-tagged CD86, HER2, HER2-GS, EGFR, and EGFR-GS, labeled by JFX650-SNAP-tag ligand and JFX549-HaloTag ligand, and then imaged by TIRF microscopy. Shown are the relative fractions of tracks in Halo channels that interact with the SNAP-tagged endogenous EGFR (n = 36–40 cells from 2 independent experiments). Scale bars, 5 μm. Error bars show means ± SD except for the MSD-Δt plots (means ± 95% confidence interval).

Next, we sought to directly visualize the interplay between these two receptors. Although different biochemical or imaging-based methods have been used to detect the interaction between activated EGFR and HER2 in cell lysates or fixed cells40,45, the direct recording of EGFR/HER2 interaction in live cells has been technically challenging. By creating the genome-edited SUM159 cells expressing both EGFR-SNAP and HER2-Halo (Supplementary Fig. S6d), labeling the cells with the JFX549-HaloTag ligand (0.31 ± 0.09 fluorescent spots per μm2) and JFX650-SNAP-tag ligand (0.24 ± 0.11 fluorescent spots per μm2), and imaging the cells with two-color single-molecule TIRF microscopy, we achieved the direct visualization and tracking of the interaction between stochastically labeled endogenous EGFR and HER2 molecules (Fig. 5d). The reduced or largely unchanged diffusion dynamics of EGFR and HER2 were also observed when they were simultaneously labeled in the same cells (Fig. 5d; Supplementary Fig. S7b). Notably, we found that EGF readily induced the transient interaction of EGFR and HER2 molecules in a concentration-dependent manner (Fig. 5d), which was also visualized when HER2-Halo was transiently expressed in the genome-edited SUM159 cells expressing EGFR-SNAP (Fig. 5e). As negative controls, HER2-GS and a non-related membrane receptor CD8646 did not interact with EGFR upon EGF stimulation (Fig. 5e). Collectively, these results provide direct evidence for the existence of EGFR/HER2 dimers on the plasma membrane of live cells and indicate that the specific transient interaction between activated EGFR and HER2 indeed relies on the DA of HER2, in support of our structural and biochemical studies.

Interaction with HER2 impedes the endocytosis of EGFR

Ligand binding to EGFR induces the assembly and subsequent endocytosis of the signaling complexes47–51, which causes the reduced mobility of receptors at the plasma membrane and is crucial for signal attenuation42,43,52. The largely diffusive motion of HER2 upon EGF activation suggests that it does not undergo endocytosis either on its own or in complex with EGFR, as documented in previous studies with ectopically overexpressed HER27,53. To corroborate this finding with our live-cell imaging system, we used spinning disk confocal microscopy to track in real-time the fate of activated endogenous HER2 and EGFR in genome-edited SK-BR-3 cells expressing HER2-mEGFP or EGFR-mEGFP. Whereas EGFR was internalized and started to accumulate inside the cells soon after EGF stimulation (< 5 min), HER2 remained on the plasma membrane for a long period (> 20 min), even at the high EGF concentration of 100 ng/mL (Fig. 6a). By using the more sensitive TIRF microscopy, we further confirmed that EGF could effectively induce the oligomerization and accumulation of endogenous EGFR, but not HER2, in the clathrin-coated endocytic structures in SK-BR-3 cells (Fig. 6b; Supplementary Fig. S8c, d). These results are consistent with our observations that EGF stimulation did not slow down the single molecule movement of HER2 at the plasma membrane (Fig. 5b, c).

Fig. 6. Interaction of HER2 and EGFR inhibited EGFR endocytosis.

Fig. 6

a SK-BR-3 cells genome-edited for EGFR-mEGFP or HER2-mEGFP were imaged by spinning-disk confocal microscopy. Shown are images of the cells in the middle planes at indicated times after EGF (100 ng/mL) treatment. Scale bars, 10 μm. b SK-BR-3 cells genome-edited for EGFR-mEGFP or HER2-mEGFP stably expressing clathrin-mScarlet-I were imaged at the bottom surfaces by TIRF microscopy. Shown are the single frames before and 3 min after EGF treatment during the continuous time-lapse imaging. Boxed regions are enlarged and shown. Scale bars, 5 μm. c SK-BR-3 cells genome-edited for EGFR-mEGFP and stably expressing clathrin-mScarlet-I were treated with control siRNA or siRNA targeting HER2 (HER2-KD), and then imaged at the bottom surfaces by TIRF microscopy. EGF was added at 120 s of the time-lapse imaging. The relative numbers of fluorescence spots of EGFR-mEGFP that appeared at the plasma membrane (left panel) and the relative enrichment of EGFR-mEGFP fluorescence in clathrin-coated structures (CCSs, right panel) during EGF stimulation are shown (n = 23 and 19 cells). d SK-BR-3 cells genome-edited for EGFR-mEGFP and stably expressing clathrin-mScarlet-I were treated with control siRNA or siRNA targeting HER2 (HER2-KD). The cells treated with siRNA targeting HER2 were transiently transfected with the siRNA-resistant wild-type HER2 or the HER2-GS mutant and then imaged at the bottom surfaces by TIRF microscopy. EGF was added at 120 s of the time-lapse imaging. The relative numbers of fluorescence spots of EGFR-mEGFP that appeared at the plasma membrane (left panel, n = 49, 50, 29, and 30 cells) and the relative enrichment of EGFR-mEGFP fluorescence in CCSs (right panel, n = 43, 49, 28, and 30 cells) during EGF stimulation are shown. Error bars show means ± SEM.

Since HER2 can resist endocytosis, we investigated whether it would further influence the endocytosis of EGFR through their interaction. Therefore, we knocked down the expression of HER2 (HER2-KD) in SK-BR-3 cells and used TIRF microscopy to track in real-time the endocytosis process of endogenous EGFR. Our results showed that decreasing the expression of HER2 significantly accelerated EGFR oligomerization and enrichment in clathrin-coated structures (Fig. 6c), which could be rescued by overexpressing the wild-type HER2 but not the EGFR binding-defective HER2-GS variant (Fig. 6d). The uptake of fluorescently labeled EGF was also increased in SK-BR-3 cells with HER2-KD (Supplementary Fig. S8e). Thus, not only can HER2 resist endocytosis individually, but — through the formation of transient heterodimers — it can also help another HER family member EGFR escape internalization and downregulation.

Discussion

It was identified over three decades ago that EGFR and HER2 associate with each other and work synergistically to mediate the cell transformation7–11. However, the biochemical details of their interaction have remained unclear until this work. Like the previously reported asymmetric HER dimer structures17,18,23, the EGFR/HER2 structure that we resolved provides more evidence to demonstrate that asymmetric ectodomain dimerization is an important functional state for HER family members. For symmetric EGFR dimers, Tyr275 in the DA and Arg309 in the binding pocket of its partner make key intermolecular cation–π interactions to stabilize the complex15,16. Notably, these two residues become phenylalanine (Phe279) and leucine (Leu313) in HER2, respectively (Fig. 3e, f). Structurally, the cation–π interaction is largely unaffected by the tyrosine-to-phenylalanine mutation, but is destroyed by converting the arginine to leucine. Therefore, in HER2-containing dimers, it is likely that only the DA of HER2 can insert appropriately into the binding pocket of its partner, but not conversely. As a result, HER2 could only form asymmetric dimers with other family members as observed in the EGFR/HER2 and HER2/HER3 structures23. Furthermore, our functional studies demonstrated that only the well-placed DA of HER2, but not that of EGFR, is required for their dimerization, consistent with the structural features that we observed.

It has been well accepted that the carcinogenesis of HER2 is due to the more prolonged and/or enhanced signaling of HER2-containing heterodimers compared to the homodimers of other family members54,55. Specifically, in EGFR signaling, it has been reported that HER2 can extend the EGFR signaling duration either by attenuating EGFR endocytosis or shunting the internalized EGFR toward recycling and away from degradation1,53,56,57. However, the comparative characterization of the behaviors of endogenous EGFR and HER2 in live cells during EGF activation has not been achieved, which greatly limits our understanding of their intricate dynamics, interaction, and pathogenic effects. Here, we tracked and analyzed the membrane dynamics of endogenous EGFR and HER2 molecules using single-molecule live-cell imaging. We observe the transient interaction between activated EGFR and HER2 molecules at the cell membrane of cancer cells in real time. More importantly, we demonstrated that HER2 impeded the endocytosis of EGFR, which could lead to the prolonged downstream signaling seen in previous studies53,56. Surprisingly, HER2 does not perform this function through higher affinity to EGFR, which would competitively disrupt EGFR homodimerization and internalization. On the contrary, we found that the interaction between HER2 and EGFR is quite weak and short-lived. In situations wherein HER2 is highly overexpressed at the plasma membrane of certain cancer cells, the accumulation of transient interactions exerted by large numbers of HER2 molecules is likely sufficient to influence the membrane dynamics and endocytosis of EGFR. This mechanism of interaction could provide an advantage in cancer cells; since the dynamics and thus concentrations of HER2 itself at the plasma membrane would not be affected, this would ensure that HER2 can continuously impose the regulatory effects on EGFR. Furthermore, HER2 might also regulate the function of other family members in a similar manner. Overall, this work provides elaborate details on the dynamics and interaction of EGFR and HER2, and deepens our understanding of the EGFR/HER2 signaling.

Materials and methods

Cell cultures

Sf9 insect cells (ATCC CRL-1711) were cultured at 27 °C in Sf-900 II SFM medium (Gibco). HEK293S GnTI– cells (ATCC CRL-3022) were cultured at 37 °C with 5% CO2 in Yocon HEK293 medium (Yocon Biotechnology), supplemented with 1% fetal bovine serum (FBS) and 100 μg/mL penicillin/streptomycin (Gibco). SUM159 cells were cultured at 37 °C and 5% CO2 in DMEM/F-12 (Corning), supplemented with 5% FBS (Gibco), 100 U/mL penicillin and streptomycin (Corning), 1 μg/mL hydrocortisone (Sigma-Aldrich), 5 μg/mL insulin (Sigma-Aldrich), and 10 mM HEPES (Corning), pH 7.4. SK-BR-3 cells were cultured at 37 °C and 5% CO2 in RPMI 1640 (Gibco), supplemented with 10% FBS (Gibco) and 100 U/mL penicillin and streptomycin (Corning). The cells were routinely verified to be mycoplasma-free using the TransDetect PCR Mycoplasma Detection Kit (TransGen Biotech). The Escherichia coli TransB cells (TransGen Biotech, TRANS CD811-02) were cultured at 37 °C in Luria-Bertani medium with 50 mg/L kanamycin and 10 mg/L tetracycline.

Expression and purification of EGF

A gene encoding the 53 amino-acid of human EGF (NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) was synthesized and cloned into a modified pET-32a vector (Novagen) which bears an N-terminal 6× histidine + SUMO tag followed by a PreScission protease recognition site. This plasmid was transformed into E. coli (TransB) for protein expression. Bacteria were grown in 1 L of Luria-Bertani medium at 37 °C with 50 mg/L kanamycin, 10 mg/L tetracycline, and 100 mg/L ampicillin. When OD600 reached 1.0, the protein expression was induced at 20 °C by adding isopropyl β-D-thiogalactoside (IPTG) to a final concentration of 0.5 mM. After 24 h, the cells were centrifuged at 7000 rpm for 20 min and frozen at –80 °C.

For the purification of EGF, cells were thawed and broken by sonication in PBS buffer. The cell debris was removed by centrifugation at 18,000 rpm for 40 min. Subsequently, the supernatants were mixed with Ni NTA beads (Smart-Lifesciences) at 4 °C for 1.5 h in the presence of 5 mM imidazole. The beads were washed with 30 column volumes (CVs) of PBS buffer containing 10 mM imidazole, and the protein was eluted using PBS buffer supplemented with 250 mM imidazole. The 6× histidine + SUMO tag was cleaved by addition of PreScission protease (8:1 w/w ratio). After dialyzed overnight in PBS buffer, the sample was re-incubated with nickel beads to remove the tag. The flow-through fraction was further purified by gel filtration using a Superose 6 Increase 10/300 GL column (GE Healthcare) equilibrated with PBS buffer. The peak fractions of the target protein were collected, flash frozen in liquid nitrogen, and stored at –80 °C.

Expression and purification of the EGFR/HER2 complex

DNA sequence of human EGFR (residues 1–683, EGFR_JM) with a C-terminal basic coiled-coil peptide (AQLKKKLQALKKKNAQLKWKLQALKKKLAQ) was cloned into a pEG BacMam expression vector58 bearing a green fluorescent protein (GFP) tag at the C-terminus. The sequence of human HER2 (residues 1–693, HER2_JM) with a C-terminal acidic coiled-coil peptide (AQLEKELQALEKENAQLEWELQALEKELAQ) was cloned into another vector carrying a 10× histidine + mCherry tag at the C-terminus. Additionally, a TEV protease cleavage site surrounded by two GGS linkers (GGSENLYFQGGGS) was inserted between the receptors and coiled-coil peptides. These plasmids were transformed into DH10Bac E. coli cells to generate bacmids, and then the recombinant baculoviruses were produced in Sf9 cells using Cellfectin II reagents (Life Technologies). HEK293S GnTI– suspension cells at a density of 3 × 106 cells/mL were co-infected with 5% passage 3 viruses of both EGFR and HER2. The cells were first cultured at 37 °C for 8–12 h, and then transferred to 30 °C for 48 h with addition of 10 mM sodium butyrate. Cells were harvested by centrifugation at 6000 rpm for 40 min, and stored at –80 °C.

For the purification of EGFR/HER2 complex, cells were resuspended in Buffer A (50 mM HEPES, pH 7.5, 150 mM NaCl, 15% glycerol, 2 μg/mL DNase, and a cocktail of protease inhibitors (1 μg/mL Aprotinin, 1 μg/mL Leupeptin, 1 μg/mL Pepstatin, 20 μg/mL Trypsin inhibitor, 1 mM Benzamidine, and 1 mM PMSF)). Before solubilized with 1% n-dodecyl-β-d-maltoside (DDM, Anatrace) and 0.1% cholesteryl hemisuccinate (CHS, Anatrace) at 4 °C for 2 h, the cells were incubated with 0.2 μM EGF or EREG (Beyotime) for 1 h. Then the supernatants were separated by centrifugation at 18,000 rpm for 40 min, and mixed with Ni NTA beads at 4 °C for 1.5 h. The nickel beads were rinsed sequentially with 30 CVs of Buffer B (25 mM HEPES, pH 7.5, 150 mM NaCl, and 0.02% DDM-0.002% CHS) containing 10 mM and 50 mM imidazole. The proteins were eluted using Buffer B supplemented with 250 mM imidazole. Next, the sample was applied to anti-GFP nanobody (GFPnb)-coupled CNBR-activated Sepharose beads (GE Healthcare). After mixing at 4 °C for 2 h, the beads were washed with 20 CVs of Buffer B, and then incubated with PreScission protease (4:1 w/w ratio) at 4 °C overnight to release the target proteins. The proteins were loaded into a Superose 6 Increase 10/300 GL column for further purification. Only fresh-purified proteins were used for the following cryo-EM studies.

Cryo-EM sample preparation, data collection, and processing

The EGF- and EREG-bound EGFR/HER2 complexes from the peak fractions of gel filtration were concentrated to 4.2 mg/mL. A total of 3 μL samples were deposited to Quantifoil R1.2/1.3 300 Au holey carbon grids (Quantifoil), and then blotted and frozen in liquid ethane using Vitrobot Mark IV (FEI). The grids were stored in liquid nitrogen until further use. Data collection was performed using a 300-kV Titan Krios (FEI) microscope equipped with a K3 summit detector (Gatan) and a Gatan imaging filter (GIF) with a slit of 20 eV. SerialEM software59 was used for automatic data acquisition. The data were collected in super-resolution mode at a physical pixel size of 1.07 Å. The dose rate was 14.5 e–/pixel/s and total exposure time was 4.8 s. Each micrograph was divided into 40 frames. The total number of micrographs collected for the EGF- and EREG-bound EGFR/HER2 complexes was 6121 and 8067, respectively.

The data processing strategy for these two datasets was the same. Raw images were motion-corrected using MotionCor260. Contrast transfer function (CTF) parameters for each micrograph were calculated using Gctf61. Particle picking, two-dimensional (2D) and three-dimensional (3D) classifications, and 3D refinement were performed in RELION-3.162. For both datasets, the good subclasses out of 2D classification were used for the following 3D classification. For the EGF-bound EGFR/HER2 dataset, the EGFR/HER2 heterodimer and EGFR homodimer were classified into two different 3D classes with nearly equal particle amounts, both of which were applied to 3D refinement. For the EREG-bound EGFR/HER2 dataset, only one of the 3D classes with the highest resolution representing the EGFR/HER2 heterodimer was chosen for 3D refinement. After 3 rounds of alternative Bayesian polishing and CTF refinement, the particle stacks were imported into cryoSPARC63 and subjected to non-uniform and local refinement. The local resolution distribution of the final maps was estimated in cryoSPARC, and DeepEMhancer64 was used for post-processing. The resolutions of the EGF-bound EGFR/HER2 and homodimeric EGFR, and EREG-bound EGFR/HER2 complexes were 3.3 Å, 3.8 Å, and 4.5 Å, respectively (using the 0.143 cutoff criterion).

Model building and refinement

The reported structures of NRG1β-bound HER2/HER3 (PDB code: 7MN5) and EGF-bound EGFR (PDB codes: 1IVO and 7SYD) were used for the model building of our EGF-bound EGFR/HER2 and dimeric EGFR complexes. The corresponding structures were roughly fitted into our cryo-EM maps using ChimeraX65 and then manually adjusted using COOT66. The real-space refinement was performed in PHENIX67. For the model building of the EREG-bound EGFR/HER2 complex, the EGF-bound heterodimer structure was fitted into the EM map and EGF was subsequently substituted with EREG (PDB code: 5WB7). The following refinement was also carried out in PHENIX. The Fourier shell correlation (FSC) curves between the refined models and full maps were calculated using RELION. The final models were validated using MolProbity68. All the figures were created with ChimeraX.

FSEC

DNA sequence of human EGFR (residues 1–1210) was cloned into a pEG BacMam vector with a C-terminal GFP tag. The sequence of human HER2_DT (residues 1–1029, C-terminal tail-deleted version) was cloned into another vector carrying a maltose-binding protein (MBP) in tandem with a mCherry tag at the C-terminus. The plasmids of EGFR and HER2_DT, or EGFR_JM and HER2_JM, were co-transfected into HEK293S GnTI– cells. Specifically, 0.5 μg of each plasmid was mixed with 3 μg PEI MAX 40K (Poly Sciences) and incubated in 200 μL OPT-MEM (Gibco) medium at room temperature for 25 min before adding into 2 mL adherent cells. The cells were cultured at 37 °C for 8–12 h, and then transferred to 30 °C for 48 h with addition of 10 mM sodium butyrate. Cells were harvested by centrifugation at 4000 rpm for 5 min and subsequently incubated with 5 μM EGF for 1 h in Buffer A. Next, the cells were solubilized with 1% DDM and 0.1% CHS at 4 °C for 2 h. The supernatants were separated by centrifugation at 15,000 rpm for 1 h and loaded into a Shimadzu HPLC system. The proteins were separated by a Superose 6 Increase 10/300 GL column during which process the GFP and mCherry fluorescence signals were monitored.

Pull-down assays

A total of 6× histidine + GFP-tagged EGFR and EGFR-GS were purified with Ni NTA beads. mCherry-tagged HER2_DT and HER2-GS_DT were attached to anti-mCherry nanobody (mCherrynb)-coupled beads in Buffer B. In total 10 μL beads were mixed with 28 μg EGFR or EGFR-GS at 4 °C for 2 h in the presence of 10 μM EGF or 100 μM EREG. After washing three times with Buffer B, the beads were added to the SDS loading buffer and boiled at 100 °C for 8 min. The protein extracts were separated using 10% SDS polyacrylamide gel and transferred onto polyvinylidene fluoride (PVDF) membranes. For the immunoblotting of GFP-tagged EGFR, the membranes were blocked at room temperature for 1 h and then incubated with mouse anti-GFP primary antibody (TransGen Biotech, 1:5000) at 4 °C overnight in TBST buffer (TBS + 1% Tween) supplemented with 5% skim milk. Subsequently, the membranes were incubated with goat anti-mouse IgG secondary antibody (TransGen Biotech, 1:10,000) at room temperature for 1 h. The signal was detected using a High-sig ECL Western Blotting Substrate (Thermo Fisher) and the images were captured using a AI 600 (Cytiva) equipment. For probing mCherry-tagged HER2 with the same membrane, stripping and re‐probing were performed. Briefly, the PVDF membranes were incubated with the stripping buffer (62.5 mM Tris-HCl, 2% SDS, and 100 mM β-mercaptoethanol) at room temperature for 30 min. After washing three times with TBST, the membranes were sequentially incubated with mouse anti-mCherry primary antibody (Beyotime, 1:10,000) and goat anti-mouse secondary antibody. The signals were redetected in the same way as above.

Immunoblotting analyses for protein phosphorylation detection

The EGFR knockout SUM159 cells were co-transfected with the plasmids expressing wild-type or mutant EGFR (EGFR-mEGFP or EGFR-GS-mEGFP) and HER2 (HER2-mCherry or HER2-GS-mCherry) for 8 h, and then serum-starved for 16 h. Next, the cells were treated with EGF (10 ng/mL, Peprotech) for 10 min, washed with DPBS once, and solubilized at 4 °C for 30 min in RIPA lysis buffer (Sigma-Aldrich) with a protease inhibitor cocktail (Pierce). The samples were pelleted at 13,400× g for 15 min at 4 °C, and then mixed with 5× sample buffer (GenScript) and heated to 100 °C for 10 min. After fractionated by 10% SDS–PAGE, the proteins were transferred to nitrocellulose membranes (Cell Signaling). The membranes were incubated in TBST buffer containing 5% skim milk for 3 h at room temperature, followed by overnight incubation at 4 °C with the specific primary antibodies. After three washes in TBST (5 min each), the membranes were incubated with the appropriate HRP-conjugated secondary antibody (Beyotime, 1:1000) at room temperature for 1 h. After three washes (5 min each) in TBST, the membrane was incubated with the SignalFireTM ECL Reagent (Cell Signaling) and imaged by the Tanon-5200 Chemiluminescent Imaging System (Tanon). The primary antibodies agonist AKT (4691S, 1:1000, Cell Signaling), α-actinin (69758S, 1:1000, Cell Signaling), phospho-AKT (4060S, 1:2000, Cell Signaling), phospho-EGFR (3777S, 1:1000, Cell Signaling), GFP (HT801-01, 1:3000, TransGen Biotech), mCherry (26765-1-AP, 1:3000, Proteintech), and phospho-HER2 (Y1221 + Y1222) (ab91633, 1:1000, Abcam) were used in this study.

Plasmids and reagents for single-molecule imaging

The plasmids used for transient expression in mammalian cells (EGFR-mEGFP, EGFR-GS-mEGFP, EGFR-Halo, EGFR-GS-Halo, HER2-Halo, HER2-GS-Halo, CD86-Halo) were generated by the Gibson assembly method. A linker (5′-GGAGGTTCTGGTGGTTCTGGTGGTTCC-3′) was placed between EGFR/HER2 and mEGFP/Halo. Transfections were performed using Lipofectamine 3000 (Invitrogen) according to the manufacturer’s instructions.

JFX650-HaloTag ligand, JFX549-HaloTag ligand, and JFX650-SNAP-tag ligand were kind gifts from Luke D. Lavis (Janelia Research Campus). EGF was purchased from PeproTech.

Incorporation of tags to EGFR or HER2 in SUM159 and SK-BR-3 cells using the CRISPR/Cas9 approach

SUM159 and SK-BR-3 cells were genome-edited to incorporate mEGFP, Halo, or SNAP tags to the C-terminus of EGFR or HER2 using the CRISPR/Cas9 approach as described69,70. The single-guide RNA (sgRNA) targeting human EGFR (5′-TTATTGGAGCATGACCACGG-3′) or human HER2 (5′-CTTGGCCTTCTGGTTCACAC-3′) was cloned into pSpCas9(BB)-2A-Puro (PX459) (Addgene). The donor constructs EGFR-mEGFP, EGFR-Halo, EGFR-SNAP, HER2-mEGFP, and HER2-Halo used for homologous recombination were generated by cloning into the pUC19 vector with two ∼600–800-nucleotide fragments of genomic DNA upstream and downstream of the stop codon of human EGFR or HER2, and the open reading frame of mEGFP, Halo or SNAP using the pEASY-Uni Seamless Cloning and Assembly Kit (TransGen Biotech).

SUM159 and SK-BR-3 cells were transfected with the donor plasmid and sgRNA targeting sequence containing PX459 plasmid using Lipofectamine 3000 (Invitrogen) according to the manufacturer’s instruction. The cells expressing mEGFP, Halo (stained by JF549-HaloTag ligand), or SNAP (stained by JF549-SNAP-tag ligand) were enriched by fluorescence-activated cell sorting (FACS) (FACSAria II, BD Biosciences). SUM159 cells expressing EGFR-mEGFP, EGFR-Halo, or EGFR-SNAP were further subjected to single cell sorting to 96-well plates. The clonal SUM159 cells expressing EGFR-mEGFP+/+, EGFR-Halo+/+, or EGFR-SNAP+/+ were then gene-edited for HER2 to generate a pool of cells expressing EGFR-mEGFP HER2-Halo, EGFR-Halo HER2-mEGFP, and EGFR-SNAP HER2-Halo. SK-BR-3 cells expressing EGFR-mEGFP, EGFR-Halo, HER2-mEGFP, or HER2-Halo were subjected to two more subsequent bulk sorting to enrich the genome-edited cell pools. The genome-edited SUM159 and SK-BR-3 cells were confirmed by imaging, PCR, and western blot analysis.

Knockout of EGFR in SUM159 cells

Knockout of EGFR in SUM159 cells was performed using the CRISPR/Cas9 approach as described69,70. The sgRNA sequence targeting the human EGFR gene is 5′-ATAGTTAGATAAGACTGCTA-3′. The monoclonal cell populations were screened by loss of EGFR protein expression by western blotting and confirmed by genomic DNA sequencing.

Single-molecule imaging and analyses of the diffusive dynamics of EGFR and HER2

Single-molecule TIRF imaging was performed on a Nikon Ti2-E microscope equipped with a CFI Apochromat TIRF 100× objective (1.49 NA, Nikon), a manual TIRF Illuminator Unit (Nikon), a Perfect Focus Unit (Nikon), a UNO Stage Top Incubator (Okolab), and OBIS CellX 405, 488, 561, and 637 nm lasers (Coherent). The emission fluorescence signal was collected using the W-VIEW GEMINI-2C Image Splitting Optics (Hamamatsu) and two EMCCD cameras (Evolve 512 Delta, Photometrics). The 2× tube lens equipped on the Nikon Ti2-E microscope was applied for single-molecule imaging experiments (final pixel size corresponding to 80 nm of the image). Imaging sequences were acquired using Micro-Manager 1.471.

Genome-edited SUM159 or SK-BR-3 cells expressing EGFR-Halo or HER2-Halo were cultured overnight in 4-well confocal dishes (Cellvis). The cells were then incubated with JFX650-HaloTag ligand in culture medium for 3–5 min, washed three times with culture medium, and then imaged in phenol-free DMEM/F12 (Corning) containing 5% FBS and 20 mM HEPES. The cells were then imaged by the single-molecule TIRF microscopy. Each cell was imaged continuously for 400 frames with an exposure time of 30 ms. The 150 to 300 frames of the time-lapse movies were used for imaging analysis. The images were subjected to cell mask creation by Fiji. Then the single fluorescent spots in the processed images were detected and tracked by u-track72 in MATLAB (MathWorks). The parameters with non-default values used: psfSigma, 1.25; minTrackLen, 4; minSearchRadius, 2; maxSearchRadius, 6; maximum allowed gaps, 4.

The tracks longer than 20 frames were used for mean square displacement (MSD) analysis using the MSDanalyzer package73 in MATLAB. The diffusion coefficients were calculated using the first five points with a minimal fitting R2 value of 0.8 using the MSDanalyzer package73. The tracks were classified as mobile, confined, immobile, and directed based on the moment scaling spectrum of each track by u-track72. Since the fraction of tracks classified as directed was less than 3%, the tracks classified as mobile, confined, and immobile were used for further analysis.

Single-molecule imaging and analyses of the interaction between EGFR and HER2

Genome-edited SUM159 cells expressing both EGFR-SNAP and HER2-Halo were cultured overnight in the pretreated confocal dishes (Cellvis). The confocal dishes were sonicated in NaOH for 1 h, washed with distilled H2O three times, and then stored in 100% ethanol. The cleaned dishes were washed three times with DPBS before use. Cells cultured overnight on the cleaned dished were then incubated with a mixture of JFX549-HaloTag ligand and JFX650-SNAP-tag ligand in culture medium for 5 min, washed three times with culture medium, and then imaged in phenol-free DMEM/F12 containing 5% FBS and 20 mM HEPES. Single-molecule dual color imaging was performed with the same TIRF microscopy described above. JFX549 and JFX650 were excited and imaged sequentially for 400 frames with an exposure time of 30 ms. The 100 to 400 frames of the dual-color movies were subjected to cell mask creation by Fiji, and then detected and tracked by u-track for each channel72. The parameters with non-default values used: psfSigma, 1.25; minTrackLen, 4; minSearchRadius, 2; maxSearchRadius, 8; maximum allowed gaps, 4. For colocalization analysis, the two channels were firstly aligned by the 0.1-μm multi-color TetraSpeck beads (Thermo Fisher) using a transformation matrix from the software package SlimFast4C74,75. A non-related membrane receptor CD8646 was used as a reference for random colocalization. Molecules within tracks from the two channels that fall within a 100 nm radius were identified as colocalized by the software package SlimFast4C74,75. Trajectories with at least five consecutive colocalized frames were identified as co-locomotion.

Real-time tracking of EGFR and HER2 endocytosis by TIRF and spinning disk confocal microscopy

The endocytosis process at the plasma membrane was tracked with a Nikon TIE microscope equipped with a CFI Apochromat TIRF 100× objective (1.49 NA, Nikon), a 100× Oil objective (1.45 NA, Nikon), a Perfect Focus Unit (Nikon), a Motorized XY stage (Prior Scientific), a fully enclosed and environmentally controlled cage incubator (Okolab), a motorized TIRF Illuminator Unit (Nikon), OBIS 488, 561, and 647 nm lasers (Coherent), the W-VIEW GEMINI Image splitting optics (Hamamatsu) and an EMCCD camera (iXon Life 888, Andor Technology). The 1.5× tube lens equipped on the Nikon TiE microscope was applied for TIRF imaging experiments (final pixel size corresponding to 86.7 nm of the image). The microscope was also equipped with a CSU-X1 spinning disk confocal unit (Yokogawa) and an EMCCD camera (iXon Ultra 897, Andor Technology) on the left side port. Imaging sequences were acquired using Micro-Manager 2.071. The genome-edited SK-BR-3 cells expressing EGFR-mEGFP or HER2-mEGFP were imaged by spinning disk confocal microscopy (3 imaging planes spaced at 0.75 μm, exposure time 100 ms) with a 100× oil objective (1.45 NA, Nikon) every 2 min for 32 min. The genome-edited SK-BR-3 cells expressing EGFR-mEGFP or HER2-mEGFP were also stably expressed with clathrin-mScarlet-I, and then imaged at the bottom surface by TIRF microscopy every 10 s for 12 min with an exposure time 100 ms. EGF was added to the cells at 2 min during imaging by a Syringe Pump (Harvard Apparatus).

Knockdown of HER2 expression by siRNA

Knockdown of HER2 expression in SK-BR-3 cells genome-edited for EGFR-mEGFP or HER2-mEGFP and stably expressing clathrin-mScarlet-I were achieved by two sequential transfections of siRNA using Lipofectamine RNAiMAX (Invitrogen). The cells plated overnight were transfected with siRNA targeting HER2 (5’-AAATTCCAGTGGCCATCAA-3’) or control siRNA (a mixture of three non-targeting sequences) and then transfected again two days afterward. The cells were transfected with the siRNA-resistant plasmids HER2-Halo or HER2-GS-Halo one day after the second transfection. The siRNA-resistant plasmids bearing mutations (5′-AGATCCCCGTCGCTATCAA-3′) were generated using PCR. Knockdown efficiency was confirmed by western blot analysis. The cells were used for imaging analysis the next day by TIRF microscopy. The cells were imaged every 10 s for 73 frames with an exposure time of 100 ms. EGF was added to the cells at 2 min during imaging by a Syringe Pump (Harvard Apparatus). The two-color time-lapse images were subjected to background subtraction (Rolling ball radius 25 pixels) and cell mask creation by Fiji. The numbers of fluorescent spots of EGFR-mEGFP that appeared at the plasma membrane in each frame during EGF stimulation were detected on the mEGFP channel by batch processing in TrackMate 7 (Fiji)76,77. To track the change of EGFR-mEGFP fluorescence at clathrin-coated structures during EGF stimulation, the clathrin-coated structures on the mScarlet-I channel in each frame were detected by batch processing in TrackMate 7, and then the fluorescent intensity of each detected object in the mEGFP channel was measured and plotted.

Measurement of EGF uptake by spinning disk confocal microscopy

SK-BR-3 cells treated with control siRNA or siRNA targeting HER2 were incubated with Alexa Fluor 488 conjugated EGF (Thermo Fisher; 10 ng/mL) for 10 min or 15 min at 37 °C. The surface-bound EGF was removed by ice-chilled PBS and acid wash buffer (0.1 M glycine, 150 mM NaCl, 1 mM MgCl2, and 0.125 mM CaCl2, pH 2.5). Then the cells were fixed using 4% paraformaldehyde in PBS for 30 min at room temperature, washed with PBS, and then imaged by spinning-disk confocal microscopy (z stack spaced at 0.35 μm). The first four imaging planes near the bottom surface were used to create the z-stack projection. The projected images were then subjected to background subtraction, cell mask creation, and then mean intensity measurement of each cell by Fiji.

Supplementary information

Supplementary Video S1 (26.7MB, mp4)
Supplementary Video S2 (26.6MB, mp4)
Supplementary Video S3 (26.6MB, mp4)
Supplementary Video S4 (26.6MB, mp4)

Acknowledgements

We thank the Cryo-EM platform and the School of Life Sciences of Peking University for cryo-EM data collection. We are grateful to Dr. Zhenxi Guo, Dr. Guopeng Wang, Bo Shao, Xia Pei, and Dr. Ning Gao for their help in cryo-EM experiments. We thank Dr. Luke D. Lavis for the generous gifts of the JFX650-HaloTag ligand, JFX549-HaloTag ligand, JF549-SNAP-tag ligand, and JFX650-SNAP-tag ligand. We thank Dr. Jacob Piehler for sharing the software package SLimFast4C. We thank Dr. Joan Brugge and Dr. Lei Chen for generously providing SUM159 and SK-BR-3 cells, respectively. We thank the National Center for Protein Sciences at Peking University for other technical supports. This research was funded by the National Key R&D Program of China (2021YFA1302300 to Z.Z., 2021YFA0804802 and 2022YFA1304500 to K.H.), and the National Natural Science Foundation of China (32171201 to Z.Z., 31970659 and 91957106 to K.H., 32000557 to N.L.). The study was also supported by Center for Life Sciences (CLS), School of Life Sciences (SLS) of Peking University, the SLS-Qidong innovation fund, Li Ge-Zhao Ning Life Science Youth Research Foundation, and the State Key Laboratory of Membrane Biology and the State Key Laboratory of Molecular Developmental Biology of China.

Author contributions

X.B. purified the proteins and collected the cryo-EM datasets. X.B. and Z.Z. processed the EM data. Z.Z. built the structural models. P.S. detected the phosphorylation and downstream signaling of EGFR and HER2. P.S., S.D., and S.Z. generated the constructs for transient expression and genome editing. P.S., S.D., S.Z., Y.D., N.L., and X.Z. generated and characterized the knockin and knockout cell lines. C.L. and X.B. carried out the pull-down assay. S.L. did the cloning and cell culture. P.S. and X.W. performed the single-molecule imaging experiment. K.H., P.S., and X.W. processed and analyzed the single-molecule imaging data. Z.Z. and K.H. wrote and revised the manuscript with input and support from all co-authors.

Data availability

The cryo-EM density maps of EGF- and EREG-bound EGFR/HER2 heterodimers, and EGF-bound EGFR homodimer have been deposited in the Electron Microscopy Data Bank under the accession codes EMD-34744, EMD-34745, and EMD-34746, respectively. Their atomic coordinates have been deposited in the Protein Data Bank under accession codes 8HGO, 8HGP, and 8HGS, respectively.

Conflict of interest

The authors declare no competing interests.

Footnotes

Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

These authors contributed equally: Xue Bai, Pengyu Sun, Xinghao Wang, ChangkunLong, Shuyun Liao.

Contributor Information

Kangmin He, Email: kmhe@genetics.ac.cn.

Zhe Zhang, Email: zzhang01@pku.edu.cn.

Supplementary information

The online version contains supplementary material available at 10.1038/s41421-023-00523-5.

References

  • 1.Yarden Y, Sliwkowski MX. Untangling the ErbB signalling network. Nat. Rev. Mol. Cell Biol. 2001;2:127–137. doi: 10.1038/35052073. [DOI] [PubMed] [Google Scholar]
  • 2.Oh DY, Bang YJ. HER2-targeted therapies - a role beyond breast cancer. Nat. Rev. Clin. Oncol. 2020;17:33–48. doi: 10.1038/s41571-019-0268-3. [DOI] [PubMed] [Google Scholar]
  • 3.Yarden Y, Pines G. The ERBB network: at last, cancer therapy meets systems biology. Nat. Rev. Cancer. 2012;12:553–563. doi: 10.1038/nrc3309. [DOI] [PubMed] [Google Scholar]
  • 4.Hudziak RM, Schlessinger J, Ullrich A. Increased expression of the putative growth factor receptor p185HER2 causes transformation and tumorigenesis of NIH 3T3 cells. Proc. Natl. Acad. Sci. USA. 1987;84:7159–7163. doi: 10.1073/pnas.84.20.7159. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Lemmon MA, Schlessinger J, Ferguson KM. The EGFR family: not so prototypical receptor tyrosine kinases. Cold Spring Harb. Perspect. Biol. 2014;6:a020768. doi: 10.1101/cshperspect.a020768. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Peckys DB, Korf U, de Jonge N. Local variations of HER2 dimerization in breast cancer cells discovered by correlative fluorescence and liquid electron microscopy. Sci. Adv. 2015;1:e1500165. doi: 10.1126/sciadv.1500165. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.King CR, Borrello I, Bellot F, Comoglio P, Schlessinger J. Egf binding to its receptor triggers a rapid tyrosine phosphorylation of the erbB-2 protein in the mammary tumor cell line SK-BR-3. EMBO J. 1988;7:1647–1651. doi: 10.1002/j.1460-2075.1988.tb02991.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Stern DF, Kamps MP. EGF-stimulated tyrosine phosphorylation of p185neu: a potential model for receptor interactions. EMBO J. 1988;7:995–1001. doi: 10.1002/j.1460-2075.1988.tb02906.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Wada T, Qian XL, Greene MI. Intermolecular association of the p185neu protein and EGF receptor modulates EGF receptor function. Cell. 1990;61:1339–1347. doi: 10.1016/0092-8674(90)90697-D. [DOI] [PubMed] [Google Scholar]
  • 10.Kokai Y, et al. Synergistic interaction of p185c-neu and the EGF receptor leads to transformation of rodent fibroblasts. Cell. 1989;58:287–292. doi: 10.1016/0092-8674(89)90843-X. [DOI] [PubMed] [Google Scholar]
  • 11.Goldman R, Levy RB, Peles E, Yarden Y. Heterodimerization of the erbB-1 and erbB-2 receptors in human breast carcinoma cells: a mechanism for receptor transregulation. Biochemistry. 1990;29:11024–11028. doi: 10.1021/bi00502a002. [DOI] [PubMed] [Google Scholar]
  • 12.Sliwkowski MX, et al. Coexpression of erbB2 and erbB3 proteins reconstitutes a high affinity receptor for heregulin. J. Biol. Chem. 1994;269:14661–14665. doi: 10.1016/S0021-9258(17)36676-0. [DOI] [PubMed] [Google Scholar]
  • 13.Alimandi M, et al. Cooperative signaling of ErbB3 and ErbB2 in neoplastic transformation and human mammary carcinomas. Oncogene. 1995;10:1813–1821. [PubMed] [Google Scholar]
  • 14.Wallasch C, et al. Heregulin-dependent regulation of HER2/neu oncogenic signaling by heterodimerization with HER3. EMBO J. 1995;14:4267–4275. doi: 10.1002/j.1460-2075.1995.tb00101.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Ogiso H, et al. Crystal structure of the complex of human epidermal growth factor and receptor extracellular domains. Cell. 2002;110:775–787. doi: 10.1016/S0092-8674(02)00963-7. [DOI] [PubMed] [Google Scholar]
  • 16.Garrett TP, et al. Crystal structure of a truncated epidermal growth factor receptor extracellular domain bound to transforming growth factor alpha. Cell. 2002;110:763–7736. doi: 10.1016/S0092-8674(02)00940-6. [DOI] [PubMed] [Google Scholar]
  • 17.Alvarado D, Klein DE, Lemmon MA. Structural basis for negative cooperativity in growth factor binding to an EGF receptor. Cell. 2010;142:568–579. doi: 10.1016/j.cell.2010.07.015. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Freed DM, et al. EGFR ligands differentially stabilize receptor dimers to specify signaling kinetics. Cell. 2017;171:683–695.e18. doi: 10.1016/j.cell.2017.09.017. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Zhang X, Gureasko J, Shen K, Cole PA, Kuriyan J. An allosteric mechanism for activation of the kinase domain of epidermal growth factor receptor. Cell. 2006;125:1137–1149. doi: 10.1016/j.cell.2006.05.013. [DOI] [PubMed] [Google Scholar]
  • 20.Qiu C, et al. Mechanism of activation and inhibition of the HER4/ErbB4 kinase. Structure. 2008;16:460–467. doi: 10.1016/j.str.2007.12.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Liu P, et al. A single ligand is sufficient to activate EGFR dimers. Proc. Natl. Acad. Sci. USA. 2012;109:10861–10866. doi: 10.1073/pnas.1201114109. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Mi LZ, et al. Simultaneous visualization of the extracellular and cytoplasmic domains of the epidermal growth factor receptor. Nat. Struct. Mol. Biol. 2011;18:984–989. doi: 10.1038/nsmb.2092. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Diwanji D, et al. Structures of the HER2-HER3-NRG1beta complex reveal a dynamic dimer interface. Nature. 2021;600:339–343. doi: 10.1038/s41586-021-04084-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Ferguson KM, Darling PJ, Mohan MJ, Macatee TL, Lemmon MA. Extracellular domains drive homo- but not hetero-dimerization of erbB receptors. EMBO J. 2000;19:4632–4643. doi: 10.1093/emboj/19.17.4632. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.O’Shea EK, Lumb KJ, Kim PS. Peptide ‘Velcro’: design of a heterodimeric coiled coil. Curr. Biol. 1993;3:658–667. doi: 10.1016/0960-9822(93)90063-T. [DOI] [PubMed] [Google Scholar]
  • 26.Lu C, Takagi J, Springer TA. Association of the membrane proximal regions of the alpha and beta subunit cytoplasmic domains constrains an integrin in the inactive state. J. Biol. Chem. 2001;276:14642–14648. doi: 10.1074/jbc.M100600200. [DOI] [PubMed] [Google Scholar]
  • 27.Takagi J, Erickson HP, Springer TA. C-terminal opening mimics ‘inside-out’ activation of integrin alpha5beta1. Nat. Struct. Biol. 2001;8:412–416. doi: 10.1038/87569. [DOI] [PubMed] [Google Scholar]
  • 28.Lu C, et al. Structural evidence for loose linkage between ligand binding and kinase activation in the epidermal growth factor receptor. Mol. Cell Biol. 2010;30:5432–5443. doi: 10.1128/MCB.00742-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Huang Y, et al. A molecular mechanism for the generation of ligand-dependent differential outputs by the epidermal growth factor receptor. Elife. 2021;10:e73218. doi: 10.7554/eLife.73218. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Cho HS, et al. Structure of the extracellular region of HER2 alone and in complex with the Herceptin Fab. Nature. 2003;421:756–760. doi: 10.1038/nature01392. [DOI] [PubMed] [Google Scholar]
  • 31.Franklin MC, et al. Insights into ErbB signaling from the structure of the ErbB2-pertuzumab complex. Cancer Cell. 2004;5:317–328. doi: 10.1016/S1535-6108(04)00083-2. [DOI] [PubMed] [Google Scholar]
  • 32.Garrett TP, et al. The crystal structure of a truncated ErbB2 ectodomain reveals an active conformation, poised to interact with other ErbB receptors. Mol. Cell. 2003;11:495–505. doi: 10.1016/S1097-2765(03)00048-0. [DOI] [PubMed] [Google Scholar]
  • 33.Li Y, Macdonald-Obermann J, Westfall C, Piwnica-Worms D, Pike LJ. Quantitation of the effect of ErbB2 on epidermal growth factor receptor binding and dimerization. J. Biol. Chem. 2012;287:31116–31125. doi: 10.1074/jbc.M112.373647. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Worthylake R, Opresko LK, Wiley HS. ErbB-2 amplification inhibits down-regulation and induces constitutive activation of both ErbB-2 and epidermal growth factor receptors. J. Biol. Chem. 1999;274:8865–8874. doi: 10.1074/jbc.274.13.8865. [DOI] [PubMed] [Google Scholar]
  • 35.Mattoon D, Klein P, Lemmon MA, Lax I, Schlessinger J. The tethered configuration of the EGF receptor extracellular domain exerts only a limited control of receptor function. Proc. Natl. Acad. Sci. USA. 2004;101:923–928. doi: 10.1073/pnas.0307286101. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Dawson JP, et al. Epidermal growth factor receptor dimerization and activation require ligand-induced conformational changes in the dimer interface. Mol. Cell. Biol. 2005;25:7734–7742. doi: 10.1128/MCB.25.17.7734-7742.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Friedlaender A, et al. EGFR and HER2 exon 20 insertions in solid tumours: from biology to treatment. Nat. Rev. Clin. Oncol. 2022;19:51–69. doi: 10.1038/s41571-021-00558-1. [DOI] [PubMed] [Google Scholar]
  • 38.Robichaux JP, et al. Structure-based classification predicts drug response in EGFR-mutant NSCLC. Nature. 2021;597:732–737. doi: 10.1038/s41586-021-03898-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Forozan F, et al. Molecular cytogenetic analysis of 11 new breast cancer cell lines. Br. J. Cancer. 1999;81:1328–1334. doi: 10.1038/sj.bjc.6695007. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.DeFazio-Eli L, et al. Quantitative assays for the measurement of HER1-HER2 heterodimerization and phosphorylation in cell lines and breast tumors: applications for diagnostics and targeted drug mechanism of action. Breast Cancer Res. 2011;13:R44. doi: 10.1186/bcr2866. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.Grimm JB, et al. A General method to improve fluorophores using deuterated auxochromes. JACS Au. 2021;1:690–696. doi: 10.1021/jacsau.1c00006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Yasui M, Hiroshima M, Kozuka J, Sako Y, Ueda M. Automated single-molecule imaging in living cells. Nat. Commun. 2018;9:3061. doi: 10.1038/s41467-018-05524-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Hiroshima M, et al. Transient acceleration of epidermal growth factor receptor dynamics produces higher-order signaling clusters. J. Mol. Biol. 2018;430:1386–1401. doi: 10.1016/j.jmb.2018.02.018. [DOI] [PubMed] [Google Scholar]
  • 44.Clarke DT, Martin-Fernandez ML. A brief history of single-particle tracking of the epidermal growth factor receptor. Methods Protoc. 2019;2:12. doi: 10.3390/mps2010012. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Peckys DB, Gaa D, de Jonge N. Quantification of EGFR-HER2 heterodimers in HER2-overexpressing breast cancer cells using liquid-phase electron microscopy. Cells. 2021;10:3244. doi: 10.3390/cells10113244. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Sungkaworn T, et al. Single-molecule imaging reveals receptor-G protein interactions at cell surface hot spots. Nature. 2017;550:543–547. doi: 10.1038/nature24264. [DOI] [PubMed] [Google Scholar]
  • 47.von Zastrow M, Sorkin A. Mechanisms for regulating and organizing receptor signaling by endocytosis. Annu. Rev. Biochem. 2021;90:709–737. doi: 10.1146/annurev-biochem-081820-092427. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Goh LK, Sorkin A. Endocytosis of receptor tyrosine kinases. Cold Spring Harb. Perspect. Biol. 2013;5:a017459. doi: 10.1101/cshperspect.a017459. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Barbieri E, Di Fiore PP, Sigismund S. Endocytic control of signaling at the plasma membrane. Curr. Opin. Cell Biol. 2016;39:21–27. doi: 10.1016/j.ceb.2016.01.012. [DOI] [PubMed] [Google Scholar]
  • 50.Renard HF, Boucrot E. Unconventional endocytic mechanisms. Curr. Opin. Cell Biol. 2021;71:120–129. doi: 10.1016/j.ceb.2021.03.001. [DOI] [PubMed] [Google Scholar]
  • 51.Alfonzo-Mendez MA, Sochacki KA, Strub MP, Taraska JW. Dual clathrin and integrin signaling systems regulate growth factor receptor activation. Nat. Commun. 2022;13:905. doi: 10.1038/s41467-022-28373-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Chung I, et al. Spatial control of EGF receptor activation by reversible dimerization on living cells. Nature. 2010;464:783–787. doi: 10.1038/nature08827. [DOI] [PubMed] [Google Scholar]
  • 53.Haslekas C, et al. The inhibitory effect of ErbB2 on epidermal growth factor-induced formation of clathrin-coated pits correlates with retention of epidermal growth factor receptor-ErbB2 oligomeric complexes at the plasma membrane. Mol. Biol. Cell. 2005;16:5832–5842. doi: 10.1091/mbc.e05-05-0456. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Zaczek A, Brandt B, Bielawski KP. The diverse signaling network of EGFR, HER2, HER3 and HER4 tyrosine kinase receptors and the consequences for therapeutic approaches. Histol. Histopathol. 2005;20:1005–1015. doi: 10.14670/HH-20.1005. [DOI] [PubMed] [Google Scholar]
  • 55.Moasser MM. The oncogene HER2: its signaling and transforming functions and its role in human cancer pathogenesis. Oncogene. 2007;26:6469–6487. doi: 10.1038/sj.onc.1210477. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56.Lenferink AE, et al. Differential endocytic routing of homo- and hetero-dimeric ErbB tyrosine kinases confers signaling superiority to receptor heterodimers. EMBO J. 1998;17:3385–3397. doi: 10.1093/emboj/17.12.3385. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Hartman Z, Zhao H, Agazie YM. HER2 stabilizes EGFR and itself by altering autophosphorylation patterns in a manner that overcomes regulatory mechanisms and promotes proliferative and transformation signaling. Oncogene. 2013;32:4169–4180. doi: 10.1038/onc.2012.418. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Goehring A, et al. Screening and large-scale expression of membrane proteins in mammalian cells for structural studies. Nat. Protoc. 2014;9:2574–2585. doi: 10.1038/nprot.2014.173. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 59.Mastronarde DN. Automated electron microscope tomography using robust prediction of specimen movements. J. Struct. Biol. 2005;152:36–51. doi: 10.1016/j.jsb.2005.07.007. [DOI] [PubMed] [Google Scholar]
  • 60.Zheng SQ, et al. MotionCor2: anisotropic correction of beam-induced motion for improved cryo-electron microscopy. Nat. Methods. 2017;14:331–332. doi: 10.1038/nmeth.4193. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Zhang K. Gctf: Real-time CTF determination and correction. J. Struct. Biol. 2016;193:1–12. doi: 10.1016/j.jsb.2015.11.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Fernandez-Leiro R, Scheres SHW. A pipeline approach to single-particle processing in RELION. Acta Crystallogr. D Struct. Biol. 2017;73:496–502. doi: 10.1107/S2059798316019276. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Punjani A, Rubinstein JL, Fleet DJ, Brubaker M. A. cryoSPARC: algorithms for rapid unsupervised cryo-EM structure determination. Nat. Methods. 2017;14:290–296. doi: 10.1038/nmeth.4169. [DOI] [PubMed] [Google Scholar]
  • 64.Sanchez-Garcia R, et al. DeepEMhancer: a deep learning solution for cryo-EM volume post-processing. Commun. Biol. 2021;4:874. doi: 10.1038/s42003-021-02399-1. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 65.Pettersen EF, et al. UCSF ChimeraX: structure visualization for researchers, educators, and developers. Protein Sci. 2021;30:70–82. doi: 10.1002/pro.3943. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66.Emsley P, Lohkamp B, Scott WG, Cowtan K. Features and development of Coot. Acta Crystallogr. D Biol. Crystallogr. 2010;66:486–501. doi: 10.1107/S0907444910007493. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67.Adams PD, et al. PHENIX: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr. D Biol. Crystallogr. 2010;66:213–221. doi: 10.1107/S0907444909052925. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.Davis IW, et al. MolProbity: all-atom contacts and structure validation for proteins and nucleic acids. Nucleic Acids Res. 2007;35:W375–W383. doi: 10.1093/nar/gkm216. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69.Ran FA, et al. Genome engineering using the CRISPR-Cas9 system. Nat. Protoc. 2013;8:2281–2308. doi: 10.1038/nprot.2013.143. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.He K, et al. Dynamics of phosphoinositide conversion in clathrin-mediated endocytic traffic. Nature. 2017;552:410–414. doi: 10.1038/nature25146. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Edelstein A, Amodaj N, Hoover K, Vale R, Stuurman N. Computer control of microscopes using μManager. Curr. Protoc. Mol. Biol. 2010;92:14.20.1–14.20.17. doi: 10.1002/0471142727.mb1420s92. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 72.Jaqaman K, et al. Robust single-particle tracking in live-cell time-lapse sequences. Nat. Methods. 2008;5:695–702. doi: 10.1038/nmeth.1237. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 73.Tarantino N, et al. TNF and IL-1 exhibit distinct ubiquitin requirements for inducing NEMO-IKK supramolecular structures. J. Cell Biol. 2014;204:231–245. doi: 10.1083/jcb.201307172. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.You C, et al. Receptor dimer stabilization by hierarchical plasma membrane microcompartments regulates cytokine signaling. Sci. Adv. 2016;2:e1600452. doi: 10.1126/sciadv.1600452. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75.Sotolongo Bellon J, et al. Four-color single-molecule imaging with engineered tags resolves the molecular architecture of signaling complexes in the plasma membrane. Cell Rep. Methods. 2022;2:100165. doi: 10.1016/j.crmeth.2022.100165. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76.Ershov D, et al. TrackMate 7: integrating state-of-the-art segmentation algorithms into tracking pipelines. Nat. Methods. 2022;19:829–832. doi: 10.1038/s41592-022-01507-1. [DOI] [PubMed] [Google Scholar]
  • 77.Tinevez JY, et al. TrackMate: an open and extensible platform for single-particle tracking. Methods. 2017;115:80–90. doi: 10.1016/j.ymeth.2016.09.016. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplementary Video S1 (26.7MB, mp4)
Supplementary Video S2 (26.6MB, mp4)
Supplementary Video S3 (26.6MB, mp4)
Supplementary Video S4 (26.6MB, mp4)

Data Availability Statement

The cryo-EM density maps of EGF- and EREG-bound EGFR/HER2 heterodimers, and EGF-bound EGFR homodimer have been deposited in the Electron Microscopy Data Bank under the accession codes EMD-34744, EMD-34745, and EMD-34746, respectively. Their atomic coordinates have been deposited in the Protein Data Bank under accession codes 8HGO, 8HGP, and 8HGS, respectively.


Articles from Cell Discovery are provided here courtesy of Nature Publishing Group

RESOURCES