Skip to main content
Springer Nature - PMC COVID-19 Collection logoLink to Springer Nature - PMC COVID-19 Collection
. 2023 Feb 20;77(4):251–257. doi: 10.3103/S0096392522040125

Immunoinformatics Study of SARS-CoV-2 Nucleocapsid Phosphoprotein Identifies Promising Epitopes with Mutational Implications

S Kumar 1, K Kumari 1, G K Azad 1,
PMCID: PMC9940079  PMID: 36843648

Abstract

The SARS-CoV-2 is rapidly evolving and new mutations are being reported from different parts of the world. In this study, we investigated the variations occurring in the nucleocapsid phosphoprotein (N-protein) of SARS-CoV-2 from India. We used several in silico prediction tools to characterise N-protein including IEDB webserver for B cell epitope prediction, Vaxijen 2.0 and AllergenFP v.1.0 for antigenicity and allergenicity prediction of epitopes, CLUSTAL Omega for mutation identification and PONDR webserver for disorder prediction, PROVEAN score for protein function and iMutantsuite for protein stability prediction. Our results show that 81 mutations have occurred in this protein among Indian SARS-CoV-2 isolates. Subsequently, we characterized the N-protein epitopes to identify seven most promising peptides. We mapped these mutations with seven N-protein epitopes to identify the loss of antigenicity in two of them, suggesting that the mutations occurring in the SARS-CoV-2 genome contribute to the alteration in the properties of epitopes. Altogether, our data strongly indicates that N-protein is gaining several mutations in its B cell epitope regions that might alter protein function.

Keywords: nucleocapsid phosphoprotein (N-protein), SARS-CoV-2 Indian isolates, immunoinformatics, mutations, epitopes, COVID-19

INTRODUCTION

In the Wuhan province of China, various cases of pneumonia were reported in the late 2019 whose causative agent was identified as Severe acquired respiratory syndrome coronavirus 2 (SARS-CoV-2) [13]. Studies have revealed that SARS-CoV-2 genome shows close resemblance of approximately 96% with the bat SARS-like coronavirus strain Bat-CoV RaTG13 [4]. The SARS-CoV-2 infection leads to Coronavirus disease 2019 (COVID-19) whose symptom ranges from mild to severe respiratory distress. The SARS-CoV-2 rapidly spreads from infected individuals to the normal population by direct contact or via respiratory droplets. This virus has infected human population worldwide and caused tremendous loss of lives and economy. As of 11th Nov 2021, approximately 252 million cases of COVID-19 have been reported worldwide and death toll has reached 5.08 million. To overcome the COVID-19 pandemic, the treatment strategies, better diagnostic methods and vaccines are being developed by the collaborative efforts of industry and academia worldwide.

The single-stranded RNA genome of SARS-CoV-2 is  approximately 29 Kb in length [5]. Its genome encodes 29 proteins categorized into structural (S, M, E and N), non-structural (Nsp1-16) and accessory proteins (Orf3a, 3b, 6, 7a, 7b, 8, 9b, 9c and 10) [6]. SARS-CoV-2 enters the host cells by interaction with the receptor angiotensin-converting enzyme 2 (ACE2) present on host cells via the receptor binding domain (RBD) of Spike protein [7]. Subsequent to the entry into the host cell, the SARS-CoV-2 genomic RNA is translated by the host cell translational machinery to produce viral proteins. As a result, the viral proteins are exposed to the host immune system that triggers an immune response. The B cell epitopes generated from viral proteins bind to the host B cell antigen receptors to induce a cascade of reactions to generate protective antibodies that neutralize the virus [8]. Therefore, identifying the epitopes of SARS-COV-2 plays central role in vaccine development and SARS-CoV-2 pathogenesis. More importantly, SARS-CoV-2 is rapidly mutating and several new variants are emerging and therefore, continued analyses of variants are warranted to understand viral evolution and its implication on the host immune response.

In this study, we used bioinformatic approach to characterize N-protein epitopes of SARS-CoV-2. Our data revealed that few epitopes of N-protein might lose its antigenic property as a result of mutations observed among Indian SARS-CoV-2 isolates.

METHODS

Sequence Retrieval for Analysis

We retrieved protein sequences of SARS-CoV-2 used in this study from public accessible NCBI Virus database. The NCBI virus database has annotated 26 proteins of SARS-CoV-2 from the reference genome (NC_045512.2). We performed detailed analysis of variations present in the N-protein among Indian isolates of SARS-CoV-2. For this analysis, sequences of 831 N-protein reported from India (till July 2021), were also downloaded from NCBI virus database. The accession ID of N-protein reference sequence (N-protein) used in this study was YP_009724397. The details of all N-protein sequences (accession ID) used in this study are mentioned in Supplementary Table S1.

The Prediction of B Cell Epitopes

Linear B cell epitopes are small continuous peptides. For this prediction, a webserver tool IEDB (Immune Epitope Database) was applied that uses an algorithm based on the “Bepipred linear prediction method” [9]. For the analysis by “Bepipred linear prediction methods” the default threshold value of 0.350 was applied using Bepipred 2.0. The antigenicity and allergenicity of epitopes were predicted by Vaxijen 2.0 [10] and AllergenFP v.1.0 [11] webservers, respectively. We used reference sequence of N-protein (accession ID: YP_009724397) for this prediction.

Multiple Sequence Alignments (MSAs)

MSAs were performed to identify variations present among N-proteins. The Clustal Omega tool was used to conduct MSAs [12] as described earlier [13]. In this analysis, the first reported sequence of N-protein from Wuhan, China was used (protein Accession Number: YP_009724397) as the reference sequence. The 831 N-protein sequences reported from India until 1st June 2021 were compared with the reference sequence to identify variations present among Indian isolates.

Secondary Structure and Protein Disorder Prediction

The secondary structure of polypeptide sequence was predicted using CFSSP webserver [14] as described earlier [15]. The per-residue contribution of disorder was predicted using PONDR webserver [16]. The PONDR-VSL2 value more than 0.5 represents disorder, while the value less than 0.5 indicates order in the polypeptide structure.

Analysis of Effect of Mutation on Protein Function and Stability

The PROVEAN (Protein Variation Effect Analyzer) score indicates the probable effect of a mutation on protein function [17]. For this prediction, the default threshold score of –2.5 was used. A PROVEAN score of ≤–2.5 represents “deleterious” mutation, while, score more than –2.5 indicates “neutral” mutation. We predicted protein stability by iMutantsuite webserver [18] based on the difference in free energy (ΔΔG) as described earlier [19]. The protein is considered more stable if the ΔΔG is positive, while negative ΔΔG indicates instability.

RESULTS

Identification and Characterization of Linear B Cell Epitopes of N-Protein

The linear B cell epitopes were predicted by a bioinformatic tool IEDB, which is based on the “Bepipred linear prediction method” using 0.350 as a threshold value. The analysis of linear B cell epitopes of N-protein revealed that it contributes to 13 potential peptides (Fig. 1, yellow shaded area). Among those 13 peptides, seven peptides fulfilled the criteria of being antigenic, non-allergen and non-toxic (Table 1). The complete list of 13 peptides is shown in Supplementary Table S2. The peptide 6 (KLDDKDPNFK) shows the highest antigenic value (Vaxijen score) which is 2.129 followed by peptide 4 (AFGRRGPEQTQGNFG) with 1.172 score.

Fig. 1.

Fig. 1.

Analysis of linear B cell epitopes contributed by N‑protein. Data was obtained using IEDB webserver. The B cell epitopes were predicted at the default threshold value of 0.350 for each protein. The Y-axis represents the “Bepipred score,” while the X-axis represents the N-protein residue number. The yellow shaded regions indicate the residues that reside in the putative B cell epitopes, while the green shaded region represents non-antigenic residues of N-protein.

Table 1.

Linear continuous B cell epitopes of N-protein predicted by IEDB webserver

Peptide (Start-End) Peptide Peptide length Vaxijen Score Allergenicity Toxicity
Peptide 1 (58–85) QHGKEDLKFPRGQGVPINTNSSPDDQIG 28

0.5570

Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic
Peptide 2 (93–104) RIRGGDGKMKDL 12

0.8771

(Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic
Peptide 3 (232–269) SKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYN 38

0.5302

(Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic
Peptide 4 (273–287) AFGRRGPEQTQGNFG 15

1.1728

(Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic
Peptide 5 (323–331) EVTPSGTWL 9

0.4548

(Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic
Peptide 6 (338–347) KLDDKDPNFK 10

2.1298

(Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic
Peptide 7 (361–390) KTFPPTEPKKDKKKKADETQALPQRQKKQQ 30

0.4338

(Probable ANTIGEN)

Probable

NON-ALLERGEN

Non-toxic

Analysis of Variations in N-Protein of SARS-CoV-2 among Indian Isolates

To understand the N-protein variations in India, we compared the SARS-CoV-2 N-protein sequences reported from India with the first sequence reported from Wuhan, China (YP_009724397). The MSA analysis revealed that N-protein has gained 81 mutations in India (Table 2). We characterized those mutants by analyzing the change in polarity and charge of N-protein (Table 2). Subsequently, we did a stability prediction using I-mutant Suite to understand the effect of these mutations on N-protein. For stability prediction, we measured the change in free energy (ΔΔG) that demonstrates the stability of the protein. Our data revealed that 17 mutations increased stability since the ΔΔG was positive for them while 64 mutations led to decrease in stability of N-protein (Table 2). Further, we measured the PROVEAN score of each mutant that predicts the impact of mutation on protein function. Our data shows that several mutations impart no effect on protein function (neutral), while 12 mutations are deleterious (Table 2). Altogether, our data suggests that the variations in N-protein contribute to the alteration in their properties and function.

Table 2.

List of SARS-CoV-2 N-protein mutations identified from Indian isolates

S. no. Mutation Polarity change Charge change ΔΔG value, Kcal/mol Provean score Effect on
protein function
1 D3Y P to P Acidic to Neutral 0.02 –0.103 Neutral
2 D3L P to NP Acidic to Neutral 0.34 –0.230 Neutral
3 P6T NP to P Neutral to Neutral –1.10 –0.223 Neutral
4 Q9H P to P Neutral to Basic (weakly) –0.90 –0.210 Neutral
5 A12T NP to P Neutral to Neutral –0.72 –0.473 Neutral
6 P13L NP to NP Neutral to Neutral –0.48 –1.230 Neutral
7 P13S NP to P Neutral to Neutral –1.63 –0.913 Neutral
8 G18V NP to NP Neutral to Neutral –0.67 –0.462 Neutral
9 G18S NP to P Neutral to Neutral –1.37 0.046 Neutral
10 D22Y P to P Acidic to Neutral –0.36 –1.253 Neutral
11 D22N P to P Acidic to Neutral –1.40 –0.541 Neutral
12 G30R NP to P Neutral to Basic(strongly) –0.54 –0.455 Neutral
13 E31Q P to P Acidic to Neutral –0.70 0.054 Neutral
14 S33I P to P Neutral to Neutral 0.27 –1.372 Neutral
15 S33G P to NP Neutral to Neutral –1.08 –0.328 Neutral
16 G34W NP to NP Neutral to Neutral –0.13 –1.609 Neutral
17 N49S P to P Neutral to Neutral –0.82 –0.047 Neutral
18 P67S NP to P Neutral to Neutral –1.51 –1.465 Neutral
19 V72L NP to NP Neutral to Neutral –1.22 –2.419 Neutral
20 A90S NP to P Neutral to Neutral –0.81 0.680 Neutral
21 R92S P to P Basic (strongly) to Neutral –1.23 –3.718 Deleterious
22 G97S NP to P Neutral to Neutral –1.33 –1.980 Neutral
23 A119S NP to P Neutral to Neutral –0.86 –1.628 Neutral
24 G120R NP to P Neutral to Basic (strongly) –0.29 –0.733 Neutral
25 D128Y P to P Acidic to Neutral 0.23 –4.529 Deleterious
26 A134V NP to NP Neutral to Neutral –0.12 –2.811 Deleterious
27 T135I P to NP Neutral to Neutral –0.42 –1.410 Neutral
28 L139F NP to NP Neutral to Neutral –0.85 –0.697 Neutral
29 D144G P to NP Acidic to Neutral –0.85 1.019 Neutral
30 D144Y P to P Acidic to Neutral 0.20 –1.764 Neutral
31 A152S NP to P Neutral to Neutral –0.92 1.463 Neutral
32 A156S NP to P Neutral to Neutral –0.83 –0.457 Neutral
33 Q163K P to P Neutral to Basic –0.40 –0.060 Neutral
34 S180I P to NP Neutral to Neutral –0.14 –3.465 Deleterious
35 R191L P to NP Basic (strongly) to Neutral –0.58 –3.269 Deleterious
36 S193I P to NP Neutral to Neutral –0.36 –2.755 Deleterious
37 S194L P to NP Neutral to Neutral –0.38 –4.272 Neutral
38 P199S NP to P Neutral to Neutral –1.48 –0.334 Neutral
39 P199L NP to NP Neutral to Neutral –0.72 –2.057 Neutral
40 S202I P to NP Neutral to Neutral –0.11 –3.308 Neutral
41 S202N P to P Neutral to Neutral –0.78 –0.404 Deleterious
42 R203K P to P Basic (strongly) to Basic –0.93 –1.604 Neutral
43 R203M P to NP Basic (strongly) to Neutral –0.73 –3.304 Deleterious
44 G204R NP to P Neutral to Basic (strongly) –0.52 –1.656 Neutral
45 G204T NP to P Neutral to Neutral –0.96 –1.760 Neutral
46 T205I P to NP Neutral to Neutral –0.53 –1.562 Neutral
47 R209I P to NP Basic (strongly) to Neutral –0.18 2.455 Neutral
48 R209K P to P Basic (strongly) to Basic –0.69 –0.504 Neutral
49 M210I NP to NP Neutral to Neutral –0.73 –0.665 Neutral
50 A218V NP to NP Neutral to Neutral 0.21 0.171 Neutral
51 D225Y P to P Acidic to Neutral –0.08 –1.793 Neutral
52 M234I NP to NP Neutral to Neutral –0.03 0.044 Neutral
53 S235F P to NP Neutral to Neutral 0.76 –1.738 Neutral
54 G236C NP to NP Neutral to Neutral –0.27 –2.269 Neutral
55 G238S NP to P Neutral to Neutral –0.54 0.851 Neutral
56 Q239R P to P Neutral to Basic (strongly) 0.17 –0.478 Neutral
57 A251T NP to P Neutral to Neutral –0.42 –1.593 Neutral
58 A252V NP to NP Neutral to Neutral –0.25 –1.418 Neutral
59 V270L NP to NP Neutral to Neutral –0.69 –2.484 Neutral
60 H300Y P to P Basic (weakly) to Neutral 0.46 –1.577 Neutral
61 P302S NP to P Neutral to Neutral –1.30 –4.043 Deleterious
62 M317I NP to NP Neutral to Neutral –0.86 –0.965 Neutral
63 S327L P to NP Neutral to Neutral 0.44 –3.022 Deleterious
64 T332N P to P Neutral to Neutral –0.76 –1.385 Neutral
65 Y333H P to P Neutral to Basic(weakly) –1.10 –3.913 Deleterious
66 P344S NP to P Neutral to Neutral –1.46 –4.031 Deleterious
67 D348Y P to P Acidic to Neutral –0.41 –0.588 Neutral
68 A359S NP to P Neutral to Neutral –0.86 –1.414 Neutral
69 T362I P to NP Neutral to Neutral –0.35 –1.722 Neutral
70 P364L NP to NP Neutral to Neutral –0.33 –2.424 Neutral
71 P368L NP to NP Neutral to Neutral –0.25 –1.406 Neutral
72 K374N P to P Basic to Neutral –0.10 –0.626 Neutral
73 D377Y P to P Acidic to Neutral 0.21 –1.779 Neutral
74 T379I P to NP Neutral to Neutral –0.15 –0.648 Neutral
75 R385I P to NP Basic (weakly) to Neutral 0.64 –0.578 Neutral
76 Q389H P to P Neutral to Basic (weakly) –0.40 –1.114 Neutral
77 Q390L P to NP Neutral to Neutral 0.26 –0.983 Neutral
78 T393I P to NP Neutral to Neutral 0.10 –0.613 Neutral
79 D399Y P to P Acidic to Neutral 0.26 –0.599 Neutral
80 D401Y P to P Acidic to Neutral 0.06 –0.717 Neutral
81 Q409L P to NP Neutral to Neutral 0.11 –0.200 Neutral

Mutations in B Cell Epitope Cause Alteration in Their Antigenicity

Subsequently, we mapped the identified N-protein mutations over the seven B cell epitopes described above. Our data revealed that 21 mutations reside within the B cell epitopes (Fig. 2a). The peptides 2, 5, and 6 possess mutations at one site (Fig. 2a). Similarly, peptide 1 has two mutations while peptide 3 and 5 possess seven and nine mutations, respectively (Fig. 2a). We did not observe any mutation in peptide 4, suggesting that this epitope is the most conserved among the rest of the epitopes (Fig. 2a). The details of the wild type and mutant epitopes are mentioned in Supplementary Table S3. Subsequently, we analyzed the antigenicity, allergenicity and toxicity of the mutant epitopes. Interestingly, our data revealed that all mutant epitopes are non-allergen and non-toxic (Supplementary Table S3); however, peptide 3 mutant 2 (P3M2) and peptide 5 mutant 1 (P5M1) lost their antigenic property and became non-antigenic (Figs. 2d and 2e). The mutant peptides of epitopes 1, 2, 6 and 7 do not show any significant alteration in antigenicity property (Figs. 2b, 2c, 2f, and 2g). The loss of epitope in P3M2 and P5M1 can also be visualized by IEDB epitope predictions. The “bepipred score graph” revealed that compared to wild-type, the mutants P3M2 (compare 2H and 2I) and P5M1 (compare 2H and 2J) has loss of epitopes. Altogether, our data suggests that the emerging mutations in N-protein can contribute to alterations in their properties.

Fig. 2.

Fig. 2.

Characterization of N-protein epitopes. (a) the linear sequence of N-protein is shown along with the residue number. The location of B cell epitopes (peptide) is mentioned in the linear sequence of N-protein. The asterisk denotes the mutant residues identified among Indian SARS-CoV-2 isolates. Note that several mutations reside in the B cell epitope sequences. (b–g) Effect of mutation on the antigenicity of B cell epitopes. The antigenicity was analyzed by predicting the Vaxijen score of wild type and mutated peptide sequence. Each panel (b–g) represents the individual peptide and their mutant counterpart. In two cases, Peptide 3 (d) and Peptide 5 (e) the mutant showed marked reduction in Vaxijen score (highlighted in green dashed box). (h–j) Comparative analysis of B cell epitopes in wild-type and mutants. Panel H shows “wild-type N-protein” graph, panel I represents the N-protein sequence containing P3M2 mutation and panel J shows N-protein sequence containing P5M1 mutation. The Y-axis represents the “Bepipred score”, while the X-axis represents the residue N-protein residue number. The yellow shaded regions indicate the residues that reside in the putative B cell epitopes, while the green shaded region represents non-antigenic residues of N-protein.

Mutant Epitopes Alter Protein Disorder Parameters

We further characterized the effect of mutations on the two epitopes that lost their antigenicity. We analyzed per-residue disorder property of the mutant peptides. Our data shows that both mutant peptides are more ordered than their wild-type counterparts (Supplementary Figs. S1A and S1B). Altogether, our data suggests an alteration in protein disorder score in the mutant epitopes.

DISCUSSION

The SARS-CoV-2 has undergone rapid evolution after its emergence from Wuhan, China that is adversely impacting the development of vaccines and treatment strategies. Therefore, there is an urgent need to understand the biology of SARS-CoV-2 for designing effective therapy. Although several in silico predictions have been conducted on SARS-CoV-2 to identify putative epitopes, those studies were aimed for vaccine development [2023]. In this study, we focused on the mutations that have occurred in the epitopes and their effects were predicted. Our data revealed that N-protein sequences reported from India have 81 mutations. To correlate “how these mutations might affect N‑protein epitopes”, we mapped these 81 mutations with putative epitopes to identify 21 mutations reside in those N-protein epitopes. Furthermore, we observed that two epitopes lost their antigenicity (Fig. 2) due to the mutation suggesting that the epitopes are changing with SARS-CoV-2 evolution. Our data strongly suggests that, as a consequence of the mutation occurring on epitopes, the specificity and/or sensitivity of the immune-based assays where N-proteins are used might change, which will adversely affect the results. It has been established by several studies that the new SARS-COV-2 variants have altered host antibody interactions and in some rare cases they might not be recognized by the host antibody [24, 25]. A recent study revealed that several SARS-CoV-2 variants have decreased sensitivity to neutralizing monoclonal antibodies [26]. Such variants are likely to become resistant to the host immune system. This study gives a comprehensive view of B cell epitopes of SARS-CoV-2 N-protein and its evolution has been discussed. It is evident from our study that future studies should be conducted to link the impact of newly emerging SARS-CoV-2 mutations on protein structure, antigenicity, interaction with antibodies and their consequences.

Supplementary Information

ACKNOWLEDGMENTS

We would like to acknowledge the Department of Zoology, Patna University, Patna, Bihar (India) for providing infrastructural support for this study.

CONFLICT OF INTEREST

The authors declare that they have no conflicts of interest.

STATEMENTS AND DECLARATIONS

Fund Information. No funding was used to conduct this research.

Ethical Statement. Not applicable

AUTHORSHIP CONTRIBUTION STATEMENT

Sushant Kumar: Methodology, Validation, Visualization, Writing–original draft and editing.

Khushboo Kumari: Methodology, Validation and Visualization.

Gajendra Kumar Azad: Conceptualization, Supervision, Methodology, Validation, Visualization, Writing–original draft and editing.

Supplementary Information

The online version contains supplementary material available at 10.3103/S0096392522040125

REFERENCES

  • 1.Lai C.C., Shih T.P., Ko W.C., Tang H.J., Hsueh P.R. Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and coronavirus disease-2019 (COVID-19): The epidemic and the challenges. Int. J. Antimicrob. Agents. 2020;55:105924. doi: 10.1016/j.ijantimicag.2020.105924. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Rothan H.A., Byrareddy S.N. The epidemiology and pathogenesis of coronavirus disease (COVID-19) outbreak. J. Autoimmun. 2020;109:102433. doi: 10.1016/j.jaut.2020.102433. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Rabi F.A., Al Zoubi M. S., Al-Nasser A.D., Kasasbeh G.A., Salameh D.M. SARS-CoV-2 and coronavirus disease 2019: What we know so far. Pathogens. 2020;9:231. doi: 10.3390/pathogens9030231. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Zhou P., Yang X.L., Wang X.G. A pneumonia outbreak associated with a new coronavirus of probable bat origin. Nature. 2020;579:270–273. doi: 10.1038/s41586-020-2012-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Wu F., Zhao S., Yu B. A new coronavirus associated with human respiratory disease in China. Nature. 2020;579:265–269. doi: 10.1038/s41586-020-2008-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Khailany R.A., Safdar M., Ozaslan M. Genomic characterization of a novel SARS-CoV-2. Gene Rep. 2020;19:100682. doi: 10.1016/j.genrep.2020.100682. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Yang J., Petitjean S.J.L., Koehler M., Zhang Q., Dumitru A.C., Chen W., Derclaye S., Vincent S.P., Soumillion P., Alsteens D. Molecular interaction and inhibition of SARS-CoV-2 binding to the ACE2 receptor. Nat. Commun. 2020;11:4541. doi: 10.1038/s41467-020-18319-6. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Chia W.N., Zhu F., Ong S.W.X. Dynamics of SARS-CoV-2 neutralising antibody responses and duration of immunity: a longitudinal study. Lancet Microbe. 2021;2:e240–e249. doi: 10.1016/S2666-5247(21)00025-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Vita R., Mahajan S., Overton J.A., Dhanda S.K., Martini S., Cantrell J.R., Wheeler D.K., Sette A., Peters B. The Immune Epitope Database (IEDB): 2018 update. Nucleic Acids Res. 2019;47:D339–D343. doi: 10.1093/nar/gky1006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Doytchinova I.A., Flower D.R. VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinform. 2007;8:4. doi: 10.1186/1471-2105-8-4. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Dimitrov I., Naneva L., Doytchinova I., Bangov I., Allergen FP. allergenicity prediction by descriptor fingerprints. Bioinformatics. 2014;30:846–851. doi: 10.1093/bioinformatics/btt619. [DOI] [PubMed] [Google Scholar]
  • 12.Madeira F., Park Y.M., Lee J., Buso N., Gur T., Madhusoodanan N., Basutkar P., Tivey A.R.N., Potter S.C., Finn R.D., Lopez R. The EMBL-EBI search and sequence analysis tools APIs in 2019. Nucleic Acids Res. 2019;47:W636–W641. doi: 10.1093/nar/gkz268. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Azad G.K. Identification of novel mutations in the  methyltransferase complex (Nsp10-Nsp16) of SARS-CoV-2. Biochem. Biophys. Rep. 2020;24:100833. doi: 10.1016/j.bbrep.2020.100833. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Ashok K.T. CFSSP: Chou and Fasman Secondary Structure Prediction server. Wide Spectrum. 2013;1:15–19. [Google Scholar]
  • 15.Azad G.K. The molecular assessment of SARS-CoV-2 nucleocapsid phosphoprotein variants among Indian isolates. Heliyon. 2021;7:e06167. doi: 10.1016/j.heliyon.2021.e06167. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Obradovic Z., Peng K., Vucetic S., Radivojac P., Dunker A.K. Exploiting heterogeneous sequence properties improves prediction of protein disorder. Proteins. 2005;61:176–182. doi: 10.1002/prot.20735. [DOI] [PubMed] [Google Scholar]
  • 17.Choi Y., Sims G.E., Murphy S., Miller J.R., Chan A.P. Predicting the functional effect of amino acid substitutions and indels. PLoS One. 2012;7:e46688. doi: 10.1371/journal.pone.0046688. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Capriotti E., Fariselli P., Casadio R. I-Mutant2.0: predicting stability changes upon mutation from the protein sequence or structure. Nucleic Acids Res. 2005;33:W306–W310. doi: 10.1093/nar/gki375. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Azad G.K. Identification and molecular characterization of mutations in nucleocapsid phosphoprotein of SARS-CoV-2. PeerJ. 2021;9:e10666. doi: 10.7717/peerj.10666. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Ahmed S.F., Quadeer A.A., McKay M.R. Preliminary identification of potential vaccine targets for the COVID-19 Coronavirus (SARS-CoV-2) based on SARS-CoV immunological studies. Viruses. 2020;12:254. doi: 10.3390/v12030254. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Grifoni A., Sidney J., Zhang Y., Scheuermann R.H., Peters B., Sette A. A sequence homology and bioinformatic approach can predict candidate targets for immune responses to SARS-CoV-2. Cell Host Microbe. 2020;27:671–680. doi: 10.1016/j.chom.2020.03.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Chen H.Z., Tang L.L., Yu X.L., Zhou J., Chang Y.F., Wu X. Bioinformatics analysis of epitope-based vaccine design against the novel SARS-CoV-2. Infect. Dis. Poverty. 2020;9:88. doi: 10.1186/s40249-020-00713-3. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Chukwudozie O.S., Gray C.M., Fagbayi T.A., Chukwuanukwu R.C., Oyebanji V.O., Bankole T.T., Adewole R.A., Daniel E.M. Immuno-informatics design of a multimeric epitope peptide based vaccine targeting SARS-CoV-2 spike glycoprotein. PLoS One. 2021;16:e0248061. doi: 10.1371/journal.pone.0248061. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Starr T.N., Greaney A.J., Addetia A., Hannon W.W., Choudhary M.C., Dingens A.S., Li J.Z., Bloom J.D. Prospective mapping of viral mutations that escape antibodies used to treat COVID-19. Science. 2021;371:850–854. doi: 10.1126/science.abf9302. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Garcia-Beltran W.F., Lam E.C., St Denis K., Nitido A.D., Garcia Z.H., Hauser B.M., Feldman J., Pavlovic M.N., Gregory D.J., Poznansky M.C., Sigal A., Schmidt A.G., Iafrate A.J., Naranbhai V., Balazs A.B. Multiple SARS-CoV-2 variants escape neutralization by vaccine-induced humoral immunity. Cell. 2021;184:2372–2383.e9. doi: 10.1016/j.cell.2021.03.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Li Q., Wu J., Nie J. The impact of mutations in SARS-CoV-2 spike on viral infectivity and antigenicity. Cell. 2020;182:1284–1294. doi: 10.1016/j.cell.2020.07.012. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials


Articles from Moscow University Biological Sciences Bulletin are provided here courtesy of Nature Publishing Group

RESOURCES