Skip to main content
NIHPA Author Manuscripts logoLink to NIHPA Author Manuscripts
. Author manuscript; available in PMC: 2016 Nov 25.
Published in final edited form as: EcoSal Plus. 2016 Oct;7(1):10.1128/ecosalplus.ESP-0006-2016. doi: 10.1128/ecosalplus.esp-0006-2016

ANIMAL ENTEROTOXIGENIC ESCHERICHIA COLI

J Daniel Dubreuil 1, Richard E Isaacson 2, Dieter M Schifferli 3
PMCID: PMC5123703  NIHMSID: NIHMS780638  PMID: 27735786

Abstract

Enterotoxigenic Escherichia coli (ETEC) is the most common cause of E. coli diarrhea in farm animals. ETEC are characterized by the ability to produce two types of virulence factors; adhesins that promote binding to specific enterocyte receptors for intestinal colonization and enterotoxins responsible for fluid secretion. The best-characterized adhesins are expressed in the context of fimbriae, such as the F4 (also designated K88), F5 (K99), F6 (987P), F17 and F18 fimbriae. Once established in the animal small intestine, ETEC produces enterotoxin(s) that lead to diarrhea. The enterotoxins belong to two major classes; heat-labile toxin that consist of one active and five binding subunits (LT), and heat-stable toxins that are small polypeptides (STa, STb, and EAST1). This chapter describes the disease and pathogenesis of animal ETEC, the corresponding virulence genes and protein products of these bacteria, their regulation and targets in animal hosts, as well as mechanisms of action. Furthermore, vaccines, inhibitors, probiotics and the identification of potential new targets identified by genomics are presented in the context of animal ETEC.

INTRODUCTION

Enterotoxigenic Escherichia coli (ETEC) is the most common cause of E. coli diarrhea in farm animals (1). ETEC are characterized by the ability to produce two types of virulence factors; adhesins that promote binding and colonization of the intestinal epithelium and enterotoxins responsible for fluid secretion (2). The best-characterized adhesins are expressed in the context of fimbriae, such as the F4 (also designated K88), F5 (K99), F6 (987P), F17 and F18 fimbriae. Once established in the animal small intestine, ETEC produces enterotoxin(s) leading to diarrhea. Two major classes of enterotoxins are produced by ETEC: High-molecular weight heat-labile toxin (LT) inactivated by heating at 60°C for 15 min. and low-molecular weight heat-stable toxins (ST) which are stable to 100°C for 15 min (3). ETEC strains produce LT, STa, STb, and/or enteroaggregative heat-stable toxin 1 (EAST1).

PATHOGENESIS

ETEC in the environment enter animals via the oral route. The stomach, duodenum, and jejunum of animals generally do not contain coliform bacteria. The presence of ETEC in the environment of pigs, for example, is an important factor in the transmission of the pathogens as these bacteria are able to survive for at least 6 months when protected by manure (4, 5). In humans a dose of 108 to 1010 microorganisms are required for disease (6) but a lower infectious dose may be sufficient for transmission in animals. Bacteria transit and colonize the small intestine. Inside the animal it can attach to the intestinal epithelium through fimbrial or non-fimbrial adhesins (also called colonization factor (CF) antigens) by recognition of specific receptors on the small intestine and then colonize this habitat (2). There, it can multiply rapidly and reach up to 109 bacteria per gram of intestine. The degree of colonization determines whether or not disease will result from infection. Once established ETEC can synthesize and secrete one or more types of enterotoxins. Concomitant production of several enterotoxins was confirmed in piglets (7). ETEC are commonly associated with some animal species such as newborn (suckling) and weaned pigs and in newborn calves (810). ETEC infections are very rare or almost non-existent in other important farm animals like, rabbits, poultry or horses, but do occur in sheep. For now, no clear explanation of this species tropism can be given, as these animals do possess the receptors for the enterotoxins. We can only speculate that the gut environment of these animals is probably not appropriate for ETEC establishment and/or colonization. Close adhesion of ETEC to the intestinal epithelium permits efficient toxin delivery (11). Secretion of water and electrolytes in the intestinal lumen results from toxin activity. ETEC are known to cause rapid onset of secretory diarrhea leading to dehydration. Diarrhea is defined as soft to watery feces containing less than 10% dry matter. Lethal ETEC infections occur as a result of severe dehydration and electrolytes imbalance.

ETEC affect various animal species causing profuse neonatal diarrhea in piglets, calves, sheep, and dogs and post weaning diarrhea (PWD) in piglets. In these animals, ETEC provoke diarrhea through a set of different enterotoxins. Colonization factors F5, F6, F17, and F41 are associated with ETEC strains causing neonatal diarrhea whereas F18 is generally associated with strains causing PWD, and F4 with both types of strains (1219). ETEC-producing STa as the only toxin are associated with disease in neonatal pigs, calves, lambs, and dogs (5, 20).

Pigs

Diarrhea, one of the most common diseases in piglets worldwide, is transmitted from asymptomatic carrier piglets, or sows and piglets with diarrhea to naïve animals (20). Animals can be infected at early age (neonatal diarrhea) and after weaning (PWD). At birth, the pH of the piglet stomach and duodenum is relatively alkaline and production of digestive enzymes is poor favoring the establishment of infection. Diarrhea of newborn piglets is observed during the first 3–5 days of life. ETEC are frequently the primary and sole infectious agent (5). ETEC that have specific F antigens tend to be associated with a limited array of somatic O serogroups (Table 1).

Table 1.

Fimbriae of animal ETEC

Fimbriae Enterotoxi ns1 Host Associated O-serotypes References
F4ab, ac, ad (K88ab, ac, ad)2,3 LT, STa, STb neonatal and weaned piglets 8, 45, 138, 141, 147, 149, 157 (77, 584586)
F41 STa calves, lambs and goat kids 9, 20, 64, 101 (72, 586, 587)
F5 (K99) STa, STb calves, lambs and goat kids, piglets 8, 9, 20, 64, 101 (77, 584, 586, 587)
F6 (987P) STa, STb neonatal piglets 8, 9, 20, 46, 101, 138, 141, 147, 149 (77, 586588)
F18ac (2134P, 8813)2 LT, STa, STb weaned piglets 8, 25, 45, 108, 138, 141, 147, 149, 157 (203, 589)
F17a (F[Y], Att25) STa, LT-IIa calves 19, 101 (590592)
1

By expressing additional toxins (e.g. a Shiga-like toxin or a cytotoxic necrotizing factor) ETEC strains can share the pathogenic properties of non-ETEC strains

2

The F4 and F18 fimbriae each have their antigenic variants (the designation “a” describing the common antigenic determinants, and the second letter, the variant-specific determinants) (133, 203, 593). Shiga-like toxin-producing E. coli responsible for edema disease in weaned pigs express usually F18ab (F107) or F4 fimbriae

3

Fimbriae were classified and renamed according to their antigenic properties (594)

PWD on the other hand is common in piglets 3–10 days after weaning. It is an important cause of death in weaned pigs and occurs worldwide. The trend towards early weaning (at 3–4 weeks) may have been responsible for a concomitant increase in the occurrence of PWD. E. coli isolates from PWD are mostly ETEC and one or more strains can be found in the gastrointestinal tract of sick animals. Pigs with PWD typically have watery diarrhea that lasts from 1 to 5 days. This condition is a major cause of economic loss to the industry due to reduced growth rates and mortality. F18 and F4 are the fimbrial types commonly associated with PWD. F18 are typically associated with diarrhea of weaned pigs and F4 are associated with diarrhea in neonatal as well as weaned pigs. AIDA (adhesion involved in diffuse adherence), a non-fimbrial CF, has also been reported in E. coli from weaned pigs with PWD (21, 22). Some STb-positive strains or STb:EAST1 virulotypes of neonatal or weaned pigs may also be AIDA-positive and do induce diarrhea at least in experimental infections of neonatal pigs (22).

Calves and Sheep

Typically, ETEC in calves and lambs produce only STa and fimbrial adhesins F5 and F41 (1). Binding of F5 is age dependent and gradually decreases from 12 hours to two weeks of age. ETEC were implicated as the major cause of neonatal diarrhea in calves. These ETEC induce diarrhea in calves in the first four days of life, older calves or adult cattle being more resistant (10). Diarrhea accounts for more than half of all calf mortality on dairy farms.

Dogs

Most ETEC isolated from dogs with diarrhea are STa-positive but a small proportion of these are also STb-positive (23, 24). No LT-positive ETEC has been associated with diarrhea in this species. Many canine ETEC carry uncharacterized species-specific fimbriae.

EPIDEMIOLOGY

According to National Swine Surveys in the US during the nineties, diarrhea was a major cause of mortality and morbidity (2527). In recent years, a general decrease in microbial porcine diarrhea in developed countries can likely be related to significant improvements in pig housing, management, sanitation, vaccination and biosecurity. Nevertheless, ETEC remain frequent agents of porcine diarrhea and continue to be diagnosed in neonatal and post weaning piglets that die from diarrhea in various countries, including the US (2836), even though intestinal viruses became major topics of investigations. Notably, the presence of ETEC alone is not always sufficient for the disease to develop, indicating the influence of other factors such as feeding, weaning age, other infectious agents and season (37). The prevalence of the three major fimbriae (F4, F5 or F6) expressed by ETEC strains that colonize the intestines of neonatal piglets shows both temporal and geographic variations (Table 2). Although F4 became the major fimbriae of newborn piglet ETEC in the USA and Europe, F5 and F6 fimbriated ETEC remain a problem in some other countries. In the last 30 years, fimbriated isolates from sick pigs presented a less diverse F4- and O-serotype profile than 30–50 years ago. For example the F4ac variant became more predominant than the other F4 variants and O149 became a major O-serotype of ETEC in America, Europe and Australia (13, 28, 29, 3842). It has been suggested that the observed variations of these serotypes over time are the result of vaccination pressures. Alternatively, successful selection of certain serotypes might relate to the changes the pig farming industry has undergone over the years. However, the adaptation of animal ETEC is not exclusively clonal (43).

Table 2.

Numbers of F4-, F5- and F6-fimbriated ETEC isolated from piglets in various studies since 1979. Whenever possible (most studies), data including only neonatal piglets are shown.

F4 F5 F6 Country Year1 References
52 7 6 Netherlands 1979 (595)
54 9 55 USA 1980 (77)
13 1 5 Hungary 1982 (596)
48 13 30 USA 1986 (586)
27 44 25 USA 1986 (597)
50 9 16 Norway 1986 (598)
20 4 13 USA 1987 (599)
71 19 9 Sweden 1988 (600)
02 32 23 Canada 1988 (587)
20 16 5 Canada 1989 (91)
31 6 25 Japan 1990 (601)
55 6 16 England 1990 (90)
29 96 484 Indonesia 1991 (602)
790 23 157 Poland 1992 (603)
766 54 47 England 1993 (604)
10 5 5 USA 1994 (605)
59 8 16 Denmark 1994 (606)
0 6 13 Spain 1997 (607)
13 8 13 Spain 1997 (608)
18 9 26 Korea 1999 (609)
280 2 6 USA 1999 (18)
64 3 11 Japan 2001 (610)
13 7 1 Canada 2003 (497)
14 1 1 Australia 2005 (611)
95 33 0 Vietnam 2006 (612)
40 6 1 Canada 2008 (441)
8 31 4 Korea 2008 (613)
19 15 1 Zimbabwe 2009 (30)
1

Year of publication

2

Only non-classical serotypes were studied

FIMBRIAE, A HISTORICAL PERSPECTIVE

Fimbriae-mediated colonization of bacterial pathogens was first demonstrated in pigs, before similar studies were undertaken in other mammals or humans. The first described adhesive antigen of Escherichia coli strains isolated from animals was the F4 antigen (44), originally named K88 because it was thought to be a capsular antigen (K for “Kapsel” or capsule in german). Its proteinaceous nature and dependence on the presence of a plasmid was demonstrated later (45). This antigen was visible by electron microscopy as a surface–exposed filament that was thin and flexible and had hemagglutinating properties (46). Like other non-flagellar hair-like appendages on the bacterial surface, these fimbriae were also called pili. However, the designation of fimbriae is preferred by some because of historical precedence (47) or to distinguish adhesive (fimbriae) from conjugative (pili) organelles. That bacteria (48), and particularly E. coli (49), can agglutinate erythrocytes and that this property can be mediated by fimbriae (50), had been described previously. However, the fact that intestinal adhesion and colonization of E. coli in diarrheic animals (51) is mediated by fimbriae was first shown with F4 fimbriae (52). More importantly, the role of fimbriae as virulence factors was first demonstrated with these fimbriae (53). In a seminal paper, Smith and Linggood infected pigs with an enterotoxigenic E. coli (ETEC) that had either its enterotoxin- or its F4 antigen-determining plasmid missing to demonstrate that both the enterotoxin and F4 were needed to elicit severe diarrhea or death by dehydration. Moreover, in the absence of F4, significantly less E. coli could be isolated from the intestines, the difference being most impressive in the proximal portions of the small intestines. In this extensive investigation, the authors applied all the basic approaches for the study of bacterial virulence factors that were later reformulated as the molecular Koch’s postulates (54). For example, intestinal colonization and the induction of diarrhea in neonatal or weaned pigs were studied with a variety of strains, including plasmid-cured porcine ETEC strains into which the same or similar plasmids were reintroduced. Alternatively, nonpathogenic isolates were rendered pathogenic by introduction of the corresponding plasmids. To support their results, the authors even undertook competition experiments between the same strain carrying or missing either one or both plasmids. Additional studies by Jones and Rutter confirmed the role of F4 in ETEC adhesion and colonization of the small intestines of piglets (55). The latter study yielded data on the anti-adhesive properties of F4-specific antibodies. This result led the authors to the ingenious experiment demonstrating that neonatal piglets could be protected against ETEC by passive immunity acquired by colostral uptake from an immunized mother sow (56).

Finally, it should be noted that the F4 gene cluster was the first fimbrial system shown to be expressed and functional when cloned into a K-12 strain of E. coli (57). This work and further studies on both the F4ac (58) and F4ab (59) genes and their products spurred the cloning (60) and genetic study of other fimbriae, such as the common type 1 and the P fimbriae (61, 62).

THE ROLE OF FIMBRIAE IN ETEC PATHOGENESIS

Even though the role of fimbriae in animal ETEC pathogenesis has been demonstrated with clinical strains cured of plasmids encoding the fimbrial genes, confirming experiments with defined isogenic mutants were never undertaken (54). Thus, it could be argued that the absence of other plasmid-encoded genes could have affected the results. Nevertheless, there is extensive additional evidence supporting the importance of the F4, F5 and F6 fimbriae as essential adhesive virulence factors of animal ETEC (32, 6378). Evidence supporting the importance of the other fimbriae in Table 1 as adhesive virulence factors of ETEC is mainly epidemiological and indirect (e.g. passive protection with anti-F18 or F17 antibodies) (7981). All the fimbriae in Table 1 have been found associated with enterotoxin (genes) on clinical isolates of animals with diarrhea. However, F17 fimbriae are also expressed by diarrheagenic non-ETEC strains or by extra-intestinal E. coli (82), (8385). Clinical isolates of ETEC have clonal properties, since there is a preferential association of fimbriae with certain enterotoxins and O-serotypes (Table 1) that have lead to their classification into major pathotypes (86). Frequently, the same isolate carries the genes to express two or more fimbriae. Each fimbrial type carries at least one adhesive moiety that is specific for a certain host receptor, determining host species, age and tissue specificities (Table 1).

Some fimbriae were not included in Table 1, because their involvement in the pathogenesis of ETEC remains unclear. The CS1541 fimbriae are expressed in vivo by porcine ETEC strains (87, 88), but they don’t bind to porcine enterocytes in vitro. Other fimbriae such as the F165 (1)(similar to Prs or F11), F165 (2)(same as F1C) and CS31A (protein capsule) fimbriae have been reported to be associated with animal ETEC strains (producing ST). However, these fimbriae are mainly expressed on non-ETEC strains of porcine or bovine origin (8992). Most isolates expressing these fimbriae don’t co-express ETEC enterotoxins, but more typically express a cytotoxic necrotizing factor (CNF), as found in necrotoxic E. coli (NTEC) or the enteroaggregative E. coli (EAEC) heat-stable toxin (EAST-1, a diarrheagenic toxin), in the absence of an ETEC enterotoxin (93). The CS31A fimbriae don’t mediate bacterial adhesion to bovine or porcine enterocytes or their brush borders (94). Whether non-ETEC binding to enterocytes can be mediated by CS31A variants is not clear (95). No enteroadhesive property in relation to farm animals has been reported for both F165 fimbriae. Thus, both F165 and CS31A lack the typical properties of ETEC fimbriae. Some Dr-like fimbriae (Afa-7 and Afa-8) are expressed by diarrheagenic E. coli that are non-ETEC or extra-intestinal E. coli (83, 96).

FIMBRIAL GENE CLUSTERS

Like most studied bacterial fimbriae, the production of animal ETEC fimbriae requires sets of genes that are organized in clusters that include one and possibly more operons (Fig. 1). They all belong to various phylogenic clades of the chaperone-usher class of fimbriae (97). Most animal ETEC gene clusters for fimbriae are located on plasmids. These plasmids are quite large (40–100 kb) and usually also encode enterotoxin genes (98104) (Table 1). In some cases, the fimbrial genes are adjacent to an enterotoxin gene, creating a pathogenicity islet that includes all the genetic determinants responsible for the symptoms of diarrhea (105, 106). However, ETEC strains typically carry several large plasmids encoding additional enterotoxins and fimbrial and non-fimbrial proteins, suggesting that the resulting redundancy of colonization and diarrheagenic factors must be beneficial to the survival or the transmission of ETEC. These same plasmids can also carry antibiotic resistance genes (107109).

Fig. 1. Genetic organization of animal ETEC fimbrial gene clusters.

Fig. 1

Genes encoding similar products or products with similar functions were labeled with the same pattern; genes for the major fimbrial subunit (yellow), minor fimbrial subunits (blue), minor adhesive subunit (orange), chaperones (green), usher (red), regulators (purple) and mobile or conjugation elements (white).

The gene clusters for the fimbriae of animal ETEC (Fig. 1) encode proteins that have one of three essential functions for the production of fimbriae (110). First, two or more genes encode the structural components of the fimbriae. One protein, the major fimbrial subunit, forms most of the polymeric structure of the fimbriae, whereas the other components are incorporated as minor subunits. One (or sometimes more) subunit(s) of each fimbria carries at least one binding site for a specific mammalian host receptor. Second, the fimbrial biogenesis machineries all consist of two types of molecules, one or more periplasmic chaperones and one outer membrane protein, or usher (111). Finally, gene clusters for animal ETEC fimbriae encode typically regulatory proteins that are fimbriae-specific. Models depicting the subcellular locations of fimbrial subunits, chaperones and usher proteins involved in the biogenesis of the major fimbriae in animal ETEC are shown in Fig. 2.

Fig. 2. Fimbrial biogenesis models.

Fig. 2

The fimbriae consist all of the polymeric assembly of a major subunit (yellow) and of one or more minor subunits (blue), one of them being a tip adhesin (orange) for some fimbriae. For the K88 and K99 fimbriae, the major subunit is the adhesin. Usher proteins (red) locate in the outer membrane and channel the fimbrial subunits to the bacterial surface. All the fimbrial export systems use one periplasmic chaperone (green) for all the subunits, with the exception of the F6 fimbriae that have three chaperones, two being dedicated to two different fimbrial subunits. All the fimbrial proteins cross the inner membrane by using the general secretion (Sec) pathway (black), with the exception of fimbriae specific regulators that remain in the cytoplasm (not shown).

FIMBRIAL STRUCTURES

The hair-like appearance of fimbriae is best observed by negative staining electron microscopy. Fimbriae, which can reach 2 μm in length, have been typically classified by their thickness (diameter), which varies from 2 to 7 nm (Table 3). Diameter values cited in the literature seem to vary according to the bacterial growth conditions and the staining techniques used by each investigator (112115). One fimbrial thread or fimbria consists of the spiral arrangement of hundreds of protein subunits along a filamentous axis (116). The less the subunits are compacted along the axis, the less they share surfaces of interactions and the thinner and more flexible the fimbria appears. The structure of thick or thin fimbriae is best illustrated by a helix or spring that is compressed or stretched apart, every helical turn touching the next turn only in the former situation, and bending of the whole filamentous axis encountering the least amount of resistance in the latter situation. The model is also consistent with an axial hole (~ 2 nm), which is only visible on the electron micrograph of thicker fimbriae. Thick helical fimbriae can be stretched under certain in vitro conditions (117) or by using force to unwind the helix (118), accompanied by conformational changes in fimbrial subunits. It has been suggested that fimbrial stretching occurs in vivo to adjust and coordinate the lengths of the few hundred fimbrial threads anchoring the colonizing bacteria that are submitted to the intestinal peristalsis and its resulting shear force (119). Fimbriae-mediated bacterial adhesion to a target cell is enhanced by shear force, as described with F41 fimbriae (120). In addition, studies with adhesive subunits of a variety of fimbriae described a catch bond mechanism whereby tensile force induce stronger binding through the extension of the adhesin inter-domain linker chain and an allosteric conformational change of the binding pocket that closes around the receptor moiety like a Chinese finger trap (121). The components of animal ETEC fimbriae are listed in Table 3. Immune electron microscopy of animal ETEC fimbriae typically shows that minor subunits are located at the fimbrial tips as well as at discrete sites along the fimbrial threads (122, 123). Mechanical fragmentation of isolated type 1 fimbriae of E. coli resulted in increased adhesin-mediated binding, suggesting the uncovering of hidden or incorporated adhesive minor subunits (124). However, that minor subunits can effectively be incorporated into a fimbrial body remains controversial, since broken off fimbrial tips could increase binding by sticking along the sides of fimbrial threads. Moreover, as discussed later, the current biogenesis model of affinity-determined ordered delivery of fimbrial subunits to the periplasmic domains of the usher speaks against it (123, 125, 126). Bacterial mutants of minor subunits are typically poorly fimbriated or lack fimbriae (122, 123), in support of the involvement of minor subunits in the initiation steps of fimbrial elongation and tip localization.

Table 3.

The structural proteins of animal ETEC

Fimbriae Fimbrial diameter Major subunit Minor subunits References
F4 2–4 nm FaeG FaeC,FaeF,FaeH,FaeI,(FaeJ) (46, 58, 59, 113, 122, 246)
F41 3.2 nm Like F4 (no genes or protein names) (181, 182, 271)
F5 ~ 3 nm* FanC FanF, FanG, FanH (112, 251254, 614, 615)
F6 7 nm FasA FasF,FasG (106, 123, 195, 616, 617)
F18 6.7 nm FedA FedE,FedF (115, 199, 258)
F17 3–4 nm F17-A F17-G (215, 590, 618)
*

Reported wider values were likely due to strand bundling

ADHESINS AND HOST RECEPTORS

It is generally assumed that the fimbriae of ETEC strains act only as anchoring devices to serve bacterial colonization of the intestinal surface. Fimbriae-mediated ETEC colonization of the intestines in pigs induces also innate immune responses (127129), but it is not clear what bacterial molecules are responsible, whether LPS, flagellin or other effectors. The pathogenesis of ETEC strains is specifically linked with the colonization of the small intestine and not of the large intestine. The distribution of the receptor(s) and the differential environmental signals regulating fimbrial expression in each intestinal segment (130, 131) determine the bacterial colonization sites.

Many fimbriae mediate hemagglutination. Since fimbriae most frequently act like lectins by binding to carbohydrate moieties of glycoproteins or glycolipids, fimbrial receptors have frequently been studied with red blood cells of various animal species. Although hemagglutination remains a convenient way to study and classify fimbriae (132134), some fimbriae of animal ETEC such as F6 don’t agglutinate red blood cells, or do so only after chemical-treatment (135). Another caveat is that the O- and N-glycosylation profiles and the glycosylated host molecules on red blood cells might be quite different from the ones found in the intestinal mucus and on enterocyte brush borders of the relevant animal species. The presence, modification or absence of some of these receptors in the mucus or on the brush borders varies with age, and these changes have been proposed to explain age-dependent intestinal colonization and ETEC-mediated diarrhea. For example, only newborn and weaned piglets had F4 receptors in their mucus, the latter more than the former (136), while these receptors were hardly detectable in the mucus of 6-month-old pigs (137). Similarly, intestinal cells from older pigs or calves were resistant to F5-mediated adhesion (138). This correlated to the age-dependent disappearance of the N-glycolyl group in intestinal glycolipids required for the F5 receptor activity (139, 140). Studies on the F6 receptors suggested that intestinal brush border receptors, particularly sulfatide, are released in the mucus of post-neonatal pigs inhibiting fimbriae-mediated adhesion and colonization (141143). Lactotetraosylceramide, which was recently detected as a carbohydrate receptor moiety, was suggested to be inactivated by fucosylation in older pigs (144). In contrast, the adhesion and colonization by F18-fimbriated ETEC isolates was proposed to be dependent on receptors that develop progressively with age during the first 3 weeks after birth (145). F17-mediated bacterial binding to ileal mucus of older calves was decreased when compared with the binding to mucus of younger animals (146). The age-specific presentation and anatomical location in the intestines of the various receptor molecules for one fimbrial type don’t determine alone the susceptibility of neonatal or weaned animals to fimbriae-mediated colonization. Important are also the genetic makeup of breeds and individual animals determining whether a receptor is expressed or not, and the adaptive immune responses eliciting passive (colostral) or active protection against colonizing ETEC. The major intestinal receptors for animal ETEC fimbriae and their cognate fimbrial adhesins are listed in Table 4.

Table 4.

The fimbrial adhesins of ETEC and their receptors

Fimbriae Adhesins Intestinal receptor molecules References
F4ab FaeG(ab) b: Transferrin N-glycan (74 kDa)1 (159, 619)
 Galactosylceramide, sulfatide, sulf-lactosylceramide, globotriaosylceramide (162)
bc: IMPTGP (210–240 kDa)1,3 (620, 621)
bcd: Glycoproteins (45–70 kDa)2 (137)
  Aminopeptidase N (160, 161)
F4ac FaeG(ac) bc: IMPTGP (210–240 kDa)1 (620, 621)
  Galactosylceramide (162)
bcd: Glycoproteins (45–70 kDa)2 (137)
  Aminopeptidase N (160, 161)
F4ad FaeG(ad) d: Neutral glycosphyngolipids1 (622)
 bcd: Glycoproteins (45–70 kDa)2 (137)
  Aminopeptidase N (160, 161)

F41 Major subunit Unknown (erythrocytes: glycophorin AM) (120, 183)

F5 FanC N-glycolylsialoparagloboside (139, 140, 189, 190)
N-glycolyl-GM3

F6 FasG Sulfatide (142, 143, 165, 195)
Proteins (32–35 kDa)
FasA Ceramide monohexoside
(hydroxylated galactosyl-cerebroside)

F18ac FedF Unknown [F18ab: alpha(1,2)fucosyl-containing glycoconjugates] (205, 206)

F17a F17-G Mucins, glycoproteins (170–200 kDa) (146)
1

As suggested by Billey et al. (155)

2

As suggested by van den Broeck et al. (156)

3

Intestinal mucin-type sialoglycoproteins

F4 fimbriae and receptors

Biochemical studies identified several different receptors for the F4 fimbriae and its serological variants (Table 4). That the antigenic classification of the F4 variants also determines their binding particularities (147, 148) is consistent with the identification of the major fimbrial subunit FaeG as the F4 adhesin (149, 150). By definition, the F4 fimbriae are polyadhesins (110), since FaeG accumulates two roles by constituting most of the fimbrial structure and by mediating bacterial adhesion, unlike the better studied model that have a separate major subunit and an adhesive minor subunit that locates only at the fimbrial tip. FaeG combines its structural requirements with its adhesive role by grafting an additional ligand domain on its Ig-like core (151). Recombinant FaeG inhibits bacterial F4-mediated binding to enterocytes (152) and substituting the phenylalanine at position 150 of FaeG for a serine drastically reduced the hemagglutinating property of the F4ab fimbriae, suggesting that this residue is important for intestinal binding (150). Binding studies with engineered chimeric F4ac/ad indicated that amino acids 125 to 163 of FaeG are essential for F4 variant-specific binding (153).

The F4 receptor list in Table 4 is not exhaustive, other receptors of various molecular weights having been reported for the F4 fimbriae, as discussed in several reviews (154156). Some of the additional mucin receptors might represent released degradation products of larger brush border receptors. Depending on the presence or absence of the different F4 receptors, up to 8 groups of receptor phenotypes were described (157), with six having been studied in more details (158)(Table 5). As shown with different glycoconjugate receptors, the three F4 variants demonstrate lectin activities specific for a minimal recognition sequence containing a ß-linked HexNAc, a terminal ß-linked galactose enhancing the binding (159). It is most likely that the context of this sequence on the different receptors is responsible for the binding specificities of the F4 variants. In contrast, the F4 aminopeptidase N receptor is glycosylated and biochemical evidence indicated that sialic acid was needed for binding (160), whereas transcription levels or single nucleotide polymorphisms (SNPs) could not explain the various binding profiles of three F4 variants (161). Recent studies characterized some of the porcine intestinal carbohydrate receptor moieties interacting with the F4 fimbriae (162). Crystal structure comparisons of the FaeG variants and of the FaeGad-lactose complex suggested different variant-specific binding pockets with a potential involvement of conformational changes for the adhesion process (163). Noticeably, all the intestinal ceramides that act as receptor for the F4, F5 and F6 fimbriae need to be hydroxylated (140, 162, 164, 165), indicating the importance of the lipid moiety in the binding properties of gangliosides with short carbohydrate chains. Moreover, the membrane-embedded lipid portion of a glycolipid receptor determines the orientation of the carbohydrate target on the surface of host cells, and thus, plays an essential role in the recognition by a fimbrial lectin (166). Finally, although binding studies have focused on FaeG whether some of the F4 minor subunits contribute to the adhesive properties of the fimbriae in animals remains an open question.

Table 5.

Groups of F4/F4 receptor phenotypes, as originally classified (I-IV or A-E), with an updated nomenclature that distinguishes receptors with fully (RFA) or partially (RPA) adhesive phenotypes (155, 158, 623626).

A (IV) A1: F4abRFA/F4acR+/F4adRFA
A2: F4abRFA/F4acR+/F4adRPA
B (III) B: F4abRFA/F4acR+/F4adR
C C1: F4abRPA/F4acR/F4adRFA
C2: F4abRPA/F4acR/F4adRPA
D (II) D1: F4abR/F4acR/F4adRFA
D2: F4abR/F4acR/F4adRPA
E (I) E: F4abR/F4acR/F4adR

Genetic studies located the receptors of the F4ab/ac fimbriae on porcine chromosome 13 (167, 168), in the MUC4 region (169171). MUC4-mediated susceptibility was linked to the presence of high molecular weight glycoproteins (172). Based on linkage disequilibrium for MUC13 (173), and more specifically for six SNPs (two in MUC13) with the F4ab/ac receptor locus, this locus was located between the LMLN locus and microsatellite S0283 (174). Further studies confirmed a link between the F4ac receptor locus and MUC13, and pigs expressing at least one transcript predicted to encode a highly O-glycosylated MUC13 protein (MUC13B) were F4ac-susceptible, whereas pigs homozygous for the non-glycosylated allele (MUC13A) were F4ac resistant (175). In differing studies, transcription of either MUC13 or MUC20, another gene associate to F4ac binding (176), did not relate to the adhesive phenotype (177). Moreover, biochemical studies were unable to detect an interaction between MUC13 and F4ac and genotyping assays suggested that a yet uncharacterized M13-adjacent orphan gene participates in glycosylation of the F4ac receptor (178). In another investigation, the SNPs or transcription of 12 genes involved in the assembly of glycosphingolipid carbohydrates could not be associated to a F4 binding phenotype (179). In contradiction to early studies, recent data suggested that pigs carrying F4ab/ac receptors had greater average daily weight gains than pigs lacking these receptors or having the F4ad receptor (180), possibly contributing to the prevalence of F4 variants in western countries.

F41 fimbriae and receptor

DNA hybridization and gene expression studies indicated that the F41 fimbrial gene cluster is most similar to the F4 gene cluster, with the exception of the major subunit gene (181, 182). Thus, it is assumed that this fimbrial subunit acts as the F41 adhesin. An intestinal receptor for the F41 fimbriae remains to be identified, although it might include N-acetylglucosamine in a carbohydrate group that mimics one on glycophorin AM, as determined by hemagglutination assays (120, 183). A quantitative trait locus (QTL) with a suggested candidate gene (ST3GAL1) was found on Chromosome 4 (SSC4) (184).

F5 fimbriae and receptors

Similar to the F4 fimbriae, the major F5 subunit FanC was shown to be responsible for the hemagglutinating properties of the fimbriae (185, 186). Site-directed mutagenesis of two positively charged residues, lysine 132 and arginine 136, affected the interaction with erythrocytes known to share some of the sialylated glycolipid receptors with piglet and calf intestines (139, 140, 187191).

F6 fimbriae and receptors

In contrast to F4 and F5, F6 fimbriae do not agglutinate mammalian red blood cells, but only bind to intestinal cells of neonatal piglets (141, 143, 192194). The F6 minor subunit FasG binds specifically to porcine histone H1 proteins (143, 195, 196). FasG also mediates F6-binding to a glycolipid receptor, porcine intestinal sulfatide (142, 165). Out of twenty single arginine or lysine to alanine mutants, binding to sulfatide-containing liposomes was reduced in four cases (residues 17, 116, 118, 200) and abrogated for one mutant (lysine 117). All five mutants produced wild type levels of F6 fimbriae. It was proposed that one or more of these residues communicate with the sulfate group of sulfatide by hydrogen bonding and/or salt bridges (197). All the allelic FasG proteins with reduced binding to sulfatide still interacted like wild-type FasG with the protein receptors of porcine brush borders. At least two segments of FasG that did not include lysine117 were involved in this interaction, suggesting that different residues, and thus different domains of FasG, are required for binding to the protein and the sulfatide receptors (198). In addition to the two entero-adhesive properties of FasG, a third type of F6 binding occurs between the major subunit FasA and piglet brush border hydroxylated ceramide monohexoside (165). More recently, F6 fimbriae were shown to bind to lactotriaosylceramide and lactotetraosylceramide isolated from the intestines of 6 weeks old pigs (144). Whether these receptors are already expressed in younger neonatal piglets, which are the targets for F6-fimbriated ETEC, was not determined.

F18 fimbriae and receptors

For the F18 fimbriae, the minor subunit FedF of F18ab (199) was shown to act as an adhesin specific for porcine intestinal epithelial cells (200). The continuous FedF sequence from residue 60 to 109 was important for binding (201). Each of its charged residues was substituted for alanine, one at a time, and three mutations (replacing lysine 72, histidine 88 or histidine 89) significantly diminished bacterial binding to jejunal epithelial cells. Binding was abolished with a double mutant (lysine 72 and histidine 88) and the triple mutant. All these mutants produced wild type levels of fimbriae. The fedF sequence of 15 clinical isolates indicated 97% identity, with 8 sequences showing an asparagine substitution to glycine or aspartic acid at position 73 (201). Both substituted and “wild type” alleles were found in O139-serotyped strains, which typically express F18ab, and in O141-serotyped isolates, which usually express F18ac. Similar results were obtained with a study of 37 strains of F18-expressing E. coli of various countries (202). Thus, it is likely that F18ab and F18ac bind to the same receptor(s), as suggested in earlier studies showing that either F18ab or F18ac fimbriae inhibit F18-mediated bacterial attachment to enterocytes (203). Whether the adhesive function of F18 fimbriae is modulated by the reported allelic sequence profiles of fedF in clinical isolates remains an open question. Genetic studies have shown that susceptibility to F18ab-mediated enteroadhesion was inherited in pigs as a dominant trait and that it was linked to the α (1, 2) fucosyltransferase FUT1 gene on porcine chromosome 6 (204206). These studies suggested that this glycosylase adds an essential fucose to one or more glycoconjugate receptors for the F18ab fimbriae. The role of FUT1 was consistent with the inhibition of F18-mediated receptor binding by a monoclonal antibody specific for the red blood group antigen H2, a trisaccharide that carries a terminal fucose (207), and confirmed biochemically by F18-binding to a variety of hexa- to nonaglycosylceramides from porcine intestinal epithelial cells, all carrying at least one terminal fucose (208). The crystal structure of FedF with its N-terminus bound to the blood group A and B type 1 hexaoses revealed a shallow glycan binding pocket with an adjacent polybasic loop proposed to stabilize F18 binding by interacting with intestinal cell membranes glycosphingolipids (209, 210). This polybasic loop was proposed to benefit particularly the intestinal binding of F18-ETEC to pig intestines, in the absence of inhibitory milk glycans that follows weaning (210). Several investigators in China detected that the homozygous resistance genotype occurred only in certain western breeds and associated with genotypes for other forms of resistance (211214).

F17 fimbriae and receptors

The F17G minor fimbrial subunit is the adhesin of the F17 fimbriae (215). F17G mutants produce normal fimbriae that do not bind to calf intestinal epithelial cells. Binding inhibition assays suggested that the carbohydrate specificity of the F17a fimbriae is a terminal or an internal N-acetylglucosamine on O-linked oligosaccharides of bovine mucins or intestinal glycoproteins (146, 210, 216). The crystal structures of the immunoglobulin-like lectin domains of two F17 adhesins (F17G and the related adhesin GafD) that bind N-acetylglucosamine were resolved (217, 218). Although an f17G gene encoding a different N-terminal sequence was recently described, it was not carried by an ETEC strain (85).

FIMBRIAL BIOGENESIS

Animal ETEC use the export and assembly apparatus of protein subunits known as the chaperone-usher pathway of fimbrial biogenesis (110, 219). Although the earliest models of fimbrial biogenesis were developed by studies on K88, much of the current knowledge was obtained by more detailed investigations on the type 1 and P fimbriae. To produce fimbriae on the bacterial surface, the structural subunits have to be transported directionally through two membranes (Fig. 2). With the exception of the fimbriae-specific regulatory proteins, both the fimbrial subunit and biogenesis proteins have typical signal sequences allowing them to cross the cytoplasmic membrane by using the general secretory pathway, also designated sec-translocase (220). Having reached the periplasm, an exported fimbriae-specific chaperone associate with a fimbrial subunit that appears on the periplasmic side of the inner membrane and lends a beta-strand to complete the immunoglobulin fold of the subunit by a mechanism termed donor strand complementation (221) (222). The chaperones stabilize and protect the fimbrial subunits against proteolytic degradation and premature assembly in the periplasm. Most importantly chaperones keep the subunits in an assembly- and export-competent conformation, the energy for subunit export and assembly being maintained by the conformational state of the chaperone-associated subunits (223). After their export to the periplasm, usher proteins reach the outer membrane, where they assemble in a beta-barrel structure with the help of the BAM assembly machinery (224, 225).

Fimbrial subunit release and delivery to the usher by the chaperone is coupled with the assembly of the subunit into a fimbrial fiber through a donor-strand complementation mechanism (110, 219, 226, 227). The usher molecule forms a gated channel that is required for the translocation of fimbrial subunits in a linear structure through the outer membrane (111, 221, 228). Although earlier findings suggested oligomeric and dimeric structures, recent work indicated that monomers are sufficient for fiber assembly and secretion, with a plug domain, a C-terminal domain required for filament assembly and an N-terminal domain responsible for recruiting the chaperone-subunit complexes (229). Incorporation of subunits into the linear fimbriae with the help of the usher protein results in the extension of fimbriae on the bacterial surface, where they take their final helical conformation (230). Thus, the usher also acts as an anchor for the elongating fimbrial fiber (58). Minor fimbrial subunits are frequently observed on the tip of fimbriae by immune electron microscopy. Since fimbriae grow from the base (231), tip-associated minor subunits have to be delivered to the usher before the major subunits. The role of these minor subunits can be essential in initiating fimbrial elongation, as described below for the individual fimbriae, when a mutation in a minor subunit gene results in the reduction or lack of fimbriation (122, 123).

F4 biogenesis

DNA and protein sequence differences of the serologically differentiated F4ab, F4ac and F4ad fimbriae are found between and within their major subunits FaeG (232). However, the sequences of the accessory genes of the F4ab and F4ac are identical (114, 233). The F4 chaperone FaeE (234238), and the usher FaeD (239241) are involved in the export of the adhesive major subunit FaeG and three to five minor subunits (FaeC, FaeF, FaeH, and possibly FaeI and FaeJ) (156, 221, 242244). Genetic studies predict that the usher FaeD spans the outer membrane with 22 beta-strands, leaving relatively long N- and C-terminal ends in the periplasm (240, 241), which are likely used for subunit assembly and export as currently modeled (111, 229). FaeC, unlike FaeG, H and F, interacts only weakly or indirectly with the chaperone FaeE in the periplasm, but binds well to the usher FaeD (245). The model of F4 biogenesis suggests that FaeC locates at the fimbrial tip and plays an essential role in initiating fimbrial export and assembly, since there is no fimbriation in its absence (246248). FaeF is thought to act as an adapter that links FaeC to the fimbriae. In addition, FaeF locates also at distinct distances along the fimbrial length, as does FaeH, and both are involved in fimbrial biogenesis since 40 to 100 times less fimbriae are expressed in their absence (122). The FaeI and FaeJ proteins share sequence similarities with the other subunits. However, their role is not clear and the corresponding mutants have no detectable phenotypes. The F41 biogenesis apparatus has not been studied in great details. However, it was shown that the F41 gene cluster contained a similar gene arrangement as the F4 gene cluster (181, 182). Moreover, F41 subunit-containing fimbriae were expressed by complementing its gene with the accessory genes from the F4 gene cluster, indicating that the F41 and F4 export and assembly system are closely related (249).

F5 biogenesis

The export of the F5 subunits is coordinated by the monomeric chaperone FanE (234, 250) and the usher FanD (251). The minor subunit FanF is positioned both at the tip and along the fimbrial shaft (252). This is consistent with the phenotype of a fanF mutant that produces only 0.1% fimbriae, all being short. FanG and FanH are additional minor components of the F5 fimbriae (253, 254). They associate with FanF and participate in the initiation and elongation of the fimbriae, since fanG and fanH mutants are nonfimbriated or produce shorter and less fimbriae (1–2% wild type levels).

F6 biogenesis

FasG, an adhesive minor subunit, is the first exported subunit of the F6 fimbriae, followed by FasF, the second minor subunit proposed to act as a linker molecule, and FasA, the major structural subunit (123, 195). FasG and FasF can be visualized as well at the tip as along the fimbrial shaft. In their absence, no fimbriae (or very rare short fibers for a fasF mutant) are expressed (106, 255). The outer membrane protein FasD is the F6 usher protein and mutagenesis studies suggested that its structure consists of a ß-barrel with 28 amphipathic ß–strands crossing the membrane (256). FasD was most accessible to proteases from the periplasmic side, implying the presence of a membrane-embedded usher with large periplasmic loops. In contrast to most other fimbrial systems, F6 fimbrial biogenesis involves three different chaperones (257). FasB is the chaperone associating with the major subunit FasA, whereas FasC acts independently of FasB as the FasG-specific chaperone. FasE, a chaperone like protein was also located in the periplasm. Although no FasE-associated Fas protein could be detected, FasE was shown to be required for optimal export of FasG.

F18 biogenesis

The serologically differentiated F18ac and F18ab fimbriae consist mainly of a major subunit FedA that has different protein sequences both between and within the serovars (258261). Accessory genes and products have only been investigated for the F18ab fimbriae. However, by analogy to the F4 fimbriae, it is assumed that the F18ab and F18ac accessory genes have the same or very similar sequences. Based on their sequences and their requirement for fimbriation, the fedB and fedC genes were proposed to encode the usher and periplasmic chaperone proteins of the F18ab fimbriae (200). Two minor fimbrial subunits FedE and the adhesin FedF are not essential for fimbriation, but corresponding deletion mutants formed longer fimbriae, indicating that their products control fimbrial elongation (199). Interestingly, fedE mutants (like fedF mutants) don’t bind to porcine intestinal villi, suggesting that FedE is involved in the export and assembly of FedF.

F17 biogenesis

Analysis of the DNA sequence from the F17a gene cluster of a bovine ETEC strain revealed the presence of four genes (215). The chaperone F17a-D and the usher protein F17a-C are essential for the export and assembly of the major subunit F17a-A and the minor adhesive subunit F17a-G. An F17a-G mutant can make wild type levels of unaltered fimbriae that don’t bind, indicating the F17a-G adhesin is not required for fimbriation. A major subunit F17a-A mutant doesn’t bind either. This suggests that the major subunit is needed for the export, the final conformation or the presentation of F17a-G on the bacterial surface (215).

REGULATION OF FIMBRIAL EXPRESSION

Fimbrial gene clusters typically include one or two genes that specifically regulate the transcription of the genes in their cluster. It is generally assumed that fimbrial gene clusters have only one promoter per direction of transcription. However, when studied in more details, some gene clusters were found to carry multiple promoters and operons for the different accessory proteins (262). In addition to the fimbriae-specific regulators, each fimbrial gene cluster typically belongs to specific regulons that can be activated or repressed by global regulators such as H-NS (histone-like nucleoid structuring protein for temperature and osmolarity mediated signals) or CRP (cAMP receptor protein for catabolite repression). Some intriguing data highlighted the possibility that auto-inducer molecules expressed by the intestinal microbiota or host catecholamines have an effect on intestinal colonization by ETEC (263). Recent data indicated increased gene expression and production of F4 fimbriae by an ETEC strain grown in the presence of conditioned media and epinephrine (264), but more work is needed to dissect the corresponding mechanisms of regulation.

Some fimbriae undergo phase variation. Transcriptional regulation ensures that all bacterial siblings synchronize their “on” or “off” switch for fimbrial expression. In contrast, a bacterial population regulated by phase variation always contains both “on” and “off” switched variants. The ratio of “on” and “off” variants depends on environmental growth conditions and one type of variant may be as scarce as mutants. It is thought that phase variation improves the survival rate of a bacterial population that is abruptly submitted to a new environment that selects for the scarcer phase variant. Fimbrial expression can be regulated post-transcriptionally. E. coli small RNA (sRNA) have been shown to regulate the transcription of some fimbriae (265, 266). However, it is not known whether sRNA also regulate ETEC fimbriae.

F4 regulation

The F4 fimbrial gene cluster carries two genes, faeA and faeB, encoding proteins that are similar to regulatory proteins of the P and S fimbriae (267). FaeA negatively controls F4 expression whereas FaeB doesn’t appear to regulate F4. Cis-active regulation of fimbrial expression is mediated by the level of methylation of three GATC sites upstream of faeB (268, 269). Dam (deoxyadenosine methylase) methylation of the first GATC site prevents the coordinate binding of the global regulator LRP and FaeA at this site; a regulatory mechanism thought to inhibit a lethal overproduction of fimbriae. Methylation of the two other GATC sites destabilizes Lrp/FaeA binding and methylation of the third site activates transcription of faeB (and downstream fae genes). The population of F4-encoded plasmids in a culture consists of a mixture of replicons that are either methylated (20%, responsible for high level expression) or nonmethylated (80%, responsible for low level expression) at the third GATC site (the first site remaining methylated and the second, nonmethylated). Thus, the methylation status of the third GATC site modulates the level of fimbrial expression. The presence of the two IS1 elements between faeA and faeB results in the lack of any detectable regulatory effects of FaeB on faeA or faeB transcription and in the constitutive expression and auto-activation of faeA. These effects were proposed to explain why the F4 fimbriae do not undergo phase variation as observed with the P fimbriae, despite the presence of similar regulatory proteins and GATC sites in cis (269). No regulatory genes have been identified for the F41 fimbriae. However, F41 expression is repressed at low temperature and in the presence of alanine, indicating that the F4 and similar F41 fimbrial systems are regulated in a different manner (270, 271).

F5 regulation

The production of F5 fimbriae or the transcription of the major subunit gene fanC is activated in the logarithmic growth phase, by oxygen, by low pH and by glycerol, whereas fewer fimbriae or fan transcripts are expressed in stationary phase, at high pH and in glucose-, pyruvate-, arabinose- or lactose-containing media (272, 273). Studies on several compounds as carbon source for bacterial growth indicated that acetate has a strong inhibitory effect on fimbriation and that together with glucose it essentially suppresses F5 expression (274). Fimbrial subunit production is drastically reduced in a cya mutant, confirming that F5 is regulated by catabolite repression (275). Curiously, unlike many other fimbrial systems, H-NS is not involved in the noticeable down-regulation of F5 expression at low temperature (270, 273). Moreover, two groups of F5-producing ETEC strains were distinguished based on the regulation of fimbriation by different growth conditions (276). At the 5′ end of the F5 gene cluster are two genes, fanA and fanB, that are transcribed in the same direction as the F5 genes and activate F5 expression (277). Studies on F5 gene transcription suggested that FanA and FanB act together as transcriptional antiterminators on two factor-dependent terminator sites after the fanA and fanB sequences (278). A third terminator after the fanC sequence includes a dyad symmetry for a potential stem-loop structure, suggesting that transcriptional termination at this site is factor-independent. Lrp (leucine-responsive regulatory protein) acts as a F5 transcriptional activator by binding to the fanA promoter (279). It is likely that the inhibitory effects of alanine and leucine on fan gene transcription and F5 fimbrial expression (279, 280) are mediated through Lrp. Most interestingly, the F5 gene cluster seems to consist of three operons, one for the fanA to fanD genes, a second one for the fanE and fanF genes and the third one for the fanG and fanH genes (262, 281). A stem-loop structure between fanE and fanF might act as an attenuator of fanF transcription. Putative promoters were mapped for the last two operons and the one upstream of fanE was adjacent to a CRP-binding consensus site, suggesting that the fanEF operon, like the fanABCD operon, is also regulated by catabolite repression.

F6 regulation

Early studies recognized that F6 fimbriae are best expressed in vivo in piglet intestines or in vitro when bacteria are grown to stationary phase, forming pellicles at the air-medium interface (64, 65). F6 fimbrial expression undergoes phase variation. Specific environmental signals or growth conditions regulate the rate of phase variation (282). The mechanisms and the potential cis- or trans-active elements regulating F6 phase variation are different from those of the F6-similar CS18 fimbriae of human ETEC (130, 131, 283, 284). Unlike CS18, no F6 DNA segment is directly regulated by DNA inversion (283, 285). Moreover, dam methylation is not involved in F6 expression or phase variation (131, 286). The apparent stability of the duplicated F6 fimbrial genes in the same clinical strain on a plasmid and on the chromosome (70, 104, 131) may suggest that the merodiploid fas genes confer some advantage to the host strain. Alternatively, the two locations of the F6 genes could be due to separate bacterial populations in the same culture, some having integrated the plasmid or a mobile DNA element carrying the F6 genes in their chromosome. Whether potentially duplicated or mobile DNA is required for phase variation in not known. However, phase variation being recA-independent, any mechanism of intrabacterial DNA exchange explaining phase variation would have to involve other recombinases (131). Expression of the major subunit FasA and of F6 is up-regulated by FasH (FapR) (104, 287). FasH shares sequence similarity with the DNA-binding domain of the AraC transcriptional activator, and more specifically with the Rns subfamily of positive regulators of fimbriae and other virulence factors of Enterobacteriaceae (288). A portion of the proximal IS1 sequence of the Tn1681 transposon located upstream of fasH is involved in activating fimbrial expression (105). The expression of fasH and fasA are both regulated in response to the carbon source and the nitrogen source (131, 284). Since these nutritional signals are differentially modulated in the intestinal environment, they may provide a mechanism to allow preferential colonization of different segments of the intestine by various enteropathogens (130, 284).

F18 and F17 regulation

No regulatory genes for F18 or F17 fimbriation have been described yet. Although special growth media seem to improve F18 fimbrial expression in vitro (203), not all the strains express F18 under these conditions (289). In contrast to F18ac, most F18ab fimbriae of clinical isolates are poorly expressed on commonly used media, suggesting a different mechanism of regulation for these two types of fimbriae. The F18 gene cluster is similar to the AF/R1 fimbrial gene cluster of rabbit attaching and effacing E. coli (290). Even though the F18 gene cluster lacks the upstream cis-active transcriptional regulators of AF/R1, it has an araC-like gene directly downstream fedF (291), suggesting regulation by a potential F18-specific protein.

ENTEROTOXINS

Two classes of ETEC enterotoxins have been described: heat-labile (LT) and heat-stable (ST). An E. coli strain may produce one or both of these types of toxins (292). Both types of toxins are plasmid-encoded. Nomenclature is based on toxin size, sequence and biological activity. LT is structurally arranged as an AB5 toxin where A is the enzymatically active subunit and the B subunits correspond to the receptor-binding moiety. LT is related to Vibrio cholerae toxin (cholera toxin, CT) a highly immunogenic molecule. In fact, antibodies against CT cross-react with LT. STs are poorly immunogenic and no immunological cross-reactivity has been observed between them. STs are single short polypeptides (less than 50 amino acids) and show no sequence similarity. Although the enteroaggregative E. coli (EAggEC or EAEC) enterotoxin (EAST1) was originally detected in human isolates of the corresponding E. coli pathotype (293), it was later shown to be also present in some porcine ETEC (294). Overall, all enterotoxins are associated with intestinal secretion of water and electrolytes in their normal hosts and/or in animal models. No significant pathological lesions or morphological changes in the intestinal mucosa result from the toxic activity of these enterotoxins (295). Many virulotypes of ETEC or classes of enterotoxin-producing E. coli that can be distinguished by their sets of virulence factors responsible for diarrheal diseases have been reported. Characteristics of ETEC responsible for enteric diseases in animals are listed in Table 6.

Table 6.

ETEC implicated in diarrheal diseases of animals

Animal species Type of diarrhea Virulotypes
Pig Neonatal STa:F41
STa:F6
STa:F5:F41
LT:STb:EAST1:F4
LT:STb:STa:EAST1:F4
STb:EAST1:AIDA
Post weaning LT:STb:EAST1:F4
LT:STb:STa:EAST1:F4
STa:STb
STa:STb:F18
STa:F18
Cattle Neonatal STa:F5:F41
STa:F41
Sheep Neonatal STa:F5:F41
STa:F41
Dog Neonatal STa:X*
STb
*

X: Unknown fimbriae

Adapted from Gyles and Fairbrother (20)

HEAT-LABILE TOXIN

Generalities

In the 1950’s it was observed that some E. coli strains could cause diarrheal disease similar to cholera (296). Although most E. coli strains lack the genes for toxin production some strains secrete a heat-labile enterotoxin (LT) that is a homologue of CT produced by V. cholerae. These toxins share about 78% identity at the nucleotide level and their structures and function are very similar. The genes encoding LT are located on a large plasmid called pEnt (297). This plasmid can be transferred to non-pathogenic E. coli bacteria rendering them toxinogenic (298). LT enterotoxins are produced predominantly by human and porcine ETEC (1). In fact, the lion’s share of the knowledge on the structure and function of LT was obtained from human ETEC strains. In humans, LT causes a cholera-like disease with watery diarrhea and stomach cramps. In animals, LT-positive ETEC typically produces F4 fimbriae and STb suggesting a possible functional link between these virulence factors. However, STb and F4 are encoded on separate plasmids. Little heterogeneity among Ent genes found in porcine ETEC was observed (299). LT is part of an important group of toxins, the AB5 toxin family. Two subtypes of LT, LTI and LTII have been described. Differences between LTI and LTII are largely due to dissimilarity in their B subunit. LTI can be divided in LTIh and LTIp, produced respectively by human and porcine and human ETEC. These subtypes show slight differences in composition.

LTII consists of three antigenic variants, LTIIa, LTIIb, and LTIIc (300302) that are related to LTI in their A subunit but differ in their B subunits. In contrast to the more similar A subunit sequences, the amino acid sequences of the B subunit of LTI and LTII are highly divergent (303305). LTII is antigenically distinct from LTI, with only 41% sequence identity with LTI but possess similar biological activities. LTII genes have been isolated from E. coli strains from humans, cows, buffalos, pigs, and ostriches. LTII toxins have mainly been observed causing disease in humans and calves (1, 306). Purified LTIIa and LTIIb caused severe diarrhea in neonatal pigs (302). LTII antigenic variants bind to various gangliosides whereas LTI binds preferentially ganglioside GM1 (Table 7). ETEC must be in close contact with the host cell to exert its effect as a semi-permeable filter could prevent toxicity expression (307). Efficient LT delivery to host cells most probably occurs via vesicles containing LT. Strains expressing LT have also been shown to have an advantage in colonization. In fact, Berberov et al., (2004) have shown that elimination of the genes for LT was associated with a concomitant reduction of toxicity and reduction in colonization of the intestine of gnotobiotic piglets demonstrating that this enterotoxin plays a role in adhesion (7). In the same way Johnson et al., (2009) have shown that LT promotes adherence of ETEC; the mechanism appearing to require the ADP-ribosyltransferase activity (308). Glucose, at an optimal concentration for LT expression, enhanced bacterial adherence through the promotion of LT production (309).

Table 7.

Receptors for ETEC toxins

Toxin Subtypes Receptor(s)
STa STaH Guanylate cyclase C
STaP Guanylate cyclase C
EAST1 Guanylate cyclase C
STb Sulfatide
LTI LTIh * GM1, GD1b, GM2
asialo GM1, galactoproteins, galactose-containing glycolipids
LTIp
LTII LTIIa * GD1b, GD1a, GT1b, GQ1b, GD2
LTIIb * GD1a, GT1b, GM3
LTIIc * GM1, GM2, GM3, GD1a
*

In order of decreasing binding strength

Production and regulation

ETEC strains do not produce similar amounts of LT (310). In fact, they can vary quite substantially in their production. On the other hand, we now know that ETEC strains that are kept frozen for long time periods just after their isolation show little change in toxin production (311). In general, conditions mimicking the human small intestine are optimal for production of LT. Growth condition influence the amount of LT produced as no detectable toxin was detected at temperatures lower than 26°C with the production increasing with temperature to reach a maximum at 37°C (312314). Microaerophilic conditions as well as increased salt concentrations (optimum at 0.2M) promoted LT production (315). Alkaline pH is a signal for production and secretion of LT and growth medium with a pH of 8.6 resulted in optimal LT production (316). Glucose, which is found in the small intestine in appreciable concentration, increased the release of LT with maximum production at 2.5g/l (312, 314, 317). In contrast, short-chain fatty acids (in particular those with carbon chains between three and eight carbons) produced in large quantities in the colon impair production of LT (318). These conditions are believed to serve to indicate when LT production should be turn-off or turn-on.

Structure

LTI is a high-molecular-weight molecule (approx. 85 kDa) which activity is abolished after 15 min. at 60°C (Table 8). It consists of a bioactive A subunit and five B subunits assembled in a doughnut-shaped ring (319) that binds to GM1 ganglioside (Galβ1-3 GalNacβ1-4(NeuAc2-3) Galβ1-4Glcβ1-1 Ceramide) receptors found on the intestinal epithelial surface. Binding of LTI to GM1 located in lipid rafts on host cells is critical leading to expression of the toxic effect. Each B subunit binds cooperatively one GM1 ganglioside molecule. In addition, LT binds but more weakly to GD1b, asialo GM1, GM2, and a number of galactoproteins and galactose-containing glycolipids. In fact, this galactose-binding property was exploited for purification of LT (320).

Table 8.

Structural characteristics of toxins produced by ETEC

Toxin # a.a. M.W. (Da) Sequence/Arrangement Structure
STa graphic file with name nihms780638t1.jpg
 Subtype STaH 19 2,000 N S S N Y C C E L C C N P A C T G C Y
 Subtype STaP 18 2,000 N T F Y C C E L C C N P A C A G C Y
EAST1 38 4,100 ?
 17-2 strain MPSTQYIRRPASSYASCIWC Inline graphicTACASCHGRTTKPSLAT
 0–42 strain MPSTQYIRRPASSYASCIWC Inline graphicTACASCHGRTTKPSLAT
STb 48 5,200 STQSNKKDLCEHYRQIAKESCKKGFLGVRDGTAGACFG
AQIMVAAKGC
graphic file with name nihms780638t2.jpg
LTI 85,000 AB 5 graphic file with name nihms780638t3.jpg
 B-subunit 103
 A-subunit 240

Letters in bold and italics indicate the region involved in binding to the receptor.

Letters in red indicate the change observed for EAST1 variants.

Recently, the B subunit has been shown to bind to blood group determinants (321323). LT was observed to bind best to pig brush borders with type A blood (324) and to human erythrocytes with A and B glycolipids (325). In fact, a cohort study in Bangladesh found a high prevalence of ETEC-based diarrhea among children with blood type A or AB (326). However, it has to be proven if blood group antigens are functional receptors in vivo.

In addition to its toxic activity, LT was shown to binds to the surface of E. coli cells (327, 328). LT localized to the cell surface by binding to lipopolysaccharides (LPS) found on the bacteria. LPS is present in the outer membrane of Gram-negative bacteria and consists of a characteristic lipid moiety called the lipid A, linked to a series of sugar residues (329). This LT-LPS association is independent of the A subunit (327). Even though it is bound to LPS, the B subunits remain able to bind to its mammalian cell surface receptor (330, 331). Free soluble LPS can significantly inhibit the binding of LT to the surface of ETEC strains (327). LPS lacking the O antigen was effective in blocking binding suggesting that the core sugars were responsible for binding. For full binding activity, the core sugars of LPS are required although some weaker binding activity can be observed for highly truncated LPS as 3-deoxy-D-manno-octulosonic acid (KDO) is the minimal requirement for binding (332). LT binds specifically to unphosphorylated E. coli KDO residues as was shown using V. cholerae phosphorylated KDO. LT may or may not associate with outer membrane vesicles (OMV) (333, 334) but the majority of LT activity in the extracellular environment is associated with OMVs (327, 332). OMVs are globular structures composed of lipid, of approximately 50–200 nm in diameter that are released from all Gram-negative bacteria studied yet (334, 335). Active LT molecules are found inside OMVs as well as associated with their surface (308, 328). LT within OMVs contributes to toxicity as LT can mediate internalization of entire vesicles (331). The LT-LPS association is robust and OMVs could play a role in protecting LT from proteolysis (328). Overall, more than 95% of LT is attached to the OMVs via LPS.

Synthesis

Individual LT toxin subunits are produced in the cytosol under the control of a joint promoter. The operon encoding the A- and B- LT subunits (eltAB) is flanked by highly conserved regions followed by variable sequences that mainly consist of partial insertion elements (336). Sequence analysis indicates that genes encoding LT were acquired by horizontal transfer from V. cholerae around 130 million years ago (337). The global regulator H-NS is involved in regulation by repressing LT expression at lower temperature (338). In high glucose condition, such as found in the duodenum, LT genes are transcribed and toxin is produced as a result of the inactivation of bacterial CRP. The CRP system ensures low level of cAMP but in presence of glucose this system is inactivated. In low glucose milieu, significant amounts of cAMP are produced and released by host cells in response to LT activity. This signal represses eltAB through CRP. Glucose limits LT production to where the toxin exerts its function (i.e. in the small intestine) corresponds to an effective targeting strategy. On the other hand, short-chain fatty acids found in the colon affect negatively LT production (339).

The A (240 amino acids) and B (103 a.a.) subunits of LTI are synthesized with an N-terminal signal sequence in the cytoplasm. This sequence permits transport to the inner membrane (IM) and assembly as a holotoxin in the periplasm after the signal sequence is cleaved off. Disulfide- bond-A oxydoreductase (DsbA) aids in disulfide bond formation and peptidyl cis-trans isomerase ensures the formation of a cis-proline; together these steps facilitate folding (340). LT-A and -B subunits spontaneously assemble into holotoxins. Once formed, these complexes are remarkably stable remaining assembled from pH 2.0 to 11.0 (341, 342). Although strong acid conditions can dissociate the B pentamer, the free monomers re-oligomerize readily following neutralization. The A subunit (28 kDa) consists of an A1 fragment (22 kDa; a.a. 1–194) containing the active enzymatic site and an A2 fragment (5.5 kDa; a.a. 195–240) that links A1 to the B (11.6 kDa) subunits (Table 8). Before activation, the A1 and A2 fragments are connected through a short linker where nicking takes place. In contrast to CT this cleavage event is not required for LT toxicity to be expressed. Nevertheless, mutants unable to be nicked show a delayed toxic effect in cells in culture (343). These subunits upon nicking remain connected through a disulfide bond.

In a human E. coli strain, LTI was shown to be transported across the OM by a type II secretion pathway (344). There has been no report of such a pathway in porcine ETEC. A type II secretion system consisting of a complex of 12–15 proteins spanning the IM and OM is found in numerous Gram-negative species (345). The genes encoding type II secretion apparatus are also regulated by H-NS (346). Thus, these genes are turned on by conditions that favor LT production. LT secretion rely on the B subunit but the A subunit is not involved in the process (347). Some studies have shown that secretion of LT was dependent of a protein called LeoA found to be a GTPase (348, 349). More recently, LeoA, B, and C were shown to be dynamin-like proteins responsible for potentiating ETEC virulence through membrane vesicle associated secretion (350). As few ETEC strains carry LeoA, a ubiquitous role in secretion of LT cannot be imparted to this protein.

Internalization and mechanism of action

Human LT enterotoxin was assimilated to a prototype and used to decipher the mechanism of action of this significant toxin. Thus, it was observed that LT must enter host cell’s cytosol to exert its toxic effect (Figure 3). LT-binding results in the clustering of GM1 gangliosides targeting more GM1. The pentamer is required for entry into cells of the intestinal epithelium and disruption of the holotoxin prevents intoxication of host cells (351). After binding of the B subunit to their specific cell receptor, internalization of LTI is mediated by receptor-mediated endocytosis. Upon endocytosis, the GM1-associated LT toxin relocates to early and recycling endosomes (352). It is then transported in a retrograde manner to the trans-Golgi network independent of the late endosome pathway (353) and the endoplasmic reticulum (ER). At the extremity of the A2 fragment an RDEL-sequence aids in the transport of the toxin to the ER. Inside this structure, the proteolytic cleavage and reduction of a disulfide bond within the A subunit provoke the release the A1 fragment in the cell cytosol (354). This fragment possesses an adenosine diphosphate (ADP)-ribosyltransferase activity that acts on the Gs heterotrimeric protein complexes found concentrated in the lipid rafts. In the cytosol, a host ADP-ribosylation factor (ARF), which is a 20-kDa regulatory GTPase, binds to the A1 subunit allowing it to bind to NAD in its active site (355). The Gs protein complex consists of a hormone stimulatory receptor, a regulatory Gs protein, and adenylate cyclase (AC) as the effector present in the basolateral membrane. Activation of Gs occurs when GTP is bound to Gsα. This component dissociates from Gsβ and Gsγ subunits and in turn activates its target, adenylate cyclase. Conversion of GTP to GDP by the intrinsic GTPase activity of Gsα acts as a turn-off switch inactivating the complex. The transfer of ADP-ribose from NAD by LT to the Gsα subunit results in inhibition of intrinsic GTPase activity. As stated previously, ADP-ribosylation is enhanced by an ADP-ribosylation factor (ARF6) that activates the A1 catalytic subunit. This modification results in activation of Gsα that turns on constitutively AC. In turn, AC produces the second messenger cyclic adenosine monophosphate (cAMP) from ATP. This second messenger targets protein kinase A (PKA) an activator of the membrane chloride channel cystic fibrosis transmembrane conductance regulator (CFTR) located in the apical membrane of epithelial cells. Activation of CFTR provokes the opening of this anion channel and results in the secretion of chloride (Cl) and bicarbonate (HCO3) ions from the cells into the intestinal lumen (356). The ions electrolytic balance across the epithelium is affected and the net effect is an increase in salt concentration in the intestine making it hypertonic. The osmotic pressure forces large amounts of water out of the intestinal cells. Activation of CFTR is the major way by which LT toxin provokes water efflux from the cells to induce diarrhea. Nevertheless, PKA also phosphorylates and opens a basolateral potassium channel (357). In the basolateral membrane, PKA also indirectly increases the activity of Na+/K+/2Cl co-transporter (NKCC). This aids in the transcellular movement of chloride ions from the basolateral side of the intestinal lumen (356). Increased cAMP levels further contribute to enhance chloride secretion. In fact, cAMP inhibits the electroneutral absorption of Na+ from the intestinal lumen. The A1 subunit has also been implicated in stimulating arachidonic acid metabolism leading to the production of the secretagogue PGE2 in turn stimulating intestinal secretion (358). In contrast to CT, LTI does not stimulate the production of 5-hydroxytryptamine (5-HT or serotonin) (359). The osmotic gradient formed is responsible for the water flow outside of the cells and the observed diarrhea. Loosening of tight junctions (TJs) as a result of LT activity can also contribute to fluid loss into the intestinal lumen (360362). In summary, LT takes advantage of the host cell’s machinery in order to exert its toxic effect and the effect of LT once initiated is irreversible.

Fig. 3. Mechanism of action of ETEC toxins on intestinal epithelial cells.

Fig. 3

Signaling leading to water and electrolytes loss through activation of ion channels and loosening of tight junctions by the various toxins is described. CFTR: cystic fibrosis transmembrane regulator; AC; adenylate cyclase; ARF: ADP-ribosylation factor; PKA: protein kinase C; PKC: protein kinase C; GM1: ganglioside GM1; GC-C: guanylate cycles C; SFT: sulfatide; ER: endoplasmic reticulum; Gsα: α component of an heterotrimeric G protein; NHE3; Na+/H+-exchanger 3; PDE3: phosphodiesterase 3; cGMPKII: cGMP-dependent protein kinase II; cAMPKII: calmodulin-dependent protein kinase II; CaCC: calcium-activated chloride channel; P: phosphorylation.

HEAT-STABLE ENTEROTOXINS

Generalities

E. coli heat-stable enterotoxins came to attention in the 1970s after it was observed that heat-inactivation of bacterial cultures from patients and animals suffering from diarrhea failed to eliminate enterotoxigenic activity (363, 364). Heat-stable toxins are peptidic molecules of less than 50 amino acids. Their small size and 3D-structure are responsible for resistance to boiling. Based on their sequences and their biochemical characteristics we have recognized in this group STa (also known as STI), STb (or STII) and EAST1, all associated with ETEC (295).

STa

STa peptide

STa represents a family of toxins composed of a single peptide chain of approximately 2,000 Da. Toxins produced by human (STaH; 19 a.a.) and porcine (STaP; 18 a.a.) strains differ slightly in length and their amino acid sequence (Table 8). To date, STaP polypeptide has been observed in isolates from animal species including pigs, calves, lambs, chickens and horses and also from humans (365). In contrast, STaH is produced solely by human isolates. A 13 amino-acid peptide in the carboxy-terminus, which includes three disulfide bonds, corresponds to a highly conserved sequence and this sequence represents a common antigenic determinant. The amino-terminal sequence up to the first cysteine is not involved in toxicity (366). STa is particularly associated with ETEC that cause disease in neonatal animals. This toxin is also produced by ETEC implicated in PWD in pigs but rarely as the sole enterotoxin.

STa toxins are synthesized as larger precursors (72 a.a.) that are later cleaved into the active mature toxin (367, 368). Six cysteine residues involved in disulfide bond formation are present at the same position in STaH and STaP (Table 8). The tertiary structure formed by the disulfide bonds is critical and required for full biological activity (369). Native STa toxins are poorly immunogenic. However, both homologous and heterologous antisera can neutralize toxicity (370). STa is an acidic peptide with a pI of 3.98 and a molecular weight of approximately 2000 Da (371). It is soluble in water and organic solvents including methanol and resists several proteases. The molecule is resistant to acidic but not to basic pH. Disruption of the disulfide bonds inactivates the toxin.

Genetics

Genes encoding STa (estA) are found on plasmids of varying molecular sizes (372). In animal ETEC isolates, it is common to find gene coding for STa, colonization factor, drug resistance and production of a colicin on the same plasmid. Genetic studies demonstrated the existence of two types of estA. This gene has an AT content of 70% and is associated with transposons that are carried on plasmids of a wide range of molecular weights. The gene cloned from a bovine isolate (STaP) was shown to be part of a transposon (Tn1681) which is flanked by inverted repeats of IS1 (373). STaP genes from ETEC isolated from other animal species (including humans) are part of the same transposon (374). Genes encoding STaH and STaP may be carried by a single human ETEC strain. Sequencing of the STa gene revealed it was identical in 52 ETEC strains of porcine origin (299). Synthesis of STa by E. coli is subject to catabolite repression and optimal yields of toxin are obtained in glucose-free media (375).

Secretion and disulfide bonds formation

STa is produced as a 72-amino acid precursor molecule referred to as pre-pro-STa (376, 377). This polypeptide consists of a 19 amino acid signal peptide (pre-STa), a 35 amino acid pro sequence and an 18 or 19 amino-acid mature STa. The pro-STa is translocated across the cytoplasmic membrane and requires secA-dependent transport. The signal sequence is cleaved by signal peptidase 1 (378). STa pro-region guides it into the periplasmic space (379), but this region does not seem to be involved in the extracellular transport of the peptide (380). Three intramolecular disulfide bonds are formed in the periplasm by DsbA protein prior to secretion (381383). Proteolysis is then required to obtain biologically active 18 and 19 amino acids (378). STa toxin is secreted from the cell as it is synthesized. Mature STa molecules use TolC to cross the OM (384, 385) Formation of the three intramolecular disulfide bonds is not required for the mature toxin to pass through the OM (386). The three intramolecular disulfide bonds in STaH link cysteine 6 and 11, 7 and 15, and 10 and 18; in STaP disulfide bonds link cysteine 5 and 10, 6 and 14 and 9 and 17 (Table 8). These bonds stabilize the spatial structure (387). Using STa analogues it was demonstrated that the second disulfide bond is essential for toxicity whereas analogues without the first or the third disulfide bond showed only reduced toxicity (388).

Structure and toxic domain

STa tertiary structure consists of a folded peptide backbone assembled as a right-handed spiral from the first cysteine at the NH2-terminus to the last cysteine residue at the COOH-terminus (389) (Table 8). Three β-turns, located along the spiral, are stabilized by the three intramolecular disulfide bonds (390, 391). Overall, a 13 amino acid sequence from the amino-terminal cysteine to the carboxyl- terminal cysteine is essential for toxicity (392394). This segment was defined as the toxic domain of STaH and STaP. Four amino acids (N-P-A-C) are conserved in STaP and STaH enterotoxins (Table 8).

Receptor

STa express its toxicity by elevation of cyclic GMP (cGMP) in intestinal epithelial cells (367, 395). Cloning the receptor from cDNA libraries of rat, pig, and human intestine led to the identification of the STa receptor (396). The deduced amino acid sequence and functional expression in mammalian cells indicated that the STa receptor is guanylate cyclase C (GC-C) belonging to the atrial natriuretic peptide receptor family (367). GC-C is a glycoprotein that is expressed primarily on intestinal epithelial cells. It is present on the brush border of villous and crypt intestinal cells. It consists of an extracellular receptor domain, a transmembrane domain and cytoplasmic domain including a kinase homology domain and a guanylate cyclase catalytic domain at the COOH-terminus (397). The endogenous agonist for GC-C was found to be a 15-amino acid hormone called guanylin (367). This hormone appears to play a role in fluid and electrolytes homeostasis in the gut. Guanylin is 50% homologous to STa containing 4 cysteine residues involved in disulfide bond formation essential for biological activity. This hormone is less potent than STa in activating GC-C and in stimulating chloride secretion (Cl) (398, 399). STa is mimicking the hormone guanylin and the basal gut fluid homeostasis is altered through activation of GC-C. STa receptors are present throughout the human intestine and colon. Their number is decreasing along the longitudinal axis of the gut and binding of STa was noted in both crypts and villi of the small intestine and in crypts and surface epithelium of the colon (400). Binding is maximal on the villus and decreased along the villus-to-crypt axis (401). Based on the concentration of receptors, the posterior jejunum appears to be the major site responsible for STa hypersecretion of fluid. There is also good evidence that STa toxin binds to other receptors (295, 402).

Mechanism of action

STa is a potent toxin with rapid action but of short duration. For example, 6 ng of STa results in a positive fluid response in mouse intestine compared with 200 ng of STb or cholera toxin (CT) in the same model (403). STa exert its toxic activity through activation of an intracellular signaling cascade leading ultimately to watery diarrhea. STa receptor, is present on villus of the jejunum and ileum brush border of intestinal epithelial cells (400) (Figure 3). The binding of STa to the extracellular domain of GC-C and activation of the intracellular catalytic domain of GC-C results in hydrolysis of GTP and cellular accumulation of cGMP (404). Elevated cGMP level activates cGMP-dependent protein kinase II (cGMPKII) resulting in the phosphorylation of CFTR (395). Activation of CFTR induces secretion of Cl and HCO3 and a net fluid secretion in the lumen of the intestine (356). Osmotically-driven water secretion results thereafter. Elevated cGMP also inhibits phosphodiesterase 3 (PDE3), resulting in an increased level of cAMP which activates protein kinase A (PKA). This enzyme phosphorylates CFTR as well as it inhibits Na+ re-absorption following phosphorylation of the Na+/H+-exchanger 3 (NHE3) (367). The effect of STa is reversible.

STa and tight junctions

TJs, a structure responsible for sealing the epithelium, could be held responsible, at least in part, for the electrolytes and fluid loss due to STa. TJs are highly organized structures where numerous proteins, including claudins and occludins, are involved in keeping closely associated areas of two neighboring cells whose membranes join together forming a virtually impermeable barrier to fluid and ions (405). Altering TJs could provoke loss of water and electrolytes within the intestinal lumen (406). Nakashima et al., (2013) observed that treating T84 polarized cell monolayers with STa elicited a reduction in transepithelial resistance (TER), indicating a loss of TJ integrity (407). However, no increase in paracellular permeability to a high molecular weight marker (FTIC-dextran) was noted. In contrast to STa, guanylin did not affect TER. Although both STa and guanylin induced cellular cGMP production, only STa reduced barrier integrity suggesting that STa causes not only an induction of water secretion, through channel activation, but also induces intestinal barrier dysfunction. The effect of STa on epithelial TJs contributes to the enterotoxic activity and most likely plays a role in the pathogenesis of STa-producing ETEC.

EAST1

Generalities

EAST1 is a peptidic toxin originally recognized in an enteroaggregative E. coli (EAEC) strain isolated from the stools of a Chilean child suffering from diarrhea (293, 408). The gene coding for this toxin was also observed in other diarrhea-causing E. coli, including ETEC, and in some other human enteric pathogens such as Salmonella (294, 409, 410). EAST1 is often compared to E. coli STa enterotoxin as it shares some physical and biological similarities. However, it does not hybridize with STa-specific DNA probes nor reacts with anti-STa antibodies (293). EAST1 is widespread among porcine ETEC in various countries (411416). This toxin is not well characterized both in terms of function and contribution to ETEC-mediated disease. Diarrhea and sometimes death in a gnotobiotic piglet model resulted from infection with the prototype EAEC strain 17-2 (408, 417). EAST1 is associated with E. coli strains isolated from cattle and pigs with diarrhea (418421). Alone EAST1 does not seem capable to produce disease (22) but together with LT it is efficient in producing diarrhea (7). The role of EAST1 in mediating diarrhea in animals remains controversial to this day (416).

EAST1 peptide

EAST1 is a heat-resistant 38 amino acid peptide with a molecular weight of 4100 Da and a calculated pI of 9.25 (Table 8) (422). Four cysteines at positions 17, 20, 24, and 27, are involved in the formation of two disulfide bridges required for toxicity expression. Unlike STa and STb, a classic signal peptide was not observed in the NH2-terminus of the predicted EAST1 sequence (423). EAST1 is immunologically distinct from STa and a polyclonal anti-STa antibody does not neutralize the biological activity of EAST1 (293). The toxic domain is comprised in a peptide spanning residues 8 to 29 (293, 423).

Genetics

astA gene was detected in EAEC strains 17-2 and in EAEC strain O-42 (424, 425). Variants differ by only one base at codon 21 (ACA→GCA), resulting in a change in the amino acid threonine to alanine (Table 8). Heterogeneity in virulence of EAEC strains 17-2 and O-42 (424) was reported. As strain O-42 was able to provoke diarrhea in volunteers, whereas strain 17-2 did not, it has been proposed that variant O-42 could contribute to the virulence of EAEC in a more significant way (425). Moreover, the toxin produced by strain O-42 can be observed more frequently in epidemiological studies (425, 426). Numerous other variants of EAST1 have been observed (294, 427). These molecules have usually been reported only once and probably represent less frequently distributed EAST1 variants. The toxicity of these variants has not been evaluated in animal models.

The astA gene, a 117-bp-long DNA sequence encodes EAST1. There is no homology between astA and estA, the structural gene for STa. The G+C content of astA is 53%, which is similar to the mean value for E. coli (50.8%), while for estA (coding for STa) it is 30.6% (410). In EAEC strains astA is associated with a 60-MDa plasmid mediating aggregative adherence (410). astA was observed in one or more copy on plasmids of variable size but was also found on the chromosome of various bacteria, including ETEC (428). It has been detected in human, bovine, and porcine ETEC and it is commonly found on plasmids in F4-positive ETEC strains from pigs with diarrhea (421). The gene found in animals has more than 98% homology with the human isolates (7). Very little is known about the genetic regulation of EAST1 expression. Nucleotide sequences upstream of astA from porcine and bovine ETEC strains are identical, but are divergent from human ETEC. Even though results obtained by Yamamoto and Nakazawa point toward heterogeneity of DNA sequences between E. coli affecting humans and animals there seems to be a certain consensus among astA flanking sequences (429). This gene was also reported to be on transposon-like sequences, near insertion elements or inverted repeats, which could represent means by which the EAST1 gene is spread.

Mechanism of action

The small size and relative heat stability of EAST1 and the finding that cGMP is the molecule acting as a second messenger led to the comparison of EAST1 with STa toxin. Also, EAST1 protein shares 50% identity with the enterotoxic domain of STa (amino acid residues 6 to 18) (423). EAST1 is also structurally and functionally similar to guanylin, both having four cysteines and activating the production of cGMP (293). Interaction with GC-C could occur through the N-P-A-C motif common to STa and partially conserved for EAST1 (i.e. X-X-A-C) (Table 6). Hence, the mechanism of action of EAST1 is proposed to be identical to that of STa (Figure 3).

Toxicity of EAST1 has been evaluated in Ussing chamber and in the suckling mouse assay (293, 428). No concordance between the presence of astA and toxicity of live bacterial strains or culture filtrates could be established for several strains tested (410). EAST1 did not stimulate an increase of intracellular cAMP or cGMP levels in human T84 or in porcine IPEC-J2 cell lines (430). In addition, 5-day-old gnotobiotic pigs challenged with E. coli strains, expressing EAST1 as the only toxin, did not developed diarrhea or clinical signs 72h post-inoculation. EAST1 alone seems not sufficient to cause diarrhea in 5-day old gnotobiotic pigs suggesting that EAST1 is likely not a virulence determinant in ETEC-associated diarrhea. An experimental infection with E. coli strains positive for EAST1 and AIDA and a F4/EAST1-positive strains, in gnotobiotic piglets, did not produce diarrhea either (431). Although the EAST1/AIDA strain used in the study was present in fecal shedding of challenged animals it was not markedly associated with intestinal epithelial surface. Overall, these studies showed that EAST1 toxin alone does not induce diarrhea in the animals tested.

STb

Generalities

ETEC producing STb are associated almost exclusively with pigs and the majority of porcine ETEC produce STb enterotoxin. This toxin has also been detected in ETEC of human origin (432, 433). STb is recognized as a potent enterotoxin in weaned pigs (292, 434436).

STb peptide

STb-positive E. coli strains have been isolated principally from pigs but also sporadically from cattle (including water buffaloes), chickens, dogs, cats, ferrets and humans (437). STb comprises 48 amino acids with four cysteine residues involved in disulfide bridges formation (Table 8). The enterotoxin has a Mr of 5,200 Da and bears no homology to STa or EAST1 enterotoxins. STb peptide is synthesized as a 71 amino-acid precursor comprising a 23 amino-acid signal sequence (438, 439). The first seven amino acids at the NH2-terminus of the mature toxin are not involved in either the structure or toxicity (440). The peptide spanning from Cys10 to Cys48 has full biological activity. STb isolated from various animal species have the same nucleotide and amino acid sequences. Nevertheless, a STb variant with a His to Asn substitution at position 12 was identified in E. coli isolates from pigs suffering from diarrhea (441). This variant shares structural and mechanistic properties with wild-type STb (442). No differences in biological activity of the variant have been reported. STb is a highly basic protein with an isolelectric point of 9.6 (443). It is soluble in water and some organic solvents but is insoluble in methanol and the toxin loses biological activity following ß-mercaptoethanol or trypsin treatment (363, 444, 445). It resists acid (pH 2), alkaline (pH 12) and 8 M urea treatments (444). STb is very susceptible to protease degradation (446, 447). STb is poorly immunogenic. A serological response can be obtained following immunization with either fusion proteins or proteins chemically coupled to STb (448451). The anti-STb antibodies can neutralize STb toxicity but are unable to neutralize STa or CT toxins (452).

Genetics

The estB gene encodes STb. This gene is found on heterogeneous plasmids that often code for other properties including other enterotoxins, colonization factors, drug resistance, colicin production and transfer functions (372, 453). It is part of a transposon of approximately 9 kb designated Tn4521 (454456). This transposon is flanked by defective IS2 elements but it is functional as estB can transpose from one plasmid to another. The structural gene for STb from different clinical isolates is uniform in size but the flanking sequences are heterogeneous suggesting that estB could be found on different transposons. Transposition of estB is probably one of the mechanisms by which this virulence factor is disseminated among ETEC. The promoter for estB expression is weak (457), capable of binding RNA polymerase, but seems to be a poor transcription initiator and hence very little STb is produced. Production is under the control of environmental conditions. STb synthesis by wild-type E. coli strains varies with the composition of the culture medium (444, 458) and a repressive effect of glucose on STb production was reported (459).

Secretion and disulfide bond formation

Intramolecular disulfide bonds must be correctly formed in order to produce an active STb toxin. The STb polypeptide is synthesized as a 71 amino acids precursor (438, 439). The NH2-terminus of pre-STb, residues 1–23, has characteristics of a signal sequence that is cleaved by a signal peptidase during export to the periplasm using the Sec export system (460). Thus, an 8.1-kDa precursor (pre-STb) is converted to a transiently cell-associated 5.2-kDa form consisting of 48 amino acids. Conversion of pre-STb to cellular STb depends on the secA gene product. Translocation of the precursor to the periplasm requires energy. The export of STb relies on the general export pathway of E. coli. STb is detected as a cell-associated molecule and an indistinguishable extracellular form becomes apparent, indicating that no proteolytic processing occurs during mobilization of STb from the periplasm to the culture supernatant. Mature STb is found preferentially in the culture supernatant (460). STb was absent from the culture supernatant of dsbA and tolC defective mutants, indicating that these genes are required for secretion (461). Two intramolecular disulfide bonds must be formed for the efficient secretion of STb (462). Elimination of either one of the bonds renders the toxin susceptible to periplasmic proteolysis. STb is exported across the OM through TolC involving accessory proteins. MacAB, an ABC transporter, interacts with TolC and participates in secretion (463, 464). MacAB probably binds the toxin in the periplasm and transports it through the pore formed by TolC (465, 466). MacA is a subunit of the MacAB transporter stimulating the MacB ATPase activity (467). The central region of STb from amino acid 19 to 36 is involved in the secretory process (468) and DsbA is necessary for STb to adopt a structure that can then cross the OM.

Toxic domain and structure

A nuclear magnetic resonance study established that STb is helical between residues 10 and 22 and residues 38 and 44 (Table 8) (440). The helical structure in the region 10–22 is amphipathic, exposing several polar residues to the solvent. The loop region between residues 21 and 36 contains a cluster of hydrophobic residues. The integrity of the disulfide bonds is crucial for the structure and function of the toxin as already discussed. Oligomerization was observed for STb resulting in the formation of hexamers and heptamers (469). The region responsible for this process comprises hydrophobic residues M, I and F, found close to or in the hydrophobic α-helix (a.a. 37 to 42).

STb receptor

A glycosphingolipid present in high number in the plasma membrane was shown to be the STb receptor (470, 471). Binding of STb to commercially available glycosphingolipids was evaluated (472). STb binding varied greatly depending on the molecule tested. Sulfatide (SO43-galactosyl-ceramide) was the molecule to which STb bound with greatest affinity. The reaction was dose-dependent and saturable. Total lipid extraction of pig jejunum epithelium and thin-layer chromatography indicated the presence of sulfatide on this tissue. A mass spectrometer analysis on the lipids isolated following high performance thin layer chromatography of pig jejunum epithelium confirmed the nature of the receptor (473). A dissociation constant of 2.4 ± 0.61 nM for the STb-sulfatide interaction was observed (474). The functionality of sulfatide, a widely distributed acidic glycosphingolipid on the intestinal epithelium, was finally proven in the rat ligated loop assay (472). The binding site of STb with sulfatide is comprised between a.a. 18 to a.a. 30. The region responsible is partly within the amphipathic α-helix and the flexible loop rich in glycine (475, 476).

Mechanism of action

STb is a toxin with rapid action but of moderate potency (477). In mouse intestinal loops, purified toxin elicits a response in 30 min and fluid accumulation reach a maximum after about 3 h (403). STb stimulated a cyclic nucleotide-independent secretion. This enterotoxin is thus a cytotonic toxin with properties and a mechanism of action different from STa. In vivo significant accumulation of Na+ and Cl occur intraluminally following STb intoxication. As well, STb stimulates bicarbonate (HCO3) secretion (478, 479).

The level of prostaglandin E2 (PGE2) in the intestinal intraluminal fluid increases as a result of STb action (480). The quantity of PGE2 produced by intestinal cells is directly related to the dose of STb administered and the quantity of PGE2 correlated with the volumes of fluid released into the intestinal lumen. Levels of arachidonic acid is also elevated following STb intoxication, indicating that arachidonic acid metabolism is stimulated possibly through phospholipase A2 activity. The mode of action of STb may be somewhat similar to that of CT stimulating the release of both PGE2 and 5-HT and suggesting a potential effect on the enteric nervous system (3). STb could also act directly on the muscle cells of the ileal serosa increasing the spontaneous motility of the intestine resulting in contractions (403). Atropine could not abolish toxicity indicating it was not the result of the excitation of cholinergic nerves. Papaverine, which causes relaxation of smooth muscles, can inhibit STb implying that STb could act directly on muscle cells. Internalization of STb toxin within rat intestinal jejunum epithelium was observed (481) and the process was also confirmed using a confocal microscope and NIH-3T3 cells (482).

When cells are intoxicated, STb binds through its galactose sulfate moiety to an acidic glycosphingolipid, sulfatide, a molecule widely distributed on intestinal epithelial cells (470)(Figure 3). STb stimulates a GTP-binding regulatory protein resulting in a Ca++ level increase inside the cell activating CAMKII (483). Activation of protein kinase C (PKC) is induced following the Ca++ increase and phosphorylation of the CFTR ensues (483, 484). PKC also inhibits Na+ uptake by acting on an unidentified Na+ channel. CAMKII opens a calcium-activated chloride channel (CaCC) and could as well be involved in phosphorylation of CFTR. The increased Ca++ levels also influence the activities of phospholipases A2 and C leading to the release of arachidonic acid from membrane phospholipids and formation of prostaglandin E2 (PGE2) and 5-HT (or serotonin), two secretagogues from enterochromaffin cells. Both compounds mediate the transport of H2O and electrolytes out of the intestinal cells by a yet unknown mechanism (452, 485487).

Using brush border membrane vesicles (BBMV) isolated from piglet jejunum and a membrane-potential-sensitive probe, STb was shown to permeabilize the intestinal tissue. It can do so by forming nonspecific pores confirming previous trypan blue and PLB studies (473, 488). An electrophysiological study using planar lipid bilayers (PLB) where the receptor for STb was reconstituted into large unilamellar vesicles made of PE osmotically fused to PE:PC:cholesterol (7:2:1) showed resolved channels currents (489). Thus, STb appears to be involved in the opening of a voltage-dependent channel. The previous observation that STb forms oligomers (469) can indicate that STb may allow formation of pores that could alter the cellular membrane. Permeabilization of intestinal cells in vitro was observed without cell death. The formation of pores/channels within the plasma membrane may constitute a signaling event triggering fluid secretion associated with diarrhea.

In human (human colon tumor, HRT-18) and animal (rat ileum epithelium, IEC-18) cell lines, caspase-9, the initiator of mitochondrion-mediated apoptosis and caspase-3, an effector of caspase-9, were both activated following STb intoxication (490). DNA fragmentation was observed as well as condensation and fragmentation of nuclei. Overall the data indicated that STb toxin could induce, at least in these cell lines, a mitochondrion-mediated caspase-dependent apoptotic pathway.

STb and tight junctions

A significant reduction of TER parallel to an increase in paracellular permeability to BSA-FITC for STb-treated cells was noted in T84 human colon cells compared to untreated cells or cells treated with a non-toxic STb mutant (491). The increase in paracellular permeability was associated with a marked alteration of F-actin stress fibers. F-actin filaments dissolution and condensation observed in the presence of STb were accompanied by redistribution and/or fragmentation of ZO-1, claudin-1, and occludin. An 8 amino acid peptide (GFLGVRDG) present in STb sequence and corresponding to a consensus sequence of Vibrio cholerae Zona occludens toxin (Zot), affected T84 cells in the same way as STb (492, 493). A scrambled octapeptide (STb24-31) showed no effect compared to untreated cells. Further studies showed that STb provoked a redistribution of claudin-1, a protein playing a major role in TJ permeability. Claudin-1 was displaced from TJs and found in the cytoplasm. The loss of this protein from TJs was accompanied by its dephosphorylation (494). Thus, STb induces epithelial barrier dysfunction through changes in TJ proteins that could contribute to diarrhea. More studies are required to understand the pathways involved in STb-mediated alteration of TER and TJ proteins modulation.

OTHER VIRULENCE FACTORS

Although fimbriae with their adhesins and enterotoxins remain the characteristic virulence factors of enterotoxigenic Escherichia coli, additional encoded proteins can play various roles in the pathogenesis of these bacteria (495). For example and as mentioned earlier, the autotransporter protein AIDA is a non-fimbrial adhesin that is expressed by certain strains causing PWD in pigs (31, 496, 497). Iha is another adhesin usually associated with shigatoxin-producing E. coli that can be detected in some animal ETEC (495, 498). In addition to AIDA and Iha, it is likely that animal ETEC express other virulence factors, including some non-fimbrial adhesins and proteases described for certain human ETEC strains, such as the adhesins and invasins Tia and autotransporter protein TibA (499502), the autotransporter adhesin TleA (503), the host-activated adhesin EaeH (504, 505), the two partner secreted EtpA adhesin that binds to the flagellar tip and acts as an adhesive bridge (506), the mucin-degrading proteases EatA, an autotransporter serine protease, and YghJ, a secreted metalloprotease (507, 508). Genomic studies and molecular epidemiology will help to evaluate the presence, distribution and frequencies of these or similar virulence factors in animal ETEC strains (509511), whereas expression and functional investigations will be needed to identify new animal specific factors and potential host-adapted activation dependency (504).

VACCINES AND COLONIZATION INHIBITORS

Neonatal diarrhea vaccines

Studies on ETEC fimbriae have helped to better understand the biology and role of these organelles in pathogenesis; they have also opened the door to new diagnostic, prophylactic, and therapeutic tools. Following on the seminal studies of Rutter and Jones (55, 56, 512, 513) demonstrating that colostral antibodies induced by maternal immunization protected neonatal piglets, many additional in vitro and in vivo studies confirmed that fimbriae are highly immunogenic proteins and that the induced antibodies protect by inhibiting adhesion to enterocytes and intestinal colonization (6769, 73, 76, 81, 514517). Studies with ETEC strains of veterinary relevance have led to the development of effective parenteral anti-adhesive vaccines based on four types of fimbriae, F4 (K88), F5 (K99), F6 (987P), and F41. In general, these vaccines have been quite successful in the prevention of neonatal diarrhea in piglets and calves. Vaccination of dams is a cost-effective health management strategy to prevent ETEC diarrhea in neonates (32, 518). However, immunity generated by the current generation of vaccines that are based on lacteal immunity is not effective in the prevention of PWD (discussed further below).

Fimbriae are thought be very good immunogens because they are proteinaceous and contain a set of epitopes that are repeated 102 to 103 times on each fimbrial thread. Because bacteria have multiple copies of fimbriae on their surfaces, each bacterium can contain as many as 105 to 106 epitopes on each bacterial surface. On the other hand, recent data has shown that the use of a single fimbrial subunit from F4, the fimbrial adhesin subunit FaeG, does not provide good protection unless it is found in the polymerized fimbrial structure (232). Likewise, it has been shown that F5 needs to be assembled to induce immunity (519).Thus it is likely that vaccines for food animals produced using technologies that focus only on fimbrial subunits as immunogens will not result in good protection compared to polymerized, mature fimbrial strands. Notably, it has been shown that when foreign epitopes genetically engineered into fimbrial subunits and displayed in a polymeric form on attenuated live bacterial can be used to increase their immunogenicity (520525).

Because there are antigenic variants of some fimbriae, such as F4 (F4ab, F4ac, and F4ad), an important question is whether all three types are required in a vaccine for efficacy against all three types? Fortunately, there is strong immunologic cross reactivity between the three variants presumably based on the common “a” antigen. Thus cross-reactivities of the major and minor structural subunits of F4, results in good protection protection regardless of the origin of F4 in the vaccine if the vaccine contains polymerized F4. However, since there is no cross reactivity between F4, F5, F6, and F41 each of these types of fimbriae needs to be in the vaccine for the broadest level of protection. Among various advantages of using assembled ETEC fimbriae in vaccines are their relative resistance to enteric proteases and their ability to induce mucosal immunity; fimbriae are also fairly easy to extract intact from whole bacterial cells.

Other approaches for vaccines for ETEC include the use of formalin-treated fimbriated ETEC, the use of live fimbriated but nontoxigenic ETEC, or the use of attenuated Salmonella enterica mutants expressing cloned fimbriae. These vaccines have been used to immunize animals by the oral route and to successfully induce anti-adhesive antibodies (526530). Oral vaccinations, combined with parenteral applications, can increase and prolong the duration of lacteal immunity (529). A potential advantage of fimbriae of enteric pathogens is that they possess enteroadhesive properties, which they share with other mucosal immunogens such as the enterotoxins. The binding of fimbriae to their complementary intestinal receptors in the appropriate host species is important for the activation of mucosal immunity after oral immunization, as shown with the F4 fimbriae (531, 532). Other carrier bacteria have also shown some level of usefulness inducing anti-F5 antibodies including Lactobaccilus acidophilus (533). The use of plant-based vaccines also has the subject of investigations. The gene encoding the main subunit of F4 and its adhesin (faeG) has been cloned into tobacco, barley, and alfalfa genomes and these plants have been shown to express faeG (152, 534, 535). Using an in vitro binding assay that employed pig villi, the FaeG produced in tobacco and barley was shown to inhibit binding of F4 positive E. coli to the villi. Using the alfalfa-based vaccine, these investigators also showed that the vaccine could reduce shedding of ETEC in challenged pigs. The reduction in shedding was equal to vaccination with purified F4 fimbriae.

Fimbrial specific monoclonal antibodies also have been used in protection against neonatal ETEC diarrhea. This approach has been most successfully applied for use in calves (536, 537) where monoclonal antibodies against F5 were administered to neonatal calves that also were challenged with an F5-expressing ETEC. F5-producing ETEC are the most common ETEC found in cattle. Calves receiving the F5 specific monoclonal antibody had reduced levels of diarrhea and mortality compared to non-vaccinated controls. However, passive vaccination with anti-fimbrial monoclonal antibodies is expensive and labor intensive (32).

Post weaning diarrhea vaccines

While the current generation of commercial vaccines confer excellent protection of neonatal piglets and calves against ETEC, these vaccines have not been shown to be effective against post weaning ETEC infections in pigs. PWD due to ETEC remains an important disease of young pigs and causes significant morbidity and mortality immediately after weaning. The reasons why the current vaccines are not effective for PWD are probably related to a loss of protective antibodies in piglets receiving colostrum and milk and the subsequent loss from circulation. Titers of anti-fimbrial antibodies in milk fade by the time pigs are weaned. Since it is believed that the mechanism of protection against ETEC is by blocking adhesion to enterocytes and by agglutination of the ETEC in the lumen of the intestines, the lack of antibodies in the intestinal lumen post weaning leads to a lack of protection against the intestinal colonization by the ETEC. Consistent with this is the observation that the feeding of anti-F18 antibodies to weaned pigs can be protective (80, 538). Spray dried serum-containing anti-F4 and anti-LT also has been shown to reduce post weaning diarrhea and shedding of ETEC (539). This could be a useful approach in the reduction of within herd spread of ETEC. The recent construction and use of nanobodies to inhibit the attachment of F18- and F4-fimbriated E. coli to pig enterocytes is an interesting approach that needs to be investigated in pigs (540, 541).

Various active immunization studies have focused on the relevant F18 and F4 fimbriae to protect piglets against post weaning ETEC infections. Administration of non-attenuated live ETEC strains expressing F18ab or F18ac fimbriae to pigs shortly before or after weaning had some protective effects after challenge with ETEC, but most of the vaccinated pigs suffered mild to severe diarrhea (538, 542). Slower colonization of F18- fimbriated ETEC versus F4-fimbriated ETEC paralleled a slower induction of the humoral immune response (543). The oral administration of enteric-coated F4 or microencapsulated F18 fimbriae to newborn piglets at best marginally reduced intestinal colonization upon challenge after weaning (544, 545). All things considered, an efficient vaccine protecting against post weaning ETEC infections awaits further developments, including the design and evaluation of attenuated live bacteria and/or fimbrial protein vaccines that include adjuvants (546, 547). An impediment to creating better vaccines for weaning diarrhea is that unlike neonatal diarrhea, good and reproducible pig disease models are not available. A newer approach that has been developed is based on the creation of vaccines that incorporate the expected protective epitopes of fimbriae and enterotoxins in a single protein molecule (548551). The incorporation of epitopes from F4, F18, and heat stable and heat labile enterotoxins in a single protein molecule has been shown to elicit antibodies that can neutralize attachment of ETEC to mucosal surfaces and neutralize the enterotoxins.

Oral immunization of weaned pigs with F4 and F18 was shown to be better at priming a mucosal response than intramuscular administration. Induction of a primary immune response occurred only in pigs expressing the corresponding intestinal F4 receptor, suggesting that receptor binding may facilitate antigen uptake (532). Pigs with the F4 receptor were protected against a challenge with F4-fimbriated ETEC. However, parenteral priming with F4 induced suppression of a mucosal F4 recall response upon oral infection with F4+ fimbriated bacteria (552). In contrast, orally administered F4 was able to prime an immune response in both F4-susceptible and -resistant pigs, indicating that F4 given by the mucosal route does not induce oral tolerance (553).

Since pigs are weaned when they are around 3–4 weeks of age, active protection against ETEC must be developed during the pig’s first month of life. However, one difficulty in eliciting protection during this timeframe is that most pigs also are receiving antibodies specific for the ETEC antigens in vaccines via colostrum and milk. Since protection is likely to depend upon local mucosal immunity and thus dependent upon oral immunization, any vaccine antigens orally administered to baby pigs must escape luminal antibodies (from the dam) specific to the vaccine antigens. Thus, strategies to elicit an active mucosal immune response in the presence of passive antibodies from the dam need to be developed. This could possibly include both oral and parenteral vaccinations. A recent review discusses immunization strategies and problems for ETEC-mediated PWD in pigs (554). An alternate approach that could be considered is the search for new, highly antigenic molecules that are not related to fimbriae but that are required for ETEC colonization and persistence in the small intestines of pigs. Because these antigens would not be part of the current generation of fimbrial specific vaccines for neonates, they could be administered directly to suckling pigs and would not be eliminated due to the maternal antibodies in milk and colostrum being received by piglets. The discovery of such antigens would need to be broadly expressed by ETEC causing PWD. While these antigens have not yet been identified, they could be discovered using extensive genomic data as a reverse genetics discovery tool. Phage display also has been used to screen for new potential antigens for vaccines (555).

Inhibitors of colonization

Identification and characterization of the binding moieties of ETEC fimbrial adhesins should be useful for the design of new prophylactic or therapeutic strategies. Studies describing potential receptor or adhesin analogues that interfere with fimbria-mediated colonization have been described (556560). However, more studies including efficient inhibition of the relevant panoply of ETEC fimbriae are needed for this approach to be applied in agriculture. Although fat globule membranes of sow’s and cow’s milk were reported to contain receptors for ETEC fimbriae (556, 561564), the postulated protective role of these receptors in the intestines of young animals remains unknown. Oral administrations of proteases that degrade intestinal receptors have been investigated with some success (565, 566).

The use of probiotics is also being considered for use in the prevention of ETEC induced diarrhea in livestock and humans. Certain probiotics such as lactobacilli can bind to enterocytes without interfering with the attachment of F4-fimbriated ETEC (567). It was suggested that the co-aggregation of certain Lactobacillus isolates with the F4 ETEC decreases ETEC colonization. Probiotics were the most efficient in controlling diarrhea in calves when used in conjunction with fimbria-based vaccines (568). The in vivo relevance of F4-mediated adhesion inhibitors found in certain Lactobacillus culture supernatants remains to be determined (569, 570). Commensal bacteria such as Lactobacillus that express F5 have shown some degree of protectiveness against F5+ ETEC (533). Some commensal bacteria are being considered as directly blocking ETEC colonization of the intestines and might be useful in prevention or treatment of disease. Certain strains of Lactobacillus have shown the most promise to date (567, 569, 571, 572) along with strains of Bifidobacterium, E. coli, Bacillus, Enteroccoccus, Pediococcus and Saccharomyces (573577). In recent years, the pathogenesis of ETEC has been linked to epithelial inflammatory responses in the form of cytokine expression (578). However, whether these responses are due to known or new ETEC virulence factors or to indirect effects on the microbiome and/or its metabolites remains to be determined. Probiotics, albeit frequently with dietary supplements, modulate detected host factors of inflammation (574, 579581), possibly through their metabolites (582). More in vivo studies are needed to determine whether probiotics can be sufficiently protective and cost-effective with regard to ETEC diarrhea in farm animals.

Genomics for future vaccines

Several completed genomes of animal-source ETEC are publicly available. Shepard et al. first described the genomes of F4+ and F18+ porcine ETEC, and performed phylogenetic comparisons of a large collection of porcine ETEC (291). This study demonstrated complex genomes with remarkable plasmid complements encoding a variety of previously identified virulence factors including the F4 and F18 fimbrial operons. It was also evident that porcine ETEC are comprised of strains from multiple phylogenetic lineages that have acquired these plasmids, including strains within the E. coli phylogenetic groups A, B1, and D. However, it was also apparent from this study that the number of lineages containing porcine ETEC is somewhat limited compared to human ETEC, suggesting that a specific chromosomal background is required to harbor porcine ETEC plasmids enabling virulence in the host.

Specific lineages may also have enhanced virulence potential. For example, the genome of an O157 porcine ETEC strain involved in an outbreak in pigs was analyzed, and it was LT+, STa+, and STb+, yet lacked common porcine ETEC fimbriae such as F4, F5, or F18 (510). The phylogenetic background of this strain was distinct from classical O157:H7 human clinical isolates, and was actually most similar to O78 strains of avian pathogenic E. coli (583). This again supports the concept that combinations of ETEC virulence factors in the appropriate phylogenetic background are required for enhanced virulence. Despite the apparent diversity of porcine ETEC, scanning of porcine ETEC genomes for antigenic candidates has revealed several candidates that are differentially present in porcine ETEC compared to porcine commensal E. coli found across porcine ETEC lineages and predicted to be surface exposed and accessible to the host (509). Therefore, reverse vaccinology exploiting available animal-source ETEC genomes could be an effective approach towards the development of subunit vaccines.

Acknowledgments

The laboratories of the authors were supported by a Discovery Grant from the National Sciences and Engineering Research Council of Canada (139070) and Fonds de Recherche Nature et Technologies (Québec) to JDD, and grants from the USDA (2013–67015–21285) and NIH (AI098041) to DMS. The authors thank Mrs Jacinthe Lachance and Ms Deborah Argento for the artwork.

Contributor Information

J. Daniel Dubreuil, Faculté de médecine vétérinaire, Université de Montréal, Québec, Canada.

Richard E. Isaacson, Department of Veterinary and Biomedical Sciences, University of Minnesota, St Paul, MN

Dieter M. Schifferli, School of Veterinary Medicine, University of Pennsylvania, Philadelphia, PA

References

  • 1.Nagy B, Fekete PZ. Enterotoxigenic Escherichia coli in veterinary medicine. Int J Med Microbiol. 2005;295:443–454. doi: 10.1016/j.ijmm.2005.07.003. [DOI] [PubMed] [Google Scholar]
  • 2.Kopic S, Geibel JP. Toxin mediated diarrhea in the 21 century: the pathophysiology of intestinal ion transport in the course of ETEC, V. cholerae and rotavirus infection. Toxins (Basel) 2010;2:2132–2157. doi: 10.3390/toxins2082132. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Dubreuil JD. The whole Shebang: the gastrointestinal tract, Escherichia coli enterotoxins and secretion. Curr Issues Mol Biol. 2012;14:71–82. [PubMed] [Google Scholar]
  • 4.van Beers-Schreurs HM, Vellenga L, Wensing T, Breukink HJ. The pathogenesis of the post-weaning syndrome in weaned piglets: a review. Vet Q. 1992;14:29–34. doi: 10.1080/01652176.1992.9694322. [DOI] [PubMed] [Google Scholar]
  • 5.Fairbrother JM, Nadeau E, Gyles CL. Escherichia coli in postweaning diarrhea in pigs: an update on bacterial types, pathogenesis, and prevention strategies. Anim Health Res Rev. 2005;6:17–39. doi: 10.1079/ahr2005105. [DOI] [PubMed] [Google Scholar]
  • 6.Tacket CO, Reid RH, Boedeker EC, Losonsky G, Nataro JP, Bhagat H, Edelman R. Enteral immunization and challenge of volunteers given enterotoxigenic E. coli CFA/II encapsulated in biodegradable microspheres. Vaccine. 1994;12:1270–1274. doi: 10.1016/s0264-410x(94)80038-2. [DOI] [PubMed] [Google Scholar]
  • 7.Berberov EM, Zhou Y, Francis DH, Scott MA, Kachman SD, Moxley RA. Relative importance of heat-labile enterotoxin in the causation of severe diarrheal disease in the gnotobiotic piglet model by a strain of enterotoxigenic Escherichia coli that produces multiple enterotoxins. Infect Immun. 2004;72:3914–3924. doi: 10.1128/IAI.72.7.3914-3924.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Liu W, Yuan C, Meng X, Du Y, Gao R, Tang J, Shi D. Frequency of virulence factors in Escherichia coli isolated from suckling pigs with diarrhoea in China. Vet J. 2014;199:286–289. doi: 10.1016/j.tvjl.2013.11.019. [DOI] [PubMed] [Google Scholar]
  • 9.Duan Q, Yao F, Zhu G. Major virulence factors of enterotoxigenic Escherichia coli in pigs. Ann Microbiol. 2012;62:7–14. [Google Scholar]
  • 10.Foster DM, Smith GW. Pathophysiology of diarrhea in calves. Vet Clin North Am Food Anim Pract. 2009;25:13–36, xi. doi: 10.1016/j.cvfa.2008.10.013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Fleckenstein JM, Hardwidge PR, Munson GP, Rasko DA, Sommerfelt H, Steinsland H. Molecular mechanisms of enterotoxigenic Escherichia coli infection. Microbes Infect. 2010;12:89–98. doi: 10.1016/j.micinf.2009.10.002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Nagy B, Casey TA, Moon HW. Phenotype and genotype of Escherichia coli isolated from pigs with postweaning diarrhea in Hungary. J Clin Microbiol. 1990;28:651–653. doi: 10.1128/jcm.28.4.651-653.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Wittig W, Fabricius C. Escherichia coli types isolated from porcine E. coli infections in Saxony from 1963 to 1990. Zentralbl Bakteriol. 1992;277:389–402. doi: 10.1016/s0934-8840(11)80918-7. [DOI] [PubMed] [Google Scholar]
  • 14.Post KW, Bosworth BT, Knoth JL. Frequency of virulence factors in Escherichia coli isolated from pigs with postweaning diarrhea and edema disease in North Carolina. Swine Health Prod. 2000;8:119–120. [Google Scholar]
  • 15.Aarestrup FM, Jorsal SE, Ahrens P, Jensen NE, Meyling A. Molecular characterization of Escherichia coli strains isolated from pigs with edema disease. J Clin Microbiol. 1997;35:20–24. doi: 10.1128/jcm.35.1.20-24.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.da Silva AS, Valadares GF, Penatti MP, Brito BG, da Silva Leite D. Escherichia coli strains from edema disease: O serogroups, and genes for Shiga toxin, enterotoxins, and F18 fimbriae. Vet Microbiol. 2001;80:227–233. doi: 10.1016/s0378-1135(01)00316-9. [DOI] [PubMed] [Google Scholar]
  • 17.Osek J. Prevalence of virulence factors of Escherichia coli strains isolated from diarrheic and healthy piglets after weaning. Vet Microbiol. 1999;68:209–217. doi: 10.1016/s0378-1135(99)00109-1. [DOI] [PubMed] [Google Scholar]
  • 18.Moon HW, Hoffman LJ, Cornick NA, Booher SL, Bosworth BT. Prevalences of some virulence genes among Escherichia coli isolates from swine presented to a diagnostic laboratory in Iowa. J Vet Diagn Invest. 1999;11:557–560. doi: 10.1177/104063879901100617. [DOI] [PubMed] [Google Scholar]
  • 19.Dean-Nystrom EA, Burkhardt D, Bosworth BT, Welter MW. Presence of F18ac (2134P) fimbriae on 4P- Escherichia coli isolates from weaned pigs with diarrhea. J Vet Diagn Invest. 1997;9:77–79. doi: 10.1177/104063879700900114. [DOI] [PubMed] [Google Scholar]
  • 20.Gyles CL, Fairbrother JM. Escherichia coli. In: Gyles CL, Prescott JF, Songer JG, Thoen CO, editors. Pathogenesis of Bacterial Infections in Animals. Wiley-Blackwell; New York, NY: 2010. pp. 267–308. [Google Scholar]
  • 21.Mainil JG, Jacquemin E, Pohl P, Kaeckenbeeck A, Benz I. DNA sequences coding for the F18 fimbriae and AIDA adhesin are localised on the same plasmid in Escherichia coli isolates from piglets. Vet Microbiol. 2002;86:303–311. doi: 10.1016/s0378-1135(02)00019-6. [DOI] [PubMed] [Google Scholar]
  • 22.Ngeleka M, Pritchard J, Appleyard G, Middleton DM, Fairbrother JM. Isolation and association of Escherichia coli AIDA-I/STb, rather than EAST1 pathotype, with diarrhea in piglets and antibiotic sensitivity of isolates. J Vet Diagn Invest. 2003;15:242–252. doi: 10.1177/104063870301500305. [DOI] [PubMed] [Google Scholar]
  • 23.Drolet R, Fairbrother JM, Vaillancourt D. Attaching and effacing Escherichia coli in a goat with diarrhea. Can Vet J. 1994;35:122–123. [PMC free article] [PubMed] [Google Scholar]
  • 24.Hammermueller J, Kruth S, Prescott J, Gyles C. Detection of toxin genes in Escherichia coli isolated from normal dogs and dogs with diarrhea. Can J Vet Res. 1995;59:265–270. [PMC free article] [PubMed] [Google Scholar]
  • 25.USDA.APHIS:VS. Swine 2000. Part I: Reference of swine health and management in the United States, 2000, NAHMS. 555 South Howes Fort Collins, Colorado. 2001;80521(970):490–8000. E-mail: NAHMSweb@aphis.usda.gov. [Google Scholar]
  • 26.USDA.APHIS:VS. Swine ‘95 Study, Part III: 1990–1995 Changes in the U.S. Pork Industry. 555 South Howes Fort Collins, Colorado. 1997;80521(970):490–8000. Internet: NAHMS_INFO@aphis.usda.gov. [Google Scholar]
  • 27.USDA.APHIS:VS. National Swine Survey. Morbidity/Mortality and Health Management of Swine in the United States. 555 South Howes Fort Collins, Colorado. 1992;80521(970):490–8000. Internet: NAHMS_INFO@aphis.usda.gov. [Google Scholar]
  • 28.Zhang W, Zhao M, Ruesch L, Omot A, Francis D. Prevalence of virulence genes in Escherichia coli strains recently isolated from young pigs with diarrhea in the US. Vet Microbiol. 2007;123:145–152. doi: 10.1016/j.vetmic.2007.02.018. [DOI] [PubMed] [Google Scholar]
  • 29.Smith MG, Jordan D, Chapman TA, Chin JJ, Barton MD, Do TN, Fahy VA, Fairbrother JM, Trott DJ. Antimicrobial resistance and virulence gene profiles in multi-drug resistant enterotoxigenic Escherichia coli isolated from pigs with post-weaning diarrhoea. Vet Microbiol. 2010;145:299–307. doi: 10.1016/j.vetmic.2010.04.004. [DOI] [PubMed] [Google Scholar]
  • 30.Madoroba E, Van Driessche E, De Greve H, Mast J, Ncube I, Read J, Beeckmans S. Prevalence of enterotoxigenic Escherichia coli virulence genes from scouring piglets in Zimbabwe. Trop Anim Health Prod. 2009;41:1539–1547. doi: 10.1007/s11250-009-9345-4. [DOI] [PubMed] [Google Scholar]
  • 31.Moredo FA, Piñeyro PE, Márquez GC, Sanz M, Colello R, Etcheverría A, Padola NL, Quiroga MA, Perfumo CJ, Galli L, Leotta GA. Enterotoxigenic Escherichia coli Subclinical Infection in Pigs: Bacteriological and Genotypic Characterization and Antimicrobial Resistance Profiles. Foodborne Pathog Dis. 2015;12:704–711. doi: 10.1089/fpd.2015.1959. [DOI] [PubMed] [Google Scholar]
  • 32.Moon HW, Bunn TO. Vaccines for preventing enterotoxigenic Escherichia coli infections in farm animals. Vaccine. 1993;11:213–200. doi: 10.1016/0264-410X(93)90020-X. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Fairbrother JM. Neonatal Escherichia coli diarrhea. In: Straw BE, D’Allaire S, Mengeling WL, Taylor DJ, editors. Diseases of swine. 8th. Iowa State University Press; Ames, Iowa: 1999. pp. 433–441. [Google Scholar]
  • 34.Vu Khac H, Holoda E, Pilipcinec E, Blanco M, Blanco JE, Mora A, Dahbi G, López C, González EA, Blanco J. Serotypes, virulence genes, and PFGE profiles of Escherichia coli isolated from pigs with postweaning diarrhoea in Slovakia. BMC Vet Res. 2006;2:10. doi: 10.1186/1746-6148-2-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Chan G, Farzan A, DeLay J, McEwen B, Prescott JF, Friendship RM. A retrospective study on the etiological diagnoses of diarrhea in neonatal piglets in Ontario, Canada, between 2001 and 2010. Can J Vet Res. 2013;77:254–260. [PMC free article] [PubMed] [Google Scholar]
  • 36.Okello E, Moonens K, Erume J, De Greve H. Enterotoxigenic Escherichia coli strains are highly prevalent in Ugandan piggeries but disease outbreaks are masked by antibiotic prophylaxis. Trop Anim Health Prod. 2015;47:117–122. doi: 10.1007/s11250-014-0694-2. [DOI] [PubMed] [Google Scholar]
  • 37.Goswami PS, Friendship RM, Gyles CL, Poppe C, Boerlin P. Preliminary investigations of the distribution of Escherichia coli O149 in sows, piglets, and their environment. Can J Vet Res. 2011;75:57–60. [PMC free article] [PubMed] [Google Scholar]
  • 38.Sarrazin E, Fritzsche C, Bertschinger HU. Hauptvirulenzfaktoren bei Escherichia coli-Isolaten von über zwei Wochen alten Schweinen mit Odemkrankheit und/oder Colidiarrhöe. Schweiz Arch Tierheilkd. 2000;142:625–630. [PubMed] [Google Scholar]
  • 39.Westerman RB, Mills KW, Phillips RM, Fortner GW, Greenwood JM. Predominance of the ac variant in K88-positive Escherichia coli isolates from swine. J Clin Microbiol. 1988;26:149–150. doi: 10.1128/jcm.26.1.149-150.1988. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.González EA, Vázquez F, Ignacio Garabal J, Blanco J. Isolation of K88 antigen variants (ab, ac, ad) from porcine enterotoxigenic Escherichia coli belonging to different serotypes. Microbiol Immunol. 1995;39:937–942. doi: 10.1111/j.1348-0421.1995.tb03296.x. [DOI] [PubMed] [Google Scholar]
  • 41.Frydendahl K. Prevalence of serogroups and virulence genes in Escherichia coli associated with postweaning diarrhoea and edema disease in pigs and a comparison of diagnostic approaches. Vet Microbiol. 2002;85:169–182. doi: 10.1016/s0378-1135(01)00504-1. [DOI] [PubMed] [Google Scholar]
  • 42.Abraham S, Chin J, Brouwers HJ, Zhang R, Chapman TA. Molecular serogrouping of porcine enterotoxigenic Escherichia coli from Australia. J Microbiol Methods. 2012;88:73–76. doi: 10.1016/j.mimet.2011.10.016. [DOI] [PubMed] [Google Scholar]
  • 43.Osek J. Clonal analysis of Escherichia coli strains isolated from pigs with post-weaning diarrhea by pulsed-field gel electrophoresis. FEMS Microbiol Lett. 2000;186:327–331. doi: 10.1111/j.1574-6968.2000.tb09125.x. [DOI] [PubMed] [Google Scholar]
  • 44.Orskov I, Orskov F, Sojka WJ, Leach JM. Simultaneous occurrence of E. coli B and Lantigens in strains from diseased swine. Influence of cultivation temperature. Two new E. coli Kantigens: K 87 and K 88. Acta Pathol Microbiol Scand. 1961;53:404–422. [PubMed] [Google Scholar]
  • 45.Stirm S, Orskov I, Orskov F. K88, an episome-determined protein antigen of Escherichia coli. Nature. 1966;209:507–508. doi: 10.1038/209507a0. [DOI] [PubMed] [Google Scholar]
  • 46.Stirm S, Orskov F, Orskov I, Birch-Andersen A. Episome-carried surface antigen K88 of Escherichia coli. 3. Morphology. J Bacteriol. 1967;93:740–748. doi: 10.1128/jb.93.2.740-748.1967. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Duguid JP, Anderson ES. Terminology of bacterial fimbriae, or pili, and their types. Nature. 1967;215:89–90. doi: 10.1038/215089a0. [DOI] [PubMed] [Google Scholar]
  • 48.Kraus R, Ludwig S. Ueber Bakteriohaemagglutinine und Antihaemagglutinine. Wien Klin Wochenschr. 1902;5:120–121. [Google Scholar]
  • 49.Guyot G. Ueber die bakterielle Haemagglutination (Bakterio-Haemoagglutination) Centralbl f Bakt Abt I Orig. 1908;XLVII:640–653. [Google Scholar]
  • 50.Duguid JP, Smith IW, Dempster G, Edmunds PN. Non-flagellar filamentous appendages (fimbriae) and haemagglutinating activity in Bacterium coli. J Pathol Bacteriol. 1955;70:335–348. doi: 10.1002/path.1700700210. [DOI] [PubMed] [Google Scholar]
  • 51.Smith T, Orcutt ML. The bacteriology of the intestinal tract of of young calves with special reference to the early diarrhea (“scours”) J Exp Med. 1925;41:89–106. doi: 10.1084/jem.41.1.89. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Smith HW, Halls S. The production of oedema disease and diarrhoea in weaned pigs by the oral administration of Escherichia coli: factors that influence the course of the experimental disease. J Med Microbiol. 1968;1:45–59. doi: 10.1099/00222615-1-1-45. [DOI] [PubMed] [Google Scholar]
  • 53.Smith HW, Linggood MA. Observations on the pathogenic properties of the K88, Hly and Ent plasmids of Escherichia coli with particular reference to porcine diarrhoea. J Med Microbiol. 1971;4:467–485. doi: 10.1099/00222615-4-4-467. [DOI] [PubMed] [Google Scholar]
  • 54.Falkow S. Molecular Koch’s postulates applied to microbial pathogenicity. Rev Infect Dis. 1988;10(Suppl 2):S274–S276. doi: 10.1093/cid/10.supplement_2.s274. [DOI] [PubMed] [Google Scholar]
  • 55.Jones GW, Rutter JM. Role of the K88 antigen in the pathogenesis of neonatal diarrhea caused by Escherichia coli in piglets. Infect Immun. 1972;6:918–927. doi: 10.1128/iai.6.6.918-927.1972. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56.Rutter JM, Jones GW. The K88 antigen of Escherichia coli–a model for vaccination with a virulence factor? J Med Microbiol. 1973;6:8–9. [PubMed] [Google Scholar]
  • 57.Mooi FR, de Graaf FK, van Embden JD. Cloning, mapping and expression of the genetic determinant that encodes for the K88ab antigen. Nucleic Acids Res. 1979;6:849–865. doi: 10.1093/nar/6.3.849. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Kehoe M, Sellwood R, Shipley P, Dougan G. Genetic analysis of K88-mediated adhesion of enterotoxigenic Escherichia coli. Nature. 1981;291:122–126. doi: 10.1038/291122a0. [DOI] [PubMed] [Google Scholar]
  • 59.Mooi FR, Harms N, Bakker D, de Graaf FK. Organization and expression of genes involved in the production of the K88ab antigen. Infect Immun. 1981;32:1155–1163. doi: 10.1128/iai.32.3.1155-1163.1981. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 60.Hull RA, Gill RE, Hsu P, Minshew BH, Falkow S. Construction and expression of recombinant plasmids encoding type 1 or D-mannose-resistant pili from a urinary tract infection Escherichia coli isolate. Infect Immun. 1981;33:933–938. doi: 10.1128/iai.33.3.933-938.1981. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61.Normark S, Lark D, Hull R, Norgren M, Båga M, O’Hanley P, Schoolnik G, Falkow S. Genetics of digalactoside-binding adhesin from a uropathogenic Escherichia coli strain. Infect Immun. 1983;41:942–949. doi: 10.1128/iai.41.3.942-949.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Orndorff PE, Falkow S. Organization and expression of genes responsible for type 1 piliation in Escherichia coli. J Bacteriol. 1984;159:736–744. doi: 10.1128/jb.159.2.736-744.1984. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 63.Moon HW, Isaacson RE, Pohlenz J. Mechanisms of association of enteropathogenic Escherichia coli with intestinal epithelium. Am J Clin Nutr. 1979;32:119–127. doi: 10.1093/ajcn/32.1.119. [DOI] [PubMed] [Google Scholar]
  • 64.Isaacson RE, Nagy B, Moon HW. Colonization of porcine small intestine by Escherichia coli: colonization and adhesion factors of pig enteropathogens that lack K88. J Infect Dis. 1977;135:531–539. doi: 10.1093/infdis/135.4.531. [DOI] [PubMed] [Google Scholar]
  • 65.Nagy B, Moon HW, Isaacson RE. Colonization of porcine intestine by enterotoxigenic Escherichia coli: selection of piliated forms in vivo, adhesion of piliated forms to epithelial cells in vitro, and incidence of a pilus antigen among porcine enteropathogenic E. coli. Infect Immun. 1977;16:344–352. doi: 10.1128/iai.16.1.344-352.1977. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66.Isaacson RE, Fusco PC, Brinton CC, Moon HW. In vitro adhesion of Escherichia coli to porcine small intestinal epithelial cells: pili as adhesive factors. Infect Immun. 1978;21:392–397. doi: 10.1128/iai.21.2.392-397.1978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67.Isaacson RE, Dean EA, Morgan RL, Moon HW. Immunization of suckling pigs against enterotoxigenic Escherichia coli-induced diarrheal disease by vaccinating dams with purified K99 or 987P pili: antibody production in response to vaccination. Infect Immun. 1980;29:824–826. doi: 10.1128/iai.29.2.824-826.1980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.Morgan RL, Isaacson RE, Moon HW, Brinton CC, To CC. Immunization of suckling pigs against enterotoxigenic Escherichia coli-induced diarrheal disease by vaccinating dams with purified 987 or K99 pili: protection correlates with pilus homology of vaccine and challenge. Infect Immun. 1978;22:771–777. doi: 10.1128/iai.22.3.771-777.1978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69.Nagy B, Moon HW, Isaacson RE, To C-C, Brinton CC. Immunization of suckling pigs against enteric enterotoxigenic Escherichia coli infection by vaccinating dams with purified pili. Infect Immun. 1978;21:269–274. doi: 10.1128/iai.21.1.269-274.1978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Casey TA, Schneider RA, Dean-Nystrom EA. Identification of plasmid and chromosomal copies of 987P pilus genes in enterotoxigenic Escherichia coli 987. Infect Immun. 1993;61:2249–2252. doi: 10.1128/iai.61.5.2249-2252.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 71.Morris JA, Wells GAH, Scott AC, Sojka WJ. Colonisation of the small intestine of lambs by an enterotoxigenic Escherichia coli producing F41 fimbriae. Vet Rec. 1983;113:471–471. doi: 10.1136/vr.113.20.471. [DOI] [PubMed] [Google Scholar]
  • 72.Morris JA, Thorns CJ, Wells GA, Scott AC, Sojka WJ. The production of F41 fimbriae by piglet strains of enterotoxigenic Escherichia coli that lack K88, K99 and 987P fimbriae. J Gen Microbiol. 1983;129:2753–2759. doi: 10.1099/00221287-129-9-2753. [DOI] [PubMed] [Google Scholar]
  • 73.Runnels PL, Moseley SL, Moon HW. F41 pili as protective antigens of enterotoxigenic Escherichia coli that produce F41, K99, or both pilus antigens. Infect Immun. 1987;55:555–558. doi: 10.1128/iai.55.3.555-558.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 74.To SC. Prevention of colibacillosis in neonatal swine with a 4-pilus E coli bacterin. Mod Vet Pract. 1984;65:39–41. [PubMed] [Google Scholar]
  • 75.To SC. F41 antigen among porcine enterotoxigenic Escherichia coli strains lacking K88, K99, and 987P pili. Infect Immun. 1984;43:549–554. doi: 10.1128/iai.43.2.549-554.1984. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76.Nagy B. Vaccination of cows with a K99 extract to protect newborn calves against experimental enterotoxic colibacillosis. Infect Immun. 1980;27:21–24. doi: 10.1128/iai.27.1.21-24.1980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 77.Moon HW, Kohler EM, Schneider RA, Whipp SC. Prevalence of pilus antigens, enterotoxin types, and enteropathogenicity among K88-negative enterotoxigenic Escherichia coli from neonatal pigs. Infect Immun. 1980;27:222–230. doi: 10.1128/iai.27.1.222-230.1980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 78.Moon HW. Colonization factor antigens of enterotoxigenic Escherichia coli in animals. Curr Top Microbiol Immunol. 1990;151:147–165. doi: 10.1007/978-3-642-74703-8_8. [DOI] [PubMed] [Google Scholar]
  • 79.Imberechts H, Bertschinger HU, Nagy B, Deprez P, Pohl P. Fimbrial colonisation factors F18ab and F18ac of Escherichia coli isolated from pigs with postweaning diarrhea and edema disease. Adv Exp Med Biol. 1997;412:175–183. doi: 10.1007/978-1-4899-1828-4_26. [DOI] [PubMed] [Google Scholar]
  • 80.Zúñiga A, Yokoyama H, Albicker-Rippinger P, Eggenberger E, Bertschinger HU. Reduced intestinal colonisation with F18-positive enterotoxigenic Escherichia coli in weaned pigs fed chicken egg antibody against the fimbriae. FEMS Immunol Med Microbiol. 1997;18:153–161. doi: 10.1111/j.1574-695X.1997.tb01041.x. [DOI] [PubMed] [Google Scholar]
  • 81.Contrepois MG, Girardeau JP. Additive protective effects of colostral antipili antibodies in calves experimentally infected with enterotoxigenic Escherichia coli. Infect Immun. 1985;50:947–949. doi: 10.1128/iai.50.3.947-949.1985. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 82.Bertin Y, Martin C, Oswald E, Girardeau JP. Rapid and specific detection of F17-related pilin and adhesin genes in diarrheic and septicemic Escherichia coli strains by multiplex PCR. J Clin Microbiol. 1996;34:2921–2928. doi: 10.1128/jcm.34.12.2921-2928.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 83.Le Bouguénec C, Bertin Y. AFA and F17 adhesins produced by pathogenic Escherichia coli strains in domestic animals. Vet Res. 1999;30:317–342. [PubMed] [Google Scholar]
  • 84.Dezfulian H, Batisson I, Fairbrother JM, Lau PC, Nassar A, Szatmari G, Harel J. Presence and characterization of extraintestinal pathogenic Escherichia coli virulence genes in F165-positive E. coli strains isolated from diseased calves and pigs. J Clin Microbiol. 2003;41:1375–1385. doi: 10.1128/JCM.41.4.1375-1385.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 85.Bihannic M, Ghanbarpour R, Auvray F, Cavalié L, Châtre P, Boury M, Brugère H, Madec JY, Oswald E. Identification and detection of three new F17 fimbrial variants in Escherichia coli strains isolated from cattle. Vet Res (Faisalabad) 2014;45:76. doi: 10.1186/s13567-014-0076-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 86.Harel J, Lapointe H, Fallara A, Lortie LA, Bigras-Poulin M, Larivière S, Fairbrother JM. Detection of genes for fimbrial antigens and enterotoxins associated with Escherichia coli serogroups isolated from pigs with diarrhea. J Clin Microbiol. 1991;29:745–752. doi: 10.1128/jcm.29.4.745-752.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 87.Broes A, Fairbrother JM, Jacques M, Lariviere S. Isolation and Characterization of a New Fimbrial Antigen (Cs1541) from a Porcine Entero-Toxigenic Escherichia-Coli O8 - Kx105 Strain. FEMS Microbiol Lett. 1988;55:341–347. [Google Scholar]
  • 88.Broes A, Fairbrother JM, Jacques M, Larivière S. Requirement for capsular antigen KX105 and fimbrial antigen CS1541 in the pathogenicity of porcine enterotoxigenic Escherichia coli O8:KX105 strains. Can J Vet Res. 1989;53:43–47. [PMC free article] [PubMed] [Google Scholar]
  • 89.Fairbrother JM, Broes A, Jacques M, Larivière S. Pathogenicity of Escherichia coli O115:K“V165” strains isolated from pigs with diarrhea. Am J Vet Res. 1989;50:1029–1036. [PubMed] [Google Scholar]
  • 90.Woodward MJ, Wray C. Nine DNA probes for detection of toxin and adhesin genes in Escherichia coli isolated from diarrhoeal disease in animals. Vet Microbiol. 1990;25:55–65. doi: 10.1016/0378-1135(90)90093-b. [DOI] [PubMed] [Google Scholar]
  • 91.Contrepois M, Fairbrother JM, Kaura YK, Girardeau JP. Prevalence of CS31A and F165 surface antigens in Escherichia coli isolates from animals in France, Canada and India. FEMS Microbiol Lett. 1989;50:319–323. doi: 10.1016/0378-1097(89)90439-4. [DOI] [PubMed] [Google Scholar]
  • 92.Bertin Y, Martin C, Girardeau JP, Pohl P, Contrepois M. Association of genes encoding P fimbriae, CS31A antigen and EAST 1 toxin among CNF1-producing Escherichia coli strains from cattle with septicemia and diarrhea. FEMS Microbiol Lett. 1998;162:235–239. doi: 10.1111/j.1574-6968.1998.tb13004.x. [DOI] [PubMed] [Google Scholar]
  • 93.Valat C, Forest K, Auvray F, Métayer V, Méheut T, Polizzi C, Gay E, Haenni M, Oswald E, Madec JY. Assessment of Adhesins as an Indicator of Pathovar-Associated Virulence Factors in Bovine Escherichia coli. Appl Environ Microbiol. 2014;80:7230–7234. doi: 10.1128/AEM.02365-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 94.Girardeau JP, Der Vartanian M, Ollier JL, Contrepois M. CS31A, a new K88-related fimbrial antigen on bovine enterotoxigenic and septicemic Escherichia coli strains. Infect Immun. 1988;56:2180–2188. doi: 10.1128/iai.56.8.2180-2188.1988. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 95.Mercado EC, Rodríguez SM, D’Antuono AL, Cipolla AL, Elizondo AM, Rossetti CA, Malena R, Méndez MA. Occurrence and characteristics of CS31A antigen-producing Escherichia coli in calves with diarrhoea and septicaemia in Argentina. J Vet Med B Infect Dis Vet Public Health. 2003;50:8–13. doi: 10.1046/j.1439-0450.2003.00610.x. [DOI] [PubMed] [Google Scholar]
  • 96.Mainil JG, Jacquemin E, Pohl P, Fairbrother JM, Ansuini A, Le Bouguénec C, Ball HJ, De Rycke J, Oswald E. Comparison of necrotoxigenic Escherichia coli isolates from farm animals and from humans. Vet Microbiol. 1999;70:123–135. doi: 10.1016/s0378-1135(99)00134-0. [DOI] [PubMed] [Google Scholar]
  • 97.Nuccio SP, Bäumler AJ. Evolution of the chaperone/usher assembly pathway: fimbrial classification goes Greek. Microbiol Mol Biol Rev. 2007;71:551–575. doi: 10.1128/MMBR.00014-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 98.Franklin A, Söderlind O, Möllby R. Plasmids coding for enterotoxins, K88 antigen and colicins in porcine Escherichia coli strains of O-group 149. Med Microbiol Immunol (Berl) 1981;170:63–72. doi: 10.1007/BF02122670. [DOI] [PubMed] [Google Scholar]
  • 99.Isaacson RE, Start GL. Analysis of K99 plasmids from enterotoxigenic Escherichia coli. FEMS Microbiol Lett. 1992;69:141–146. doi: 10.1016/0378-1097(92)90618-x. [DOI] [PubMed] [Google Scholar]
  • 100.Bertin A. Plasmid content and localisation of the STaI (STaP) gene in enterotoxigenic Escherichia coli with a non-radioactive polynucleotide gene probe. J Med Microbiol. 1992;37:141–147. doi: 10.1099/00222615-37-2-141. [DOI] [PubMed] [Google Scholar]
  • 101.Mainil JG, Bex F, Dreze P, Kaeckenbeeck A, Couturier M. Replicon typing of virulence plasmids of enterotoxigenic Escherichia coli isolates from cattle. Infect Immun. 1992;60:3376–3380. doi: 10.1128/iai.60.8.3376-3380.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 102.Mainil JG, Daube G, Jacquemin E, Pohl P, Kaeckenbeeck A. Virulence plasmids of enterotoxigenic Escherichia coli isolates from piglets. Vet Microbiol. 1998;62:291–301. doi: 10.1016/s0378-1135(98)00225-9. [DOI] [PubMed] [Google Scholar]
  • 103.Fekete PZ, Gerardin J, Jacquemin E, Mainil JG, Nagy B. Replicon typing of F18 fimbriae encoding plasmids of enterotoxigenic and verotoxigenic Escherichia coli strains from porcine postweaning diarrhoea and oedema disease. Vet Microbiol. 2002;85:275–284. doi: 10.1016/s0378-1135(01)00515-6. [DOI] [PubMed] [Google Scholar]
  • 104.Schifferli DM, Beachey EH, Taylor RK. The 987P fimbrial gene cluster of enterotoxigenic Escherichia coli is plasmid encoded. Infect Immun. 1990;58:149–156. doi: 10.1128/iai.58.1.149-156.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 105.Klaasen P, Woodward MJ, van Zijderveld FG, de Graaf FK. The 987P gene cluster in enterotoxigenic Escherichia coli contains an STpa transposon that activates 987P expression. Infect Immun. 1990;58:801–807. doi: 10.1128/iai.58.3.801-807.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 106.Schifferli DM, Beachey EH, Taylor RK. 987P fimbrial gene identification and protein characterization by T7 RNA polymerase-induced transcription and TnphoA mutagenesis. Mol Microbiol. 1991;5:61–70. doi: 10.1111/j.1365-2958.1991.tb01826.x. [DOI] [PubMed] [Google Scholar]
  • 107.Boerlin P, Travis R, Gyles CL, Reid-Smith R, Janecko N, Lim H, Nicholson V, McEwen SA, Friendship R, Archambault M. Antimicrob ial resistance and virulence genes of Escherichia coli isolates from swine in Ontario. Appl Environ Microbiol. 2005;71:6753–6761. doi: 10.1128/AEM.71.11.6753-6761.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 108.Fekete PZ, Brzuszkiewicz E, Blum-Oehler G, Olasz F, Szabó M, Gottschalk G, Hacker J, Nagy B. DNA sequence analysis of the composite plasmid pTC conferring virulence and antimicrobial resistance for porcine enterotoxigenic Escherichia coli. Int J Med Microbiol. 2012;302:4–9. doi: 10.1016/j.ijmm.2011.07.003. [DOI] [PubMed] [Google Scholar]
  • 109.Johnson TJ, Shepard SM, Rivet B, Danzeisen JL, Carattoli A. Comparative genomics and phylogeny of the IncI1 plasmids: a common plasmid type among porcine enterotoxigenic Escherichia coli. Plasmid. 2011;66:144–151. doi: 10.1016/j.plasmid.2011.07.003. [DOI] [PubMed] [Google Scholar]
  • 110.Zav’yalov V, Zavialov A, Zav’yalova G, Korpela T. Adhesive organelles of Gram-negative pathogens assembled with the classical chaperone/usher machinery: structure and function from a clinical standpoint. FEMS Microbiol Rev. 2010;34:317–378. doi: 10.1111/j.1574-6976.2009.00201.x. [DOI] [PubMed] [Google Scholar]
  • 111.Werneburg GT, Henderson NS, Portnoy EB, Sarowar S, Hultgren SJ, Li H, Thanassi DG. The pilus usher controls protein interactions via domain masking and is functional as an oligomer. Nat Struct Mol Biol. 2015;22:540–546. doi: 10.1038/nsmb.3044. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 112.Duchet-Suchaux M, Bertin A, Dubray G. Morphological description of surface structures on strain B41 of bovine enterotoxigenic Escherichia coli bearing both K99 and F41 antigens. J Gen Microbiol. 1988;134:983–995. doi: 10.1099/00221287-134-4-983. [DOI] [PubMed] [Google Scholar]
  • 113.Simons BL, Mol O, van Breemen JF, Oudega B. Morphological appearances of K88ab fimbriae and optical diffraction analysis of K88 paracrystalline structures. FEMS Microbiol Lett. 1994;118:83–88. doi: 10.1111/j.1574-6968.1994.tb06807.x. [DOI] [PubMed] [Google Scholar]
  • 114.Bertin Y, Girardeau JP, Darfeuille-Michaud A, Contrepois M. Characterization of 20K fimbria, a new adhesin of septicemic and diarrhea-associated Escherichia coli strains, that belongs to a family of adhesins with N-acetyl-D-glucosamine recognition. Infect Immun. 1996;64:332–342. doi: 10.1128/iai.64.1.332-342.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 115.Hahn E, Wild P, Schraner EM, Bertschinger HU, Häner M, Müller SA, Aebi U. Structural analysis of F18 fimbriae expressed by porcine toxigenic Escherichia coli. J Struct Biol. 2000;132:241–250. doi: 10.1006/jsbi.2000.4323. [DOI] [PubMed] [Google Scholar]
  • 116.Brinton CC., Jr The structure, function, synthesis and genetic control of bacterial pili and a molecular model for DNA and RNA transport in gram negative bacteria. Trans N Y Acad Sci. 1965;27(8 Series II):1003–1054. doi: 10.1111/j.2164-0947.1965.tb02342.x. [DOI] [PubMed] [Google Scholar]
  • 117.Abraham SN, Land M, Ponniah S, Endres R, Hasty DL, Babu JP. Glycerol-induced unraveling of the tight helical conformation of Escherichia coli type 1 fimbriae. J Bacteriol. 1992;174:5145–5148. doi: 10.1128/jb.174.15.5145-5148.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 118.Mortezaei N, Epler CR, Shao PP, Shirdel M, Singh B, McVeigh A, Uhlin BE, Savarino SJ, Andersson M, Bullitt E. Structure and function of enterotoxigenic Escherichia coli fimbriae from differing assembly pathways. Mol Microbiol. 2015;95:116–126. doi: 10.1111/mmi.12847. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 119.Smyth CJ, Marron MB, Twohig JM, Smith SG. Fimbrial adhesins: similarities and variations in structure and biogenesis. FEMS Immunol Med Microbiol. 1996;16:127–139. doi: 10.1111/j.1574-695X.1996.tb00129.x. [DOI] [PubMed] [Google Scholar]
  • 120.Brooks DE, Cavanagh J, Jayroe D, Janzen J, Snoek R, Trust TJ. Involvement of the MN blood group antigen in shear-enhanced hemagglutination induced by the Escherichia coli F41 adhesin. Infect Immun. 1989;57:377–383. doi: 10.1128/iai.57.2.377-383.1989. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 121.Le Trong I, Aprikian P, Kidd BA, Forero-Shelton M, Tchesnokova V, Rajagopal P, Rodriguez V, Interlandi G, Klevit R, Vogel V, Stenkamp RE, Sokurenko EV, Thomas WE. Structural basis for mechanical force regulation of the adhesin FimH via finger trap-like beta sheet twisting. Cell. 2010;141:645–655. doi: 10.1016/j.cell.2010.03.038. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 122.Bakker D, Willemsen PT, Willems RH, Huisman TT, Mooi FR, Oudega B, Stegehuis F, de Graaf FK. Identification of minor fimbrial subunits involved in biosynthesis of K88 fimbriae. J Bacteriol. 1992;174:6350–6358. doi: 10.1128/jb.174.20.6350-6358.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 123.Cao J, Khan AS, Bayer ME, Schifferli DM. Ordered translocation of 987P fimbrial subunits through the outer membrane of Escherichia coli. J Bacteriol. 1995;177:3704–3713. doi: 10.1128/jb.177.13.3704-3713.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 124.Ponniah S, Endres RO, Hasty DL, Abraham SN. Fragmentation of Escherichia coli type 1 fimbriae exposes cryptic D-mannose-binding sites. J Bacteriol. 1991;173:4195–4202. doi: 10.1128/jb.173.13.4195-4202.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 125.Li Q, Ng TW, Dodson KW, So SS, Bayle KM, Pinkner JS, Scarlata S, Hultgren SJ, Thanassi DG. T he differential affinity of the usher for chaperone-subunit complexes is required for assembly of complete pili. Mol Microbiol. 2010;76:159–172. doi: 10.1111/j.1365-2958.2010.07089.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 126.Morrissey B, Leney AC, Toste Rego A, Phan G, Allen WJ, Verger D, Waksman G, Ashcroft AE, Radford SE. The role of chaperone-subunit usher domain interactions in the mechanism of bacterial pilus biogenesis revealed by ESI-MS. Mol Cell Proteomics. 2012;11:M111 015289. doi: 10.1074/mcp.M111.015289. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 127.Luo Y, Van Nguyen U, de la Fe Rodriguez PY, Devriendt B, Cox E. F4+ ETEC infection and oral immunization with F4 fimbriae elicits an IL-17-dominated immune response. Vet Res (Faisalabad) 2015;46:121. doi: 10.1186/s13567-015-0264-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 128.Gao Y, Han F, Huang X, Rong Y, Yi H, Wang Y. Changes in gut microbial populations, intestinal morphology, expression of tight junction proteins, and cytokine production between two pig breeds after challenge with Escherichia coli K88: a comparative study. J Anim Sci. 2013;91:5614–5625. doi: 10.2527/jas.2013-6528. [DOI] [PubMed] [Google Scholar]
  • 129.McLamb BL, Gibson AJ, Overman EL, Stahl C, Moeser AJ. Early weaning stress in pigs impairs innate mucosal immune responses to enterotoxigenic E. coli challenge and exacerbates intestinal injury and clinical disease. PLoS One. 2013;8:e59838. doi: 10.1371/journal.pone.0059838. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 130.Edwards RA, Puente JL. Fimbrial expression in enteric bacteria: a critical step in intestinal pathogenesis. Trends Microbiol. 1998;6:282–287. doi: 10.1016/s0966-842x(98)01288-8. [DOI] [PubMed] [Google Scholar]
  • 131.Edwards RA, Schifferli DM. Differential regulation of fasA and fasH expression of Escherichia coli 987P fimbriae by environmental cues. Mol Microbiol. 1997;25:797–809. doi: 10.1046/j.1365-2958.1997.5161875.x. [DOI] [PubMed] [Google Scholar]
  • 132.Burrows MR, Sellwood R, Gibbons RA. Haemagglutinating and adhesive properties associated with the K99 antigen of bovine strains of Escherichia coli. J Gen Microbiol. 1976;96:269–275. doi: 10.1099/00221287-96-2-269. [DOI] [PubMed] [Google Scholar]
  • 133.Guinée PA, Jansen WH. Behavior of Escherichia coli K antigens K88ab, K88ac, and K88ad in immunoelectrophoresis, double diffusion, and hemagglutination. Infect Immun. 1979;23:700–705. doi: 10.1128/iai.23.3.700-705.1979. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 134.Bijlsma IG, Frik JF. Haemagglutination patterns of the different variants of Escherichia coli K88 antigen with porcine, bovine, guinea pig, chicken, ovine and equine erythrocytes. Res Vet Sci. 1987;43:122–123. [PubMed] [Google Scholar]
  • 135.Ike K, Nakazawa M, Tsuchimoto M, Ide S, Kashiwazaki M. Hemagglutination by pilus antigen 987P of enterotoxigenic Escherichia coli. Microbiol Immunol. 1987;31:1255–1258. doi: 10.1111/j.1348-0421.1987.tb01358.x. [DOI] [PubMed] [Google Scholar]
  • 136.Conway PL, Welin A, Cohen PS. Presence of K88-specific receptors in porcine ileal mucus is age dependent. Infect Immun. 1990;58:3178–3182. doi: 10.1128/iai.58.10.3178-3182.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 137.Willemsen PT, de Graaf FK. Age and serotype dependent binding of K88 fimbriae to porcine intestinal receptors. Microb Pathog. 1992;12:367–375. doi: 10.1016/0882-4010(92)90099-a. [DOI] [PubMed] [Google Scholar]
  • 138.Runnels PL, Moon HW, Schneider RA. Development of resistance with host age to adhesion of K99+ Escherichia coli to isolated intestinal epithelial cells. Infect Immun. 1980;28:298–300. doi: 10.1128/iai.28.1.298-300.1980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 139.Teneberg S, Willemsen P, de Graaf FK, Karlsson KA. Receptor-active glycolipids of epithelial cells of the small intestine of young and adult pigs in relation to susceptibility to infection with Escherichia coli K99. FEBS Lett. 1990;263:10–14. doi: 10.1016/0014-5793(90)80693-d. [DOI] [PubMed] [Google Scholar]
  • 140.Yuyama Y, Yoshimatsu K, Ono E, Saito M, Naiki M. Postnatal change of pig intestinal ganglioside bound by Escherichia coli with K99 fimbriae. J Biochem. 1993;113:488–492. doi: 10.1093/oxfordjournals.jbchem.a124071. [DOI] [PubMed] [Google Scholar]
  • 141.Dean EA. Comparison of receptors for 987P pili of enterotoxigenic Escherichia coli in the small intestines of neonatal and older pig. Infect Immun. 1990;58:4030–4035. doi: 10.1128/iai.58.12.4030-4035.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 142.Dean-Nystrom EA, Samuel JE. Age-related resistance to 987P fimbria-mediated colonization correlates with specific glycolipid receptors in intestinal mucus in swine. Infect Immun. 1994;62:4789–4794. doi: 10.1128/iai.62.11.4789-4794.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 143.Dean EA, Whipp SC, Moon HW. Age-specific colonization of porcine intestinal epithelium by 987P-piliated enterotoxigenic Escherichia coli. Infect Immun. 1989;57:82–87. doi: 10.1128/iai.57.1.82-87.1989. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 144.Madar Johansson M, Coddens A, Benktander J, Cox E, Teneberg S. Porcine intestinal glycosphingolipids recognized by F6-fimbriated enterotoxigenic Escherichia coli. Microb Pathog. 2014;76:51–60. doi: 10.1016/j.micpath.2014.09.009. [DOI] [PubMed] [Google Scholar]
  • 145.Nagy B, Casey TA, Whipp SC, Moon HW. Susceptibility of porcine intestine to pilus-mediated adhesion by some isolates of piliated enterotoxigenic Escherichia coli increases with age. Infect Immun. 1992;60:1285–1294. doi: 10.1128/iai.60.4.1285-1294.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 146.Mouricout M, Milhavet M, Durié C, Grange P. Characterization of glycoprotein glycan receptors for Escherichia coli F17 fimbrial lectin. Microb Pathog. 1995;18:297–306. doi: 10.1016/s0882-4010(05)80006-3. [DOI] [PubMed] [Google Scholar]
  • 147.Bakker D, Willemsen PT, Simons LH, van Zijderveld FG, de Graaf FK. Characterization of the antigenic and adhesive properties of FaeG, the major subunit of K88 fimbriae. Mol Microbiol. 1992;6:247–255. doi: 10.1111/j.1365-2958.1992.tb02006.x. [DOI] [PubMed] [Google Scholar]
  • 148.Sun R, Anderson TJ, Erickson AK, Nelson EA, Francis DH. Inhibition of adhesion of Escherichia coli k88ac fimbria to its receptor, intestinal mucin-type glycoproteins, by a monoclonal antibody directed against a variable domain of the fimbria. Infect Immun. 2000;68:3509–3515. doi: 10.1128/iai.68.6.3509-3515.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 149.Jacobs AA, Venema J, Leeven R, van Pelt-Heerschap H, de Graaf FK. Inhibition of adhesive activity of K88 fibrillae by peptides derived from the K88 adhesin. J Bacteriol. 1987;169:735–741. doi: 10.1128/jb.169.2.735-741.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 150.Jacobs AA, Roosendaal B, van Breemen JF, de Graaf FK. Role of phenylalanine 150 in the receptor-binding domain of the K88 fibrillar subunit. J Bacteriol. 1987;169:4907–4911. doi: 10.1128/jb.169.11.4907-4911.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 151.Van Molle I, Joensuu JJ, Buts L, Panjikar S, Kotiaho M, Bouckaert J, Wyns L, Niklander-Teeri V, De Greve H. Chloroplasts assemble the major subunit FaeG of Escherichia coli F4 (K88) fimbriae to strand-swapped dimers. J Mol Biol. 2007;368:791–799. doi: 10.1016/j.jmb.2007.02.051. [DOI] [PubMed] [Google Scholar]
  • 152.Joensuu JJ, Kotiaho M, Riipi T, Snoeck V, Palva ET, Teeri TH, Lång H, Cox E, Goddeeris BM, Niklander-Teeri V. Fimbrial subunit protein FaeG expressed in transgenic tobacco inhibits the binding of F4ac enterotoxigenic Escherichia coli to porcine enterocytes. Transgenic Res. 2004;13:295–298. doi: 10.1023/b:trag.0000034621.55404.70. [DOI] [PubMed] [Google Scholar]
  • 153.Zhang W, Fang Y, Francis DH. Characterization of the binding specificity of K88ac and K88ad fimbriae of enterotoxigenic Escherichia coli by constructing K88ac/K88ad chimeric FaeG major subunits. Infect Immun. 2009;77:699–706. doi: 10.1128/IAI.01165-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 154.Jin LZ, Zhao X. Intestinal receptors for adhesive fimbriae of enterotoxigenic Escherichia coli (ETEC) K88 in swine–a review. Appl Microbiol Biotechnol. 2000;54:311–318. doi: 10.1007/s002530000404. [DOI] [PubMed] [Google Scholar]
  • 155.Billey LO, Erickson AK, Francis DH. Multiple receptors on porcine intestinal epithelial cells for the three variants of Escherichia coli K88 fimbrial adhesin. Vet Microbiol. 1998;59:203–212. doi: 10.1016/s0378-1135(97)00193-4. [DOI] [PubMed] [Google Scholar]
  • 156.Van den Broeck W, Cox E, Oudega B, Goddeeris BM. The F4 fimbrial antigen of Escherichia coli and its receptors. Vet Microbiol. 2000;71:223–244. doi: 10.1016/s0378-1135(99)00174-1. [DOI] [PubMed] [Google Scholar]
  • 157.Yan X, Huang X, Ren J, Zou Z, Yang S, Ouyang J, Zeng W, Yang B, Xiao S, Huang L. Distribution of Escherichia coli F4 adhesion phenotypes in pigs of 15 Chinese and Western breeds and a White DurocxErhualian intercross. J Med Microbiol. 2009;58:1112–1117. doi: 10.1099/jmm.0.009803-0. [DOI] [PubMed] [Google Scholar]
  • 158.Rampoldi A, Bertschinger HU, Bürgi E, Dolf G, Sidler X, Bratus A, Vögeli P, Neuenschwander S. I nheritance of porcine receptors for enterotoxigenic Escherichia coli with fimbriae F4ad and their relation to other F4 receptors. Animal. 2014;8:859–866. doi: 10.1017/S1751731114000779. [DOI] [PubMed] [Google Scholar]
  • 159.Grange PA, Mouricout MA, Levery SB, Francis DH, Erickson AK. Evaluation of receptor binding specificity of Escherichia coli K88 (F4) fimbrial adhesin variants using porcine serum transferrin and glycosphingolipids as model receptors. Infect Immun. 2002;70:2336–2343. doi: 10.1128/IAI.70.5.2336-2343.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 160.Melkebeek V, Rasschaert K, Bellot P, Tilleman K, Favoreel H, Deforce D, De Geest BG, Goddeeris BM, Cox E. Targeting aminopeptidase N, a newly identified receptor for F4ac fimbriae, enhances the intestinal mucosal immune response. Mucosal Immunol. 2012;5:635–645. doi: 10.1038/mi.2012.37. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 161.Goetstouwers T, Van Poucke M, Nguyen VU, Melkebeek V, Coddens A, Deforce D, Cox E, Peelman LJ. F4-related mutation and expression analysis of the aminopeptidase N gene in pigs. J Anim Sci. 2014;92:1866–1873. doi: 10.2527/jas.2013-7307. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 162.Coddens A, Valis E, Benktander J, Ångström J, Breimer ME, Cox E, Teneberg S. Erythrocyte and porcine intestinal glycosphingolipids recognized by F4 fimbriae of enterotoxigenic Escherichia coli. PLoS One. 2011;6:e23309. doi: 10.1371/journal.pone.0023309. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 163.Moonens K, Van den Broeck I, De Kerpel M, Deboeck F, Raymaekers H, Remaut H, De Greve H. Structural and functional insight into the carbohydrate receptor binding of F4 fimbriae-producing enterotoxigenic Escherichia coli. J Biol Chem. 2015;290:8409–8419. doi: 10.1074/jbc.M114.618595. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 164.Payne D, O’Reilly M, Williamson D. The K88 fimbrial adhesin of enterotoxigenic Escherichia coli binds to beta 1-linked galactosyl residues in glycosphingolipids. Infect Immun. 1993;61:3673–3677. doi: 10.1128/iai.61.9.3673-3677.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 165.Khan AS, Johnston NC, Goldfine H, Schifferli DM. Porcine 987P glycolipid receptors on intestinal brush borders and their cognate bacterial ligands. Infect Immun. 1996;64:3688–3693. doi: 10.1128/iai.64.9.3688-3693.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 166.Karlsson K-A. Animal glycosphingolipids as membrane attachment sites for bacteria. Annu Rev Biochem. 1989;58:309–350. doi: 10.1146/annurev.bi.58.070189.001521. [DOI] [PubMed] [Google Scholar]
  • 167.Python P, Jörg H, Neuenschwander S, Hagger C, Stricker C, Bürgi E, Bertschinger HU, Stranzinger G, Vögeli P. Fine-mapping of the intestinal receptor locus for enterotoxigenic Escherichia coli F4ac on porcine chromosome 13. Anim Genet. 2002;33:441–447. doi: 10.1046/j.1365-2052.2002.00915.x. [DOI] [PubMed] [Google Scholar]
  • 168.Jørgensen CB, Cirera S, Anderson SI, Archibald AL, Raudsepp T, Chowdhary B, Edfors-Lilja I, Andersson L, Fredholm M. Linkage and comparative mapping of the locus controlling susceptibility towards E. COLI F4ab/ac diarrhoea in pigs. Cytogenet Genome Res. 2003;102:157–162. doi: 10.1159/000075742. [DOI] [PubMed] [Google Scholar]
  • 169.Peng QL, Ren J, Yan XM, Huang X, Tang H, Wang YZ, Zhang B, Huang LS. The g.243A>G mutation in intron 17 of MUC4 is significantly associated with susceptibility/resistance to ETEC F4ab/ac infection in pigs. Anim Genet. 2007;38:397–400. doi: 10.1111/j.1365-2052.2007.01608.x. [DOI] [PubMed] [Google Scholar]
  • 170.Joller D, Jørgensen CB, Bertschinger HU, Python P, Edfors I, Cirera S, Archibald AL, Bürgi E, Karlskov-Mortensen P, Andersson L, Fredholm M, Vögeli P. Refined localization of the Escherichia coli F4ab/F4ac receptor locus on pig chromosome 13. Anim Genet. 2009;40:749–752. doi: 10.1111/j.1365-2052.2009.01881.x. [DOI] [PubMed] [Google Scholar]
  • 171.Jacobsen M, Kracht SS, Esteso G, Cirera S, Edfors I, Archibald AL, Bendixen C, Andersson L, Fredholm M, Jørgensen CB. Refined candidate region specified by haplotype sharing for Escherichia coli F4ab/F4ac susceptibility alleles in pigs. Anim Genet. 2010;41:21–25. doi: 10.1111/j.1365-2052.2009.01952.x. [DOI] [PubMed] [Google Scholar]
  • 172.Nguyen VU, Goetstouwers T, Coddens A, Van Poucke M, Peelman L, Deforce D, Melkebeek V, Cox E. Differentiation of F4 receptor profiles in pigs based on their mucin 4 polymorphism, responsiveness to oral F4 immunization and in vitro binding of F4 to villi. Vet Immunol Immunopathol. 2013;152:93–100. doi: 10.1016/j.vetimm.2012.09.015. [DOI] [PubMed] [Google Scholar]
  • 173.Zhang B, Ren J, Yan X, Huang X, Ji H, Peng Q, Zhang Z, Huang L. Investigation of the porcine MUC13 gene: isolation, expression, polymorphisms and strong association with susceptibility to enterotoxigenic Escherichia coli F4ab/ac. Anim Genet. 2008;39:258–266. doi: 10.1111/j.1365-2052.2008.01721.x. [DOI] [PubMed] [Google Scholar]
  • 174.Rampoldi A, Jacobsen MJ, Bertschinger HU, Joller D, Bürgi E, Vögeli P, Andersson L, Archibald AL, Fredholm M, Jørgensen CB, Neuenschwander S. The receptor locus for Escherichia coli F4ab/F4ac in the pig maps distal to the MUC4-LMLN region. Mamm Genome. 2011;22:122–129. doi: 10.1007/s00335-010-9305-3. [DOI] [PubMed] [Google Scholar]
  • 175.Ren J, Yan X, Ai H, Zhang Z, Huang X, Ouyang J, Yang M, Yang H, Han P, Zeng W, Chen Y, Guo Y, Xiao S, Ding N, Huang L. Susceptibility towards enterotoxigenic Escherichia coli F4ac diarrhea is governed by the MUC13 gene in pigs. PLoS One. 2012;7:e44573. doi: 10.1371/journal.pone.0044573. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 176.Ji H, Ren J, Yan X, Huang X, Zhang B, Zhang Z, Huang L. The porcine MUC20 gene: molecular characterization and its association with susceptibility to enterotoxigenic Escherichia coli F4ab/ac. Mol Biol Rep. 2011;38:1593–1601. doi: 10.1007/s11033-010-0268-y. [DOI] [PubMed] [Google Scholar]
  • 177.Schroyen M, Stinckens A, Verhelst R, Geens M, Cox E, Niewold T, Buys N. Susceptibility of piglets to enterotoxigenic Escherichia coli is not related to the expression of MUC13 and MUC20. Anim Genet. 2012;43:324–327. doi: 10.1111/j.1365-2052.2011.02241.x. [DOI] [PubMed] [Google Scholar]
  • 178.Goetstouwers T, Van Poucke M, Coppieters W, Nguyen VU, Melkebeek V, Coddens A, Van Steendam K, Deforce D, Cox E, Peelman LJ. Refined candidate region for F4ab/ac enterotoxigenic Escherichia coli susceptibility situated proximal to MUC13 in pigs. PLoS One. 2014;9:e105013. doi: 10.1371/journal.pone.0105013. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 179.Goetstouwers T, Van Poucke M, Coddens A, Nguyen VU, Melkebeek V, Deforce D, Cox E, Peelman LJ. Variation in 12 porcine genes involved in the carbohydrate moiety assembly of glycosphingolipids does not account for differential binding of F4 Escherichia coli and their fimbriae. BMC Genet. 2014;15:103. doi: 10.1186/s12863-014-0103-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 180.Yan XM, Ren J, Huang X, Zhang ZY, Ouyang J, Zeng WH, Zou ZZ, Yang SJ, Yang B, Huang LS. Comparison of production traits between pigs with and without the Escherichia coli F4 receptors in a White Duroc × Erhualian intercross F2 population. J Anim Sci. 2009;87:334–339. doi: 10.2527/jas.2008-1107. [DOI] [PubMed] [Google Scholar]
  • 181.Moseley SL, Dougan G, Schneider RA, Moon HW. Cloning of chromosomal DNA encoding the F41 adhesin of enterotoxigenic Escherichia coli and genetic homology between adhesins F41 and K88. J Bacteriol. 1986;167:799–804. doi: 10.1128/jb.167.3.799-804.1986. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 182.Anderson DG, Moseley SL. Escherichia coli F41 adhesin: genetic organization, nucleotide sequence, and homology with the K88 determinant. J Bacteriol. 1988;170:4890–4896. doi: 10.1128/jb.170.10.4890-4896.1988. erratum appears in J Bacteriol 1989 Feb;171(2:1233.) [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 183.Lindahl M, Wadstrom T. Binding to erythrocyte membrane glycoproteins and carbohydrate specificity of F41 fimbriae of enterotoxigenic Escherichia coli. FEMS Microbiol Lett. 1986;34:297–300. [Google Scholar]
  • 184.Yang B, Huang X, Yan X, Ren J, Yang S, Zou Z, Zeng W, Ou Y, Huang W, Huang L. Detection of quantitative trait loci for porcine susceptibility to enterotoxigenic Escherichia coli F41 in a White Duroc × Chinese Erhualian resource population. Animal. 2009;3:946–950. doi: 10.1017/S1751731109004509. [DOI] [PubMed] [Google Scholar]
  • 185.Jacobs AA, Simons BH, de Graaf FK. The role of lysine-132 and arginine-136 in the receptor-binding domain of the K99 fibrillar subunit. EMBO J. 1987;6:1805–1808. doi: 10.1002/j.1460-2075.1987.tb02434.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 186.Jacobs AA, van den Berg PA, Bak HJ, de Graaf FK. Localization of lysine residues in the binding domain of the K99 fibrillar subunit of enterotoxigenic Escherichia coli. Biochim Biophys Acta. 1986;872:92–97. doi: 10.1016/0167-4838(86)90151-2. [DOI] [PubMed] [Google Scholar]
  • 187.Ono E, Abe K, Nakazawa M, Naiki M. Ganglioside epitope recognized by K99 fimbriae from enterotoxigenic Escherichia coli. Infect Immun. 1989;57:907–911. doi: 10.1128/iai.57.3.907-911.1989. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 188.Smit H, Gaastra W, Kamerling JP, Vliegenthart JF, de Graaf FK. Isolation and structural characterization of the equine erythrocyte receptor for enterotoxigenic Escherichia coli K99 fimbrial adhesin. Infect Immun. 1984;46:578–584. doi: 10.1128/iai.46.2.578-584.1984. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 189.Teneberg S, Willemsen PT, de Graaf FK, Karlsson KA. Calf small intestine receptors for K99 fimbriated enterotoxigenic Escherichia coli. FEMS Microbiol Lett. 1993;109:107–112. doi: 10.1111/j.1574-6968.1993.tb06151.x. [DOI] [PubMed] [Google Scholar]
  • 190.Kyogashima M, Ginsburg V, Krivan HC. Escherichia coli K99 binds to N-glycolylsialoparagloboside and N-glycolyl-GM3 found in piglet small intestine. Arch Biochem Biophys. 1989;270:391–397. doi: 10.1016/0003-9861(89)90042-8. [DOI] [PubMed] [Google Scholar]
  • 191.Teneberg S, Willemsen PT, de Graaf FK, Stenhagen G, Pimlott W, Jovall PA, Angström J, Karlsson KA. Characterization of gangliosides of epithelial cells of calf small intestine, with special reference to receptor-active sequences for enteropathogenic Escherichia coli K99. J Biochem. 1994;116:560–574. doi: 10.1093/oxfordjournals.jbchem.a124562. [DOI] [PubMed] [Google Scholar]
  • 192.Dean EA, Isaacson RE. In vitro adhesion of piliated Escherichia coli to small intestinal villous epithelial cells from rabbits and the identification of a soluble 987P pilus receptor-containing fraction. Infect Immun. 1982;36:1192–1198. doi: 10.1128/iai.36.3.1192-1198.1982. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 193.Dean EA, Isaacson RE. Purification and characterization of a receptor for the 987P pilus of Escherichia coli. Infect Immun. 1985;47:98–105. doi: 10.1128/iai.47.1.98-105.1985. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 194.Dean EA, Isaacson RE. Location and distribution of a receptor for the 987P pilus of Escherichia coli in small intestines. Infect Immun. 1985;47:345–348. doi: 10.1128/iai.47.2.345-348.1985. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 195.Khan AS, Schifferli DM. A minor 987P protein different from the structural fimbrial subunit is the adhesin. Infect Immun. 1994;62:4233–4243. doi: 10.1128/iai.62.10.4233-4243.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 196.Zhu G, Chen H, Choi BK, Del Piero F, Schifferli DM. Histone H1 proteins act as receptors for the 987P fimbriae of enterotoxigenic Escherichia coli. J Biol Chem. 2005;280:23057–23065. doi: 10.1074/jbc.M503676200. [DOI] [PubMed] [Google Scholar]
  • 197.Choi BK, Schifferli DM. Lysine residue 117 of the FasG adhesin of enterotoxigenic Escherichia coli is essential for binding of 987P fimbriae to sulfatide. Infect Immun. 1999;67:5755–5761. doi: 10.1128/iai.67.11.5755-5761.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 198.Choi BK, Schifferli DM. Characterization of FasG segments required for 987P fimbria-mediated binding to piglet glycoprotein receptors. Infect Immun. 2001;69:6625–6632. doi: 10.1128/IAI.69.11.6625-6632.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 199.Imberechts H, Wild P, Charlier G, De Greve H, Lintermans P, Pohl P. Characterization of F18 fimbrial genes fedE and fedF involved in adhesion and length of enterotoxemic Escherichia coli strain 107/86. Microb Pathog. 1996;21:183–192. doi: 10.1006/mpat.1996.0053. [DOI] [PubMed] [Google Scholar]
  • 200.Smeds A, Hemmann K, Jakava-Viljanen M, Pelkonen S, Imberechts H, Palva A. Characterization of the adhesin of Escherichia coli F18 fimbriae. Infect Immun. 2001;69:7941–7945. doi: 10.1128/IAI.69.12.7941-7945.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 201.Smeds A, Pertovaara M, Timonen T, Pohjanvirta T, Pelkonen S, Palva A. Mapping the binding domain of the F18 fimbrial adhesin. Infect Immun. 2003;71:2163–2172. doi: 10.1128/IAI.71.4.2163-2172.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 202.Tiels P, Verdonck F, Smet A, Goddeeris B, Cox E. The F18 fimbrial adhesin FedF is highly conserved among F18(+)Escherichia coli isolates. Vet Microbiol. 2005 doi: 10.1016/j.vetmic.2005.08.004. [DOI] [PubMed] [Google Scholar]
  • 203.Rippinger P, Bertschinger HU, Imberechts H, Nagy B, Sorg I, Stamm M, Wild P, Wittig W. Design ations F18ab and F18ac for the related fimbrial types F107, 2134P and 8813 of Escherichia coli isolated from porcine postweaning diarrhoea and from oedema disease. Vet Microbiol. 1995;45:281–295. doi: 10.1016/0378-1135(94)00141-i. [DOI] [PubMed] [Google Scholar]
  • 204.Vögeli P, Bertschinger HU, Stamm M, Stricker C, Hagger C, Fries R, Rapacz J, Stranzinger G. Ge nes specifying receptors for F18 fimbriated Escherichia coli, causing oedema disease and postweaning diarrhoea in pigs, map to chromosome 6. Anim Genet. 1996;27:321–328. [PubMed] [Google Scholar]
  • 205.Meijerink E, Neuenschwander S, Fries R, Dinter A, Bertschinger HU, Stranzinger G, Vögeli P. A DNA polymorphism influencing alpha(1,2)fucosyltransferase activity of the pig FUT1 enzyme determines susceptibility of small intestinal epithelium to Escherichia coli F18 adhesion. Immunogenetics. 2000;52:129–136. doi: 10.1007/s002510000263. [DOI] [PubMed] [Google Scholar]
  • 206.Meijerink E, Fries R, Vögeli P, Masabanda J, Wigger G, Stricker C, Neuenschwander S, Bertschinger HU, Stranzinger G. Two alpha(1,2) fucosyltransferase genes on porcine chromosome 6q11 are closely linked to the blood group inhibitor (S) and Escherichia coli F18 receptor (ECF18R) loci. Mamm Genome. 1997;8:736–741. doi: 10.1007/s003359900556. [DOI] [PubMed] [Google Scholar]
  • 207.Snoeck V, Verdonck F, Cox E, Goddeeris BM. Inhibition of adhesion of F18+ Escherichia coli to piglet intestinal villous enterocytes by monoclonal antibody against blood group H-2 antigen. Vet Microbiol. 2004;100:241–246. doi: 10.1016/j.vetmic.2004.03.001. [DOI] [PubMed] [Google Scholar]
  • 208.Coddens A, Diswall M, Angström J, Breimer ME, Goddeeris B, Cox E, Teneberg S. Recognition of blood group ABH type 1 determinants by the FedF adhesin of F18-fimbriated Escherichia coli. J Biol Chem. 2009;284:9713–9726. doi: 10.1074/jbc.M807866200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 209.Moonens K, Bouckaert J, Coddens A, Tran T, Panjikar S, De Kerpel M, Cox E, Remaut H, De Greve H. Structural insight in histo-blood group binding by the F18 fimbrial adhesin FedF. Mol Microbiol. 2012;86:82–95. doi: 10.1111/j.1365-2958.2012.08174.x. [DOI] [PubMed] [Google Scholar]
  • 210.Lonardi E, Moonens K, Buts L, de Boer AR, Olsson JD, Weiss MS, Fabre E, Guérardel Y, Deelder AM, Oscarson S, Wuhrer M, Bouckaert J. Structural Sampling of Glycan Interaction Profiles Reveals Mucosal Receptors for Fimbrial Adhesins of Enterotoxigenic Escherichia coli. Biology (Basel) 2013;2:894–917. doi: 10.3390/biology2030894. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 211.Zhao Q, Liu Y, Dong W, Zhu S, Huo Y, Wu S, Bao W. Genetic variations of TAP1 gene exon 3 affects gene expression and Escherichia coli F18 resistance in piglets. Int J Mol Sci. 2014;15:11161–11171. doi: 10.3390/ijms150611161. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 212.Wang SJ, Liu WJ, Yang LG, Sargent CA, Liu HB, Wang C, Liu XD, Zhao SH, Affara NA, Liang AX, Zhang SJ. Effects of FUT1 gene mutation on resistance to infectious disease. Mol Biol Rep. 2012;39:2805–2810. doi: 10.1007/s11033-011-1039-0. [DOI] [PubMed] [Google Scholar]
  • 213.Bao WB, Ye L, Zhu J, Pan ZY, Zhu GQ, Huang XG, Wu SL. Polymorphism of M307 of the FUT1 gene and its relationship with some immune indexes in Sutai pigs (Duroc x Meishan) Biochem Genet. 2011;49:665–673. doi: 10.1007/s10528-011-9441-9. [DOI] [PubMed] [Google Scholar]
  • 214.Bao WB, Wu SL, Musa HH, Zhu GQ, Chen GH. Genetic variation at the alpha-1-fucosyltransferase (FUT1) gene in Asian wild boar and Chinese and Western commercial pig breeds. J Anim Breed Genet. 2008;125:427–430. doi: 10.1111/j.1439-0388.2008.00722.x. [DOI] [PubMed] [Google Scholar]
  • 215.Lintermans PF, Bertels A, Schlicker C, Deboeck F, Charlier G, Pohl P, Norgren M, Normark S, van Montagu M, De Greve H. Identification, characterization, and nucleotide sequence of the F17-G gene, which determines receptor binding of Escherichia coli F17 fimbriae. J Bacteriol. 1991;173:3366–3373. doi: 10.1128/jb.173.11.3366-3373.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 216.Sanchez R, Kanarek L, Koninkx J, Hendriks H, Lintermans P, Bertels A, Charlier G, Van Driessche E. Inhibition of adhesion of enterotoxigenic Escherichia coli cells expressing F17 fimbriae to small intestinal mucus and brush-border membranes of young calves. Microb Pathog. 1993;15:207–219. doi: 10.1006/mpat.1993.1090. [DOI] [PubMed] [Google Scholar]
  • 217.Buts L, Bouckaert J, De Genst E, Loris R, Oscarson S, Lahmann M, Messens J, Brosens E, Wyns L, De Greve H. The fimbrial adhesin F17-G of enterotoxigenic Escherichia coli has an immunoglobulin-like lectin domain that binds N-acetylglucosamine. Mol Microbiol. 2003;49:705–715. doi: 10.1046/j.1365-2958.2003.03600.x. [DOI] [PubMed] [Google Scholar]
  • 218.Merckel MC, Tanskanen J, Edelman S, Westerlund-Wikström B, Korhonen TK, Goldman A. The structural basis of receptor-binding by Escherichia coli associated with diarrhea and septicemia. J Mol Biol. 2003;331:897–905. doi: 10.1016/s0022-2836(03)00841-6. [DOI] [PubMed] [Google Scholar]
  • 219.Geibel S, Waksman G. The molecular dissection of the chaperone-usher pathway. Biochim Biophys Acta. 2014;1843:1559–1567. doi: 10.1016/j.bbamcr.2013.09.023. [DOI] [PubMed] [Google Scholar]
  • 220.Lycklama A, Nijeholt JA, Driessen AJ. The bacterial Sec-translocase: structure and mechanism. Philos Trans R Soc Lond B Biol Sci. 2012;367:1016–1028. doi: 10.1098/rstb.2011.0201. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 221.Mooi FR, Wijfjes A, de Graaf FK. Identification and characterization of precursors in the biosynthesis of the K88ab fimbria of Escherichia coli. J Bacteriol. 1983;154:41–49. doi: 10.1128/jb.154.1.41-49.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 222.Sauer FG, Fütterer K, Pinkner JS, Dodson KW, Hultgren SJ, Waksman G. Structural basis of chaperone function and pilus biogenesis. Science. 1999;285:1058–1061. doi: 10.1126/science.285.5430.1058. [DOI] [PubMed] [Google Scholar]
  • 223.Jacob-Dubuisson F, Striker R, Hultgren SJ. Chaperone-assisted self-assembly of pili independent of cellular energy. J Biol Chem. 1994;269:12447–12455. [PubMed] [Google Scholar]
  • 224.Palomino C, Marín E, Fernández LA. The fimbrial usher FimD follows the SurA-BamB pathway for its assembly in the outer membrane of Escherichia coli. J Bacteriol. 2011;193:5222–5230. doi: 10.1128/JB.05585-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 225.Hagan CL, Silhavy TJ, Kahne D. β-Barrel membrane protein assembly by the Bam complex. Annu Rev Biochem. 2011;80:189–210. doi: 10.1146/annurev-biochem-061408-144611. [DOI] [PubMed] [Google Scholar]
  • 226.Barnhart MM, Sauer FG, Pinkner JS, Hultgren SJ. Chaperone-subunit-usher interactions required for donor strand exchange during bacterial pilus assembly. J Bacteriol. 2003;185:2723–2730. doi: 10.1128/JB.185.9.2723-2730.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 227.Van Molle I, Moonens K, Garcia-Pino A, Buts L, De Kerpel M, Wyns L, Bouckaert J, De Greve H. Structural and thermodynamic characterization of pre- and postpolymerization states in the F4 fimbrial subunit FaeG. J Mol Biol. 2009;394:957–967. doi: 10.1016/j.jmb.2009.09.059. [DOI] [PubMed] [Google Scholar]
  • 228.Thanassi DG, Saulino ET, Lombardo MJ, Roth R, Heuser J, Hultgren SJ. The PapC usher forms an oligomeric channel: implications for pilus biogenesis across the outer membrane. Proc Natl Acad Sci USA. 1998;95:3146–3151. doi: 10.1073/pnas.95.6.3146. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 229.Huang Y, Smith BS, Chen LX, Baxter RH, Deisenhofer J. Insights into pilus assembly and secretion from the structure and functional characterization of usher PapC. Proc Natl Acad Sci USA. 2009;106:7403–7407. doi: 10.1073/pnas.0902789106. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 230.Saulino ET, Bullitt E, Hultgren SJ. Snapshots of usher-mediated protein secretion and ordered pilus assembly. Proc Natl Acad Sci USA. 2000;97:9240–9245. doi: 10.1073/pnas.160070497. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 231.Lowe MA, Holt SC, Eisenstein BI. Immunoelectron microscopic analysis of elongation of type 1 fimbriae in Escherichia coli. J Bacteriol. 1987;169:157–163. doi: 10.1128/jb.169.1.157-163.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 232.Verdonck F, Cox E, Schepers E, Imberechts H, Joensuu J, Goddeeris BM. Conserved regions in the sequence of the F4 (K88) fimbrial adhesin FaeG suggest a donor strand mechanism in F4 assembly. Vet Microbiol. 2004;102:215–225. doi: 10.1016/j.vetmic.2004.06.002. [DOI] [PubMed] [Google Scholar]
  • 233.Bakker D. Studies on the K88 fimbriae of enteropathogenic Escherichia coli. Vrije Universiteit; Amsterdam, The Netherlands: 1991. [Google Scholar]
  • 234.Bakker D, Vader CE, Roosendaal B, Mooi FR, Oudega B, de Graaf FK. Structure and function of periplasmic chaperone-like proteins involved in the biosynthesis of K88 and K99 fimbriae in enterotoxigenic Escherichia coli. Mol Microbiol. 1991;5:875–886. doi: 10.1111/j.1365-2958.1991.tb00761.x. [DOI] [PubMed] [Google Scholar]
  • 235.Mol O, Visschers RW, de Graff FK, Oudega B. Escherichia coli periplasmic chaperone FaeE is a homodimer and the chaperone-K88 subunit complex is a heterotrimer. Mol Microbiol. 1994;11:391–402. doi: 10.1111/j.1365-2958.1994.tb00319.x. [DOI] [PubMed] [Google Scholar]
  • 236.Mol O, Oudhuis WC, Fokkema H, Oudega B. The N-terminal beta-barrel domain of the Escherichia coli K88 periplasmic chaperone FaeE determines fimbrial subunit recognition and dimerization. Mol Microbiol. 1996;22:379–388. doi: 10.1046/j.1365-2958.1996.00122.x. [DOI] [PubMed] [Google Scholar]
  • 237.Mol O, Oud RP, de Graaf FK, Oudega B. The Escherichia coli K88 periplasmic chaperone FaeE forms a heterotrimeric complex with the minor fimbrial component FaeH and with the minor fimbrial component FaeI. Microb Pathog. 1995;18:115–128. doi: 10.1016/s0882-4010(95)90109-4. [DOI] [PubMed] [Google Scholar]
  • 238.Van Molle I, Moonens K, Buts L, Garcia-Pino A, Panjikar S, Wyns L, De Greve H, Bouckaert J. The F4 fimbrial chaperone FaeE is stable as a monomer that does not require self-capping of its pilin-interactive surfaces. Acta Crystallogr D Biol Crystallogr. 2009;65:411–420. doi: 10.1107/S0907444909005174. [DOI] [PubMed] [Google Scholar]
  • 239.Mooi FR, Claassen I, Bakker D, Kuipers H, de Graaf FK. Regulation and structure of an Escherichia coli gene coding for an outer membrane protein involved in export of K88ab fimbrial subunits. Nucleic Acids Res. 1986;14:2443–2457. doi: 10.1093/nar/14.6.2443. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 240.Valent QA, Zaal J, de Graaf FK, Oudega B. Subcellular localization and topology of the K88 usher FaeD in Escherichia coli. Mol Microbiol. 1995;16:1243–1257. doi: 10.1111/j.1365-2958.1995.tb02346.x. [DOI] [PubMed] [Google Scholar]
  • 241.Harms N, Oudhuis WC, Eppens EA, Valent QA, Koster M, Luirink J, Oudega B. Epitope tagging analysis of the outer membrane folding of the molecular usher FaeD involved in K88 fimbriae biosynthesis in Escherichia coli. J Mol Microbiol Biotechnol. 1999;1:319–325. [PubMed] [Google Scholar]
  • 242.Mooi FR, Wouters C, Wijfjes A, de Graaf FK. Construction and characterization of mutants impaired in the biosynthesis of the K88ab antigen. J Bacteriol. 1982;150:512–521. doi: 10.1128/jb.150.2.512-521.1982. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 243.van Doorn J, Oudega B, Mooi FR, de Graaf FK. Subcellular localization of polypeptides involved in the biosynthesis of K88ab fimbriae. FEMS Microbiol Lett. 1982;13:99–104. [Google Scholar]
  • 244.Dougan G, Dowd G, Kehoe M. Organization of K88ac-encoded polypeptides in the Escherichia coli cell envelope: use of minicells and outer membrane protein mutants for studying assembly of pili. J Bacteriol. 1983;153:364–370. doi: 10.1128/jb.153.1.364-370.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 245.Mol O, Oudhuis WC, Oud RP, Sijbrandi R, Luirink J, Harms N, Oudega B. Biosynthesis of K88 fimbriae in Escherichia coli: interaction of tip-subunit FaeC with the periplasmic chaperone FaeE and the outer membrane usher FaeD. J Mol Microbiol Biotechnol. 2001;3:135–142. [PubMed] [Google Scholar]
  • 246.Oudega B, de Graaf M, de Boer L, Bakker D, Vader CE, Mooi FR, de Graaf FK. Detection and identification of FaeC as a minor component of K88 fibrillae of Escherichia coli. Mol Microbiol. 1989;3:645–652. doi: 10.1111/j.1365-2958.1989.tb00212.x. [DOI] [PubMed] [Google Scholar]
  • 247.Mooi FR, van Buuren M, Koopman G, Roosendaal B, de Graaf FK. K88ab gene of Escherichia coli encodes a fimbria-like protein distinct from the K88ab fimbrial adhesin. J Bacteriol. 1984;159:482–487. doi: 10.1128/jb.159.2.482-487.1984. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 248.Mol O, Oudega B. Molecular and structural aspects of fimbriae biosynthesis and assembly in Escherichia coli. FEMS Microbiol Rev. 1996;19:25–52. doi: 10.1111/j.1574-6976.1996.tb00252.x. [DOI] [PubMed] [Google Scholar]
  • 249.Korth MJ, Apostol JM, Jr, Moseley SL. Functional expression of heterologous fimbrial subunits mediated by the F41, K88, and CS31A determinants of Escherichia coli. Infect Immun. 1992;60:2500–2505. doi: 10.1128/iai.60.6.2500-2505.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 250.Mol O, Fokkema H, Oudega B. The Escherichia coli K99 periplasmic chaperone FanE is a monomeric protein. FEMS Microbiol Lett. 1996;138:185–189. doi: 10.1111/j.1574-6968.1996.tb08154.x. [DOI] [PubMed] [Google Scholar]
  • 251.de Graaf FK, Krenn BE, Klaasen P. Organization and expression of genes involved in the biosynthesis of K99 fimbriae. Infect Immun. 1984;43:508–514. doi: 10.1128/iai.43.2.508-514.1984. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 252.Simons BL, Willemsen PT, Bakker D, Roosendaal B, De Graaf FK, Oudega B. Structure, localization and function of FanF, a minor component of K99 fibrillae of enterotoxigenic Escherichia coli. Mol Microbiol. 1990;4:2041–2050. doi: 10.1111/j.1365-2958.1990.tb00564.x. [DOI] [PubMed] [Google Scholar]
  • 253.Roosendaal E, Jacobs AA, Rathman P, Sondermeyer C, Stegehuis F, Oudega B, de Graaf FK. Primary structure and subcellular localization of two fimbrial subunit-like proteins involved in the biosynthesis of K99 fibrillae. Mol Microbiol. 1987;1:211–217. doi: 10.1111/j.1365-2958.1987.tb00514.x. [DOI] [PubMed] [Google Scholar]
  • 254.Simons LH, Willemsen PT, Bakker D, de Graaf FK, Oudega B. Localization and function of FanH and FanG, minor components of K99 fimbriae of enterotoxigenic Escherichia coli. Microb Pathog. 1991;11:325–336. doi: 10.1016/0882-4010(91)90018-6. [DOI] [PubMed] [Google Scholar]
  • 255.Schifferli DM, Beachey EH, Taylor RK. Genetic analysis of 987P adhesion and fimbriation of Escherichia coli: the fas genes link both phenotypes. J Bacteriol. 1991;173:1230–1240. doi: 10.1128/jb.173.3.1230-1240.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 256.Schifferli DM, Alrutz MA. Permissive linker insertion sites in the outer membrane protein of 987P fimbriae of Escherichia coli. J Bacteriol. 1994;176:1099–1110. doi: 10.1128/jb.176.4.1099-1110.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 257.Edwards RA, Cao J, Schifferli DM. Identification of major and minor chaperone proteins involved in the export of 987P fimbriae. J Bacteriol. 1996;178:3426–3433. doi: 10.1128/jb.178.12.3426-3433.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 258.Imberechts H, Van Pelt N, De Greve H, Lintermans P. Sequences related to the major subunit gene fedA of F107 fimbriae in porcine Escherichia coli strains that express adhesive fimbriae. FEMS Microbiol Lett. 1994;119:309–314. doi: 10.1111/j.1574-6968.1994.tb06906.x. [DOI] [PubMed] [Google Scholar]
  • 259.Kennan RM, Moncktor RP, McDougall BM, Conway PL. Confirmation that DNA encoding the major fimbrial subunit of Av24 fimbriae is homologous to DNA encoding the major fimbrial subunit of F107 fimbriae. Microb Pathog. 1995;18:67–72. doi: 10.1016/s0882-4010(05)80013-0. [DOI] [PubMed] [Google Scholar]
  • 260.Bosworth BT, Dean-Nystrom EA, Casey TA, Neibergs HL. Differentiation of F18ab+ from F18ac+ Escherichia coli by single-strand conformational polymorphism analysis of the major fimbrial subunit gene (fedA) Clin Diagn Lab Immunol. 1998;5:299–302. doi: 10.1128/cdli.5.3.299-302.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 261.Byun JW, Jung BY, Kim HY, Fairbrother JM, Lee MH, Lee WK. Real-time PCR for differentiation of F18 variants among enterotoxigenic and Shiga toxin-producing Escherichia coli from piglets with diarrhoea and oedema disease. Vet J. 2013;198:538–540. doi: 10.1016/j.tvjl.2013.07.021. [DOI] [PubMed] [Google Scholar]
  • 262.Lee JH, Isaacson RE. Expression of the gene cluster associated with the Escherichia coli pilus adhesin K99. Infect Immun. 1995;63:4143–4149. doi: 10.1128/iai.63.10.4143-4149.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 263.Yang Y, Yao F, Zhou M, Zhu J, Zhang X, Bao W, Wu S, Hardwidge PR, Zhu G. F18ab Escherichia coli flagella expression is regulated by acyl-homoserine lactone and contributes to bacterial virulence. Vet Microbiol. 2013;165:378–383. doi: 10.1016/j.vetmic.2013.04.020. [DOI] [PubMed] [Google Scholar]
  • 264.Sturbelle RT, de Avila LF, Roos TB, Borchardt JL, da Conceição RC, Dellagostin OA, Leite FP. The role of quorum sensing in Escherichia coli (ETEC) virulence factors. Vet Microbiol. 2015;180:245–252. doi: 10.1016/j.vetmic.2015.08.015. [DOI] [PubMed] [Google Scholar]
  • 265.Bak G, Lee J, Suk S, Kim D, Young Lee J, Kim KS, Choi BS, Lee Y. Identification of novel sRNAs involved in biofilm formation, motility, and fimbriae formation in Escherichia coli. Sci Rep. 2015;5:15287. doi: 10.1038/srep15287. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 266.Khandige S, Kronborg T, Uhlin BE, Møller-Jensen J. sRNA-Mediated Regulation of P-Fimbriae Phase Variation in Uropathogenic Escherichia coli. PLoS Pathog. 2015;11:e1005109. doi: 10.1371/journal.ppat.1005109. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 267.Huisman TT, Bakker D, Klaasen P, de Graaf FK. Leucine-responsive regulatory protein, IS1 insertions, and the negative regulator FaeA control the expression of the fae (K88) operon in Escherichia coli. Mol Microbiol. 1994;11:525–536. doi: 10.1111/j.1365-2958.1994.tb00333.x. [DOI] [PubMed] [Google Scholar]
  • 268.van der Woude MW, Braaten BA, Low DA. Evidence for global regulatory control of pilus expression in Escherichia coli by Lrp and DNA methylation: model building based on analysis of pap. Mol Microbiol. 1992;6:2429–2435. doi: 10.1111/j.1365-2958.1992.tb01418.x. [DOI] [PubMed] [Google Scholar]
  • 269.Huisman TT, de Graaf FK. Negative control of fae (K88) expression by the ‘global’ regulator Lrp is modulated by the ‘local’ regulator FaeA and affected by DNA methylation. Mol Microbiol. 1995;16:943–953. doi: 10.1111/j.1365-2958.1995.tb02320.x. [DOI] [PubMed] [Google Scholar]
  • 270.van der Woude MW, Braster M, van Verseveld HW, de Graaf FK. Control of temperature-dependent synthesis of K99 fimbriae. FEMS Microbiol Lett. 1990;56:183–188. doi: 10.1111/j.1574-6968.1990.tb04146.x. [DOI] [PubMed] [Google Scholar]
  • 271.de Graaf FK, Roorda I. Production, purification, and characterization of the fimbrial adhesive antigen F41 isolated from calf enteropathogenic Escherichia coli strain B41M. Infect Immun. 1982;36:751–758. doi: 10.1128/iai.36.2.751-758.1982. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 272.Isaacson RE. Factors affecting expression of the Escherichia coli pilus K99. Infect Immun. 1980;28:190–194. doi: 10.1128/iai.28.1.190-194.1980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 273.White-Ziegler CA, Villapakkam A, Ronaszeki K, Young S. H-NS controls pap and daa fimbrial transcription in Escherichia coli in response to multiple environmental cues. J Bacteriol. 2000;182:6391–6400. doi: 10.1128/jb.182.22.6391-6400.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 274.Francis DH, Ryan CJ, Fritzemeier JD. Effect of sodium acetate on expression of K99 pili by Escherichia coli. Infect Immun. 1983;41:1368–1369. doi: 10.1128/iai.41.3.1368-1369.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 275.Isaacson RE. Regulation of expression of Escherichia coli pilus K99. Infect Immun. 1983;40:633–639. doi: 10.1128/iai.40.2.633-639.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 276.Girardeau JP, Dubourguier HC, Gouet P. Effect of glucose and amino acids on expression of K99 antigen in Escherichia coli. J Gen Microbiol. 1982;128:2243–2249. doi: 10.1099/00221287-128-10-2243. [DOI] [PubMed] [Google Scholar]
  • 277.Roosendaal E, Boots M, de Graaf FK. Two novel genes, fanA and fanB, involved in the biogenesis of K99 fimbriae. Nucleic Acids Res. 1987;15:5973–5984. doi: 10.1093/nar/15.15.5973. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 278.Roosendaal B, Damoiseaux J, Jordi W, de Graaf FK. Transcriptional organization of the DNA region controlling expression of the K99 gene cluster. Mol Gen Genet. 1989;215:250–256. doi: 10.1007/BF00339725. [DOI] [PubMed] [Google Scholar]
  • 279.Braaten BA, Platko JV, van der Woude MW, Simons BH, de Graaf FK, Calvo JM, Low DA. Leucine-responsive regulatory protein controls the expression of both the pap and fan pili operons in Escherichia coli. Proc Natl Acad Sci USA. 1992;89:4250–4254. doi: 10.1073/pnas.89.10.4250. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 280.de Graaf FK, Klaasen-Boor P, van Hees JE. Biosynthesis of the K99 surface antigen is repressed by alanine. Infect Immun. 1980;30:125–128. doi: 10.1128/iai.30.1.125-128.1980. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 281.Inoue OJ, Lee JH, Isaacson RE. Transcriptional organization of the Escherichia coli pilus adhesin K99. Mol Microbiol. 1993;10:607–613. doi: 10.1111/j.1365-2958.1993.tb00932.x. [DOI] [PubMed] [Google Scholar]
  • 282.van der Woude MW, de Graaf FK, van Verseveld HW. Production of the fimbrial adhesin 987P by enterotoxigenic Escherichia coli during growth under controlled conditions in a chemostat. J Gen Microbiol. 1989;135:3421–3429. doi: 10.1099/00221287-135-12-3421. [DOI] [PubMed] [Google Scholar]
  • 283.Honarvar S, Choi BK, Schifferli DM. Phase variation of the 987P-like CS18 fimbriae of human enterotoxigenic Escherichia coli is regulated by site-specific recombinases. Mol Microbiol. 2003;48:157–171. doi: 10.1046/j.1365-2958.2003.03419.x. [DOI] [PubMed] [Google Scholar]
  • 284.Edwards RA, Keller LH, Schifferli DM. Improved allelic exchange vectors and their use to analyze 987P fimbria gene expression. Gene. 1998;207:149–157. doi: 10.1016/s0378-1119(97)00619-7. [DOI] [PubMed] [Google Scholar]
  • 285.Abraham JM, Freitag CS, Clements JR, Eisenstein BI. An invertible element of DNA controls phase variation of type 1 fimbriae of Escherichia coli. Proc Natl Acad Sci USA. 1985;82:5724–5727. doi: 10.1073/pnas.82.17.5724. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 286.van der Woude M, Braaten B, Low D. Epigenetic phase variation of the pap operon in Escherichia coli. Trends Microbiol. 1996;4:5–9. doi: 10.1016/0966-842x(96)81498-3. [DOI] [PubMed] [Google Scholar]
  • 287.Klaasen P, de Graaf FK. Characterization of FapR, a positive regulator of expression of the 987P operon in enterotoxigenic Escherichia coli. Mol Microbiol. 1990;4:1779–1783. doi: 10.1111/j.1365-2958.1990.tb00556.x. [DOI] [PubMed] [Google Scholar]
  • 288.Munson GP, Holcomb LG, Scott JR. Novel group of virulence activators within the AraC family that are not restricted to upstream binding sites. Infect Immun. 2001;69:186–193. doi: 10.1128/IAI.69.1.186-193.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 289.Nagy B, Whipp SC, Imberechts H, Bertschinger HU, Dean-Nystrom EA, Casey TA, Salajka E. Biological relationship between F18ab and F18ac fimbriae of enterotoxigenic and verotoxigenic Escherichia coli from weaned pigs with oedema disease or diarrhoea. Microb Pathog. 1997;22:1–11. doi: 10.1006/mpat.1996.0085. [DOI] [PubMed] [Google Scholar]
  • 290.Cantey JR, Blake RK, Williford JR, Moseley SL. Characterization of the Escherichia coli AF/R1 pilus operon: novel genes necessary for transcriptional regulation and for pilus-mediated adherence. Infect Immun. 1999;67:2292–2298. doi: 10.1128/iai.67.5.2292-2298.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 291.Shepard SM, Danzeisen JL, Isaacson RE, Seemann T, Achtman M, Johnson TJ. Genome sequences and phylogenetic analysis of K88- and F18-positive porcine enterotoxigenic Escherichia coli. J Bacteriol. 2012;194:395–405. doi: 10.1128/JB.06225-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 292.Zhang W, Berberov EM, Freeling J, He D, Moxley RA, Francis DH. Significance of heat-stable and heat-labile enterotoxins in porcine colibacillosis in an additive model for pathogenicity studies. Infect Immun. 2006;74:3107–3114. doi: 10.1128/IAI.01338-05. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 293.Savarino SJ, Fasano A, Robertson DC, Levine MM. Enteroaggregative Escherichia coli elaborate a heat-stable enterotoxin demonstrable in an in vitro rabbit intestinal model. J Clin Invest. 1991;87:1450–1455. doi: 10.1172/JCI115151. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 294.Ménard LP, Dubreuil JD. Enteroaggregative Escherichia coli heat-stable enterotoxin 1 (EAST1): a new toxin with an old twist. Crit Rev Microbiol. 2002;28:43–60. doi: 10.1080/1040-840291046687. [DOI] [PubMed] [Google Scholar]
  • 295.Dubreuil JD. In Escherchia coli heat-stable enterotoxins. The comprehensive sourcebook of bacterial protein toxins. Elsevier; 2015. pp. 874–910. Chapter 31, •••. [Google Scholar]
  • 296.De SN, Bhattacharya K, Sarkar JK. A study of the pathogenicity of strains of Bacterium coli from acute and chronic enteritis. J Pathol Bacteriol. 1956;71:201–209. doi: 10.1002/path.1700710126. [DOI] [PubMed] [Google Scholar]
  • 297.Ochi S, Shimizu T, Ohtani K, Ichinose Y, Arimitsu H, Tsukamoto K, Kato M, Tsuji T. Nucleotide sequence analysis of the enterotoxigenic Escherichia coli Ent plasmid. DNA Res. 2009;16:299–309. doi: 10.1093/dnares/dsp015. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 298.Scotland SM, Day NP, Rowe B. Acquisition and maintenance of enterotoxin plasmids in wild-type strains of Escherichia coli. J Gen Microbiol. 1983;129:3111–3120. doi: 10.1099/00221287-129-10-3111. [DOI] [PubMed] [Google Scholar]
  • 299.Zhang C, Rausch D, Zhang W. Little heterogeneity among genes encoding heat-labile and heat-stable toxins of enterotoxigenic Escherichia coli strains isolated from diarrheal pigs. Appl Environ Microbiol. 2009;75:6402–6405. doi: 10.1128/AEM.00952-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 300.Guth BE, Twiddy EM, Trabulsi LR, Holmes RK. Variation in chemical properties and antigenic determinants among type II heat-labile enterotoxins of Escherichia coli. Infect Immun. 1986;54:529–536. doi: 10.1128/iai.54.2.529-536.1986. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 301.Nawar HF, Berenson CS, Hajishengallis G, Takematsu H, Mandell L, Clare RL, Connell TD. Bindi ng to gangliosides containing N-acetylneuraminic acid is sufficient to mediate the immunomodulatory properties of the nontoxic mucosal adjuvant LT-IIb(T13I) Clin Vaccine Immunol. 2010;17:969–978. doi: 10.1128/CVI.00076-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 302.Casey TA, Connell TD, Holmes RK, Whipp SC. Evaluation of heat-labile enterotoxins type IIa and type IIb in the pathogenicity of enterotoxigenic Escherichia coli for neonatal pigs. Vet Microbiol. 2012;159:83–89. doi: 10.1016/j.vetmic.2012.03.018. [DOI] [PubMed] [Google Scholar]
  • 303.Connell TD. Cholera toxin, LT-I, LT-IIa and LT-IIb: the critical role of ganglioside binding in immunomodulation by type I and type II heat-labile enterotoxins. Expert Rev Vaccines. 2007;6:821–834. doi: 10.1586/14760584.6.5.821. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 304.Mekalanos JJ, Sublett RD, Romig WR. Genetic mapping of toxin regulatory mutations in Vibrio cholerae. J Bacteriol. 1979;139:859–865. doi: 10.1128/jb.139.3.859-865.1979. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 305.Pickett CL, Twiddy EM, Belisle BW, Holmes RK. Cloning of genes that encode a new heat-labile enterotoxin of Escherichia coli. J Bacteriol. 1986;165:348–352. doi: 10.1128/jb.165.2.348-352.1986. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 306.Connell TD, Holmes RK. Characterization of hybrid toxins produced in Escherichia coli by assembly of A and B polypeptides from type I and type II heat-labile enterotoxins. Infect Immun. 1992;60:1653–1661. doi: 10.1128/iai.60.4.1653-1661.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 307.Dorsey FC, Fischer JF, Fleckenstein JM. Directed delivery of heat-labile enterotoxin by enterotoxigenic Escherichia coli. Cell Microbiol. 2006;8:1516–1527. doi: 10.1111/j.1462-5822.2006.00736.x. [DOI] [PubMed] [Google Scholar]
  • 308.Johnson AM, Kaushik RS, Francis DH, Fleckenstein JM, Hardwidge PR. Heat-labile enterotoxin promotes Escherichia coli adherence to intestinal epithelial cells. J Bacteriol. 2009;191:178–186. doi: 10.1128/JB.00822-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 309.Wijemanne P, Moxley RA. Glucose significantly enhances enterotoxigenic Escherichia coli adherence to intestinal epithelial cells through its effects on heat-labile enterotoxin production. PLoS One. 2014;9:e113230. doi: 10.1371/journal.pone.0113230. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 310.Lasaro MA, Rodrigues JF, Mathias-Santos C, Guth BE, Régua-Mangia A, Piantino Ferreira AJ, Takagi M, Cabrera-Crespo J, Sbrogio-Almeida ME, de Souza Ferreira LC. Production and release of heat-labile toxin by wild-type human-derived enterotoxigenic Escherichia coli. FEMS Immunol Med Microbiol. 2006;48:123–131. doi: 10.1111/j.1574-695X.2006.00134.x. [DOI] [PubMed] [Google Scholar]
  • 311.Rodighiero C, Aman AT, Kenny MJ, Moss J, Lencer WI, Hirst TR. Structural basis for the differential toxicity of cholera toxin and Escherichia coli heat-labile enterotoxin. Construction of hybrid toxins identifies the A2-domain as the determinant of differential toxicity. J Biol Chem. 1999;274:3962–3969. doi: 10.1074/jbc.274.7.3962. [DOI] [PubMed] [Google Scholar]
  • 312.Goins B, Freire E. Thermal stability and intersubunit interactions of cholera toxin in solution and in association with its cell-surface receptor ganglioside GM1. Biochemistry. 1988;27:2046–2052. doi: 10.1021/bi00406a035. [DOI] [PubMed] [Google Scholar]
  • 313.Surewicz WK, Leddy JJ, Mantsch HH. Structure, stability, and receptor interaction of cholera toxin as studied by Fourier-transform infrared spectroscopy. Biochemistry. 1990;29:8106–8111. doi: 10.1021/bi00487a017. [DOI] [PubMed] [Google Scholar]
  • 314.Hegde A, Bhat GK, Mallya S. Effect of stress on production of heat labile enterotoxin by Escherichia coli. Indian J Med Microbiol. 2009;27:325–328. doi: 10.4103/0255-0857.55446. [DOI] [PubMed] [Google Scholar]
  • 315.Mekalanos JJ, Collier RJ, Romig WR. Enzymic activity of cholera toxin. II. Relationships to proteolytic processing, disulfide bond reduction, and subunit composition. J Biol Chem. 1979;254:5855–5861. [PubMed] [Google Scholar]
  • 316.Gonzales L, Ali ZB, Nygren E, Wang Z, Karlsson S, Zhu B, Quiding-Järbrink M, Sjöling Å. Alkaline pH Is a signal for optimal production and secretion of the heat labile toxin, LT in enterotoxigenic Escherichia coli (ETEC) PLoS One. 2013;8:e74069. doi: 10.1371/journal.pone.0074069. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 317.Pande AH, Scaglione P, Taylor M, Nemec KN, Tuthill S, Moe D, Holmes RK, Tatulian SA, Teter K. Conformational instability of the cholera toxin A1 polypeptide. J Mol Biol. 2007;374:1114–1128. doi: 10.1016/j.jmb.2007.10.025. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 318.Merritt EA, Pronk SE, Sixma TK, Kalk KH, van Zanten BA, Hol WG. Structure of partially-activated E. coli heat-labile enterotoxin (LT) at 2.6 A resolution. FEBS Lett. 1994;337:88–92. doi: 10.1016/0014-5793(94)80635-7. [DOI] [PubMed] [Google Scholar]
  • 319.Sixma TK, Stein PE, Hol WG, Read RJ. Comparison of the B-pentamers of heat-labile enterotoxin and verotoxin-1: two structures with remarkable similarity and dissimilarity. Biochemistry. 1993;32:191–198. doi: 10.1021/bi00052a025. [DOI] [PubMed] [Google Scholar]
  • 320.Clements JD, Finkelstein RA. Isolation and characterization of homogeneous heat-labile enterotoxins with high specific activity from Escherichia coli cultures. Infect Immun. 1979;24:760–769. doi: 10.1128/iai.24.3.760-769.1979. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 321.Heggelund JE, Haugen E, Lygren B, Mackenzie A, Holmner Å, Vasile F, Reina JJ, Bernardi A, Krengel U. Both El Tor and classical cholera toxin bind blood group determinants. Biochem Biophys Res Commun. 2012;418:731–735. doi: 10.1016/j.bbrc.2012.01.089. [DOI] [PubMed] [Google Scholar]
  • 322.Mandal PK, Branson TR, Hayes ED, Ross JF, Gavín JA, Daranas AH, Turnbull WB. Towards a structural basis for the relationship between blood group and the severity of El Tor cholera. Angew Chem Int Ed Engl. 2012;51:5143–5146. doi: 10.1002/anie.201109068. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 323.Vasile F, Reina JJ, Potenza D, Heggelund JE, Mackenzie A, Krengel U, Bernardi A. Comprehensive analysis of blood group antigen binding to classical and El Tor cholera toxin B-pentamers by NMR. Glycobiology. 2014;24:766–778. doi: 10.1093/glycob/cwu040. [DOI] [PubMed] [Google Scholar]
  • 324.Guidry JJ, Cárdenas L, Cheng E, Clements JD. Role of receptor binding in toxicity, immunogenicity, and adjuvanticity of Escherichia coli heat-labile enterotoxin. Infect Immun. 1997;65:4943–4950. doi: 10.1128/iai.65.12.4943-4950.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 325.Sonnino S, Mauri L, Chigorno V, Prinetti A. Gangliosides as components of lipid membrane domains. Glycobiology. 2007;17:1R–13R. doi: 10.1093/glycob/cwl052. [DOI] [PubMed] [Google Scholar]
  • 326.Ahmed T, Lundgren A, Arifuzzaman M, Qadri F, Teneberg S, Svennerholm AM. Children with the Le(a+b−) blood group have increased susceptibility to diarrhea caused by enterotoxigenic Escherichia coli expressing colonization factor I group fimbriae. Infect Immun. 2009;77:2059–2064. doi: 10.1128/IAI.01571-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 327.Horstman AL, Kuehn MJ. Bacterial surface association of heat-labile enterotoxin through lipopolysaccharide after secretion via the general secretory pathway. J Biol Chem. 2002;277:32538–32545. doi: 10.1074/jbc.M203740200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 328.Horstman AL, Kuehn MJ. Enterotoxigenic Escherichia coli secretes active heat-labile enterotoxin via outer membrane vesicles. J Biol Chem. 2000;275:12489–12496. doi: 10.1074/jbc.275.17.12489. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 329.Raetz CR, Whitfield C. Lipopolysaccharide endotoxins. Annu Rev Biochem. 2002;71:635–700. doi: 10.1146/annurev.biochem.71.110601.135414. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 330.Kesty NC, Kuehn MJ. Incorporation of heterologous outer membrane and periplasmic proteins into Escherichia coli outer membrane vesicles. J Biol Chem. 2004;279:2069–2076. doi: 10.1074/jbc.M307628200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 331.Kesty NC, Mason KM, Reedy M, Miller SE, Kuehn MJ. Enterotoxigenic Escherichia coli vesicles target toxin delivery into mammalian cells. EMBO J. 2004;23:4538–4549. doi: 10.1038/sj.emboj.7600471. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 332.Horstman AL, Bauman SJ, Kuehn MJ. Lipopolysaccharide 3-deoxy-D-manno-octulosonic acid (Kdo) core determines bacterial association of secreted toxins. J Biol Chem. 2004;279:8070–8075. doi: 10.1074/jbc.M308633200. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 333.Bonnington KE, Kuehn MJ. Protein selection and export via outer membrane vesicles. Biochim Biophys Acta. 2014;1843:1612–1619. doi: 10.1016/j.bbamcr.2013.12.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 334.Kuehn MJ, Kesty NC. Bacterial outer membrane vesicles and the host-pathogen interaction. Genes Dev. 2005;19:2645–2655. doi: 10.1101/gad.1299905. [DOI] [PubMed] [Google Scholar]
  • 335.Chatterjee D, Chaudhuri K. Association of cholera toxin with Vibrio cholerae outer membrane vesicles which are internalized by human intestinal epithelial cells. FEBS Lett. 2011;585:1357–1362. doi: 10.1016/j.febslet.2011.04.017. [DOI] [PubMed] [Google Scholar]
  • 336.Schlör S, Riedl S, Blass J, Reidl J. Genetic rearrangements of the regions adjacent to genes encoding heat-labile enterotoxins (eltAB) of enterotoxigenic Escherichia coli strains. Appl Environ Microbiol. 2000;66:352–358. doi: 10.1128/aem.66.1.352-358.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 337.Yamamoto T, Gojobori T, Yokota T. Evolutionary origin of pathogenic determinants in enterotoxigenic Escherichia coli and Vibrio cholerae O1. J Bacteriol. 1987;169:1352–1357. doi: 10.1128/jb.169.3.1352-1357.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 338.Yang J, Tauschek M, Strugnell R, Robins-Browne RM. The H-NS protein represses transcription of the eltAB operon, which encodes heat-labile enterotoxin in enterotoxigenic Escherichia coli, by binding to regions downstream of the promoter. Microbiology. 2005;151:1199–1208. doi: 10.1099/mic.0.27734-0. [DOI] [PubMed] [Google Scholar]
  • 339.Takashi K, Fujita I, Kobari K. Effects of short chain fatty acids on the production of heat-labile enterotoxin from enterotoxigenic Escherichia coli. Jpn J Pharmacol. 1989;50:495–498. doi: 10.1254/jjp.50.495. [DOI] [PubMed] [Google Scholar]
  • 340.Wülfing C, Rappuoli R. Efficient production of heat-labile enterotoxin mutant proteins by overexpression of dsbA in a degP-deficient Escherichia coli strain. Arch Microbiol. 1997;167:280–283. doi: 10.1007/s002030050444. [DOI] [PubMed] [Google Scholar]
  • 341.Streatfield SJ, Sandkvist M, Sixma TK, Bagdasarian M, Hol WG, Hirst TR. Intermolecular interactions between the A and B subunits of heat-labile enterotoxin from Escherichia coli promote holotoxin assembly and stability in vivo. Proc Natl Acad Sci USA. 1992;89:12140–12144. doi: 10.1073/pnas.89.24.12140. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 342.Chung WY, Carter R, Hardy T, Sack M, Hirst TR, James RF. Inhibition of Escherichia coli heat-labile enterotoxin B subunit pentamer (EtxB5) assembly in vitro using monoclonal antibodies. J Biol Chem. 2006;281:39465–39470. doi: 10.1074/jbc.M606038200. [DOI] [PubMed] [Google Scholar]
  • 343.Grant CC, Messer RJ, Cieplak W., Jr Role of trypsin-like cleavage at arginine 192 in the enzymatic and cytotonic activities of Escherichia coli heat-labile enterotoxin. Infect Immun. 1994;62:4270–4278. doi: 10.1128/iai.62.10.4270-4278.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 344.Tauschek M, Gorrell RJ, Strugnell RA, Robins-Browne RM. Identification of a protein secretory pathway for the secretion of heat-labile enterotoxin by an enterotoxigenic strain of Escherichia coli. Proc Natl Acad Sci USA. 2002;99:7066–7071. doi: 10.1073/pnas.092152899. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 345.Johnson TL, Abendroth J, Hol WG, Sandkvist M. Type II secretion: from structure to function. FEMS Microbiol Lett. 2006;255:175–186. doi: 10.1111/j.1574-6968.2006.00102.x. [DOI] [PubMed] [Google Scholar]
  • 346.Yang J, Baldi DL, Tauschek M, Strugnell RA, Robins-Browne RM. Transcriptional regulation of the yghJ-pppA-yghG-gspCDEFGHIJKLM cluster, encoding the type II secretion pathway in enterotoxigenic Escherichia coli. J Bacteriol. 2007;189:142–150. doi: 10.1128/JB.01115-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 347.Hirst TR, Sanchez J, Kaper JB, Hardy SJ, Holmgren J. Mechanism of toxin secretion by Vibrio cholerae investigated in strains harboring plasmids that encode heat-labile enterotoxins of Escherichia coli. Proc Natl Acad Sci USA. 1984;81:7752–7756. doi: 10.1073/pnas.81.24.7752. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 348.Brown EA, Hardwidge PR. Biochemical characterization of the enterotoxigenic Escherichia coli LeoA protein. Microbiology. 2007;153:3776–3784. doi: 10.1099/mic.0.2007/009084-0. [DOI] [PubMed] [Google Scholar]
  • 349.Fleckenstein JM, Lindler LE, Elsinghorst EA, Dale JB. Identification of a gene within a pathogenicity island of enterotoxigenic Escherichia coli H10407 required for maximal secretion of the heat-labile enterotoxin. Infect Immun. 2000;68:2766–2774. doi: 10.1128/iai.68.5.2766-2774.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 350.Michie KA, Boysen A, Low HH, Møller-Jensen J, Löwe J. LeoA, B and C from enterotoxigenic Escherichia coli (ETEC) are bacterial dynamins. PLoS One. 2014;9:e107211. doi: 10.1371/journal.pone.0107211. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 351.Spangler BD. Structure and function of cholera toxin and the related Escherichia coli heat-labile enterotoxin. Microbiol Rev. 1992;56:622–647. doi: 10.1128/mr.56.4.622-647.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 352.Iglesias-Bartolomé R, Trenchi A, Comín R, Moyano AL, Nores GA, Daniotti JL. Differential endocytic trafficking of neuropathy-associated antibodies to GM1 ganglioside and cholera toxin in epithelial and neural cells. Biochim Biophys Acta. 2009;1788:2526–2540. doi: 10.1016/j.bbamem.2009.09.018. [DOI] [PubMed] [Google Scholar]
  • 353.Wernick NL, Chinnapen DJ, Cho JA, Lencer WI. Cholera toxin: an intracellular journey into the cytosol by way of the endoplasmic reticulum. Toxins (Basel) 2010;2:310–325. doi: 10.3390/toxins2030310. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 354.Majoul I, Ferrari D, Söling HD. Reduction of protein disulfide bonds in an oxidizing environment. The disulfide bridge of cholera toxin A-subunit is reduced in the endoplasmic reticulum. FEBS Lett. 1997;401:104–108. doi: 10.1016/s0014-5793(96)01447-0. [DOI] [PubMed] [Google Scholar]
  • 355.O’Neal CJ, Jobling MG, Holmes RK, Hol WG. Structural basis for the activation of cholera toxin by human ARF6-GTP. Science. 2005;309:1093–1096. doi: 10.1126/science.1113398. [DOI] [PubMed] [Google Scholar]
  • 356.Hug MJ, Tamada T, Bridges RJ. CFTR and bicarbonate secretion by [correction of to] epithelial cells. News Physiol Sci. 2003;18:38–42. doi: 10.1152/nips.01412.2002. [DOI] [PubMed] [Google Scholar]
  • 357.Kunzelmann K, Hübner M, Schreiber R, Levy-Holzman R, Garty H, Bleich M, Warth R, Slavik M, von Hahn T, Greger R. Cloning and function of the rat colonic epithelial K+ channel KVLQT1. J Membr Biol. 2001;179:155–164. doi: 10.1007/s002320010045. [DOI] [PubMed] [Google Scholar]
  • 358.Nataro JP, Kaper JB. Diarrheagenic Escherichia coli. Clin Microbiol Rev. 1998;11:142–201. doi: 10.1128/cmr.11.1.142. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 359.Mourad FH, O’Donnell LJ, Dias JA, Ogutu E, Andre EA, Turvill JL, Farthing MJ. Role of 5-hydroxytryptamine type 3 receptors in rat intestinal fluid and electrolyte secretion induced by cholera and Escherichia coli enterotoxins. Gut. 1995;37:340–345. doi: 10.1136/gut.37.3.340. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 360.De Haan L, Hirst TR. Cholera toxin: a paradigm for multi-functional engagement of cellular mechanisms (Review) Mol Membr Biol. 2004;21:77–92. doi: 10.1080/09687680410001663267. [DOI] [PubMed] [Google Scholar]
  • 361.Berkes J, Viswanathan VK, Savkovic SD, Hecht G. Intestinal epithelial responses to enteric pathogens: effects on the tight junction barrier, ion transport, and inflammation. Gut. 2003;52:439–451. doi: 10.1136/gut.52.3.439. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 362.Kreisberg RB, Harper J, Strauman MC, Marohn M, Clements JD, Nataro JP. Induction of increased permeability of polarized enterocyte monolayers by enterotoxigenic Escherichia coli heat-labile enterotoxin. Am J Trop Med Hyg. 2011;84:451–455. doi: 10.4269/ajtmh.2011.10-0445. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 363.Burgess MN, Bywater RJ, Cowley CM, Mullan NA, Newsome PM. Biological evaluation of a methanol-soluble, heat-stable Escherichia coli enterotoxin in infant mice, pigs, rabbits, and calves. Infect Immun. 1978;21:526–531. doi: 10.1128/iai.21.2.526-531.1978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 364.Smith HW, Gyles CL. The effect of cell-free fluids prepared from cultures of human and animal enteropathogenic strains of Escherichia coli on ligated intestinal segments of rabbits and pigs. J Med Microbiol. 1970;3:403–409. doi: 10.1099/00222615-3-3-403. [DOI] [PubMed] [Google Scholar]
  • 365.Nair GB, Takeda Y. The heat-stable enterotoxins. Microb Pathog. 1998;24:123–131. doi: 10.1006/mpat.1997.0177. [DOI] [PubMed] [Google Scholar]
  • 366.Staples SJ, Asher SE, Giannella RA. Purification and characterization of heat-stable enterotoxin produced by a strain of E. coli pathogenic for man. J Biol Chem. 1980;255:4716–4721. [PubMed] [Google Scholar]
  • 367.Weiglmeier PR, Rösch P, Berkner H. Cure and curse: E. coli heat-stable enterotoxin and its receptor guanylyl cyclase C. Toxins (Basel) 2010;2:2213–2229. doi: 10.3390/toxins2092213. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 368.Lima AA, Fonteles MC. From Escherichia coli heat-stable enterotoxin to mammalian endogenous guanylin hormones. Braz J Med Biol Res. 2014;47:179–191. doi: 10.1590/1414-431X20133063. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 369.Okamoto K, Okamoto K, Yukitake J, Kawamoto Y, Miyama A. Substitutions of cysteine residues of Escherichia coli heat-stable enterotoxin by oligonucleotide-directed mutagenesis. Infect Immun. 1987;55:2121–2125. doi: 10.1128/iai.55.9.2121-2125.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 370.Takeda T, Takeda Y, Aimoto S, Takao T, Ikemura H, Shimonishi Y, Miwatani T. Neutralization of activity of two different heat-stable enterotoxins (STh and STp) of enterotoxigenic Escherichia coli by homologous and heterologous antisera. FEMS Microbiol Lett. 1983;20:357–359. [Google Scholar]
  • 371.Dreyfus LA, Frantz JC, Robertson DC. Chemical properties of heat-stable enterotoxins produced by enterotoxigenic Escherichia coli of different host origins. Infect Immun. 1983;42:539–548. doi: 10.1128/iai.42.2.539-548.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 372.Harnett NM, Gyles CL. Enterotoxin plasmids in bovine and porcine enterotoxigenic Escherichia coli of O groups 9, 20, 64 and 101. Can J Comp Med. 1985;49:79–87. [PMC free article] [PubMed] [Google Scholar]
  • 373.So M, McCarthy BJ. Nucleotide sequence of the bacterial transposon Tn1681 encoding a heat-stable (ST) toxin and its identification in enterotoxigenic Escherichia coli strains. Proc Natl Acad Sci USA. 1980;77:4011–4015. doi: 10.1073/pnas.77.7.4011. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 374.Sekizaki T, Akashi H, Terakado N. Nucleotide sequences of the genes for Escherichia coli heat-stable enterotoxin I of bovine, avian, and porcine origins. Am J Vet Res. 1985;46:909–912. [PubMed] [Google Scholar]
  • 375.Alderete JF, Robertson DC. Repression of heat-stable enterotoxin synthesis in enterotoxigenic Escherichia coli. Infect Immun. 1977b;17:629–633. doi: 10.1128/iai.17.3.629-633.1977. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 376.Stieglitz H, Cervantes L, Robledo R, Fonseca R, Covarrubias L, Bolivar F, Kupersztoch YM. Cloni ng, sequencing, and expression in Ficoll-generated minicells of an Escherichia coli heat-stable enterotoxin gene. Plasmid. 1988;20:42–53. doi: 10.1016/0147-619x(88)90006-6. [DOI] [PubMed] [Google Scholar]
  • 377.Okamoto K, Takahara M. Synthesis of Escherichia coli heat-stable enterotoxin STp as a pre-pro form and role of the pro sequence in secretion. J Bacteriol. 1990;172:5260–5265. doi: 10.1128/jb.172.9.5260-5265.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 378.Rasheed JK, Guzmán-Verduzco LM, Kupersztoch YM. Two precursors of the heat-stable enterotoxin of Escherichia coli: evidence of extracellular processing. Mol Microbiol. 1990;4:265–273. doi: 10.1111/j.1365-2958.1990.tb00593.x. [DOI] [PubMed] [Google Scholar]
  • 379.Yamanaka H, Fuke Y, Hitotsubashi S, Fujii Y, Okamoto K. Functional properties of pro region of Escherichia coli heat-stable enterotoxin. Microbiol Immunol. 1993;37:195–205. doi: 10.1111/j.1348-0421.1993.tb03200.x. [DOI] [PubMed] [Google Scholar]
  • 380.Sommerfelt H, Haukanes BI, Kalland KH, Svennerholm AM, Sanchéz J, Bjorvatn B. Mechanism of spontaneous loss of heat-stable toxin (STa) production in enterotoxigenic Escherichia coli. APMIS. 1989;97:436–440. doi: 10.1111/j.1699-0463.1989.tb00812.x. [DOI] [PubMed] [Google Scholar]
  • 381.Okamoto K, Baba T, Yamanaka H, Akashi N, Fujii Y. Disulfide bond formation and secretion of Escherichia coli heat-stable enterotoxin II. J Bacteriol. 1995;177:4579–4586. doi: 10.1128/jb.177.16.4579-4586.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 382.Sanchez J, Solorzano RM, Holmgren J. Extracellular secretion of STa heat-stable enterotoxin by Escherichia coli after fusion to a heterologous leader peptide. FEBS Lett. 1993;330:265–269. doi: 10.1016/0014-5793(93)80885-x. [DOI] [PubMed] [Google Scholar]
  • 383.Yang Y, Gao Z, Guzmán-Verduzco LM, Tachias K, Kupersztoch YM. Secretion of the STA3 heat-stable enterotoxin of Escherichia coli: extracellular delivery of Pro-STA is accomplished by either Pro or STA. Mol Microbiol. 1992;6:3521–3529. doi: 10.1111/j.1365-2958.1992.tb01787.x. [DOI] [PubMed] [Google Scholar]
  • 384.Yamanaka H, Kameyama M, Baba T, Fujii Y, Okamoto K. Maturation pathway of Escherichia coli heat-stable enterotoxin I: requirement of DsbA for disulfide bond formation. J Bacteriol. 1994;176:2906–2913. doi: 10.1128/jb.176.10.2906-2913.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 385.Yamanaka H, Nomura T, Fujii Y, Okamoto K. Need for TolC, an Escherichia coli outer membrane protein, in the secretion of heat-stable enterotoxin I across the outer membrane. Microb Pathog. 1998a;25:111–120. doi: 10.1006/mpat.1998.0211. [DOI] [PubMed] [Google Scholar]
  • 386.Yamanaka H, Nomura T, Fujii Y, Okamoto K. Extracellular secretion of Escherichia coli heat-stable enterotoxin I across the outer membrane. J Bacteriol. 1997;179:3383–3390. doi: 10.1128/jb.179.11.3383-3390.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 387.Yamasaki S, Hidaka Y, Ito H, Takeda Y, Shimonishi Y. Structure requirements for the spatial structure and toxicity of heat-stable enterotoxin (STh) of enterotoxigenic Escherichia coli. Bull Chem Soc Jpn. 1988;61:1701–1706. [Google Scholar]
  • 388.Hidaka Y, Ohmori K, Wada A, Ozaki H, Ito H, Hirayama T, Takeda Y, Shimonishi Y. Synthesis and biological properties of carba-analogs of heat-stable enterotoxin (ST) produced by enterotoxigenic Escherichia coli. Biochem Biophys Res Commun. 1991;176:958–965. doi: 10.1016/0006-291x(91)90375-h. [DOI] [PubMed] [Google Scholar]
  • 389.Ozaki H, Sato T, Kubota H, Hata Y, Katsube Y, Shimonishi Y. Molecular structure of the toxin domain of heat-stable enterotoxin produced by a pathogenic strain of Escherichia coli. A putative binding site for a binding protein on rat intestinal epithelial cell membranes. J Biol Chem. 1991;266:5934–5941. [PubMed] [Google Scholar]
  • 390.Gariépy J, Judd AK, Schoolnik GK. Importance of disulfide bridges in the structure and activity of Escherichia coli enterotoxin ST1b. Proc Natl Acad Sci USA. 1987;84:8907–8911. doi: 10.1073/pnas.84.24.8907. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 391.Gariépy J, Lane A, Frayman F, Wilbur D, Robien W, Schoolnik GK, Jardetzky O. Structure of the toxic domain of the Escherichia coli heat-stable enterotoxin ST I. Biochemistry. 1986;25:7854–7866. doi: 10.1021/bi00372a011. [DOI] [PubMed] [Google Scholar]
  • 392.Carpick BW, Gariépy J. Structural characterization of functionally important regions of the Escherichia coli heat-stable enterotoxin STIb. Biochemistry. 1991;30:4803–4809. doi: 10.1021/bi00233a023. [DOI] [PubMed] [Google Scholar]
  • 393.Waldman SA, O’Hanley P. Influence of a glycine or proline substitution on the functional properties of a 14-amino-acid analog of Escherichia coli heat-stable enterotoxin. Infect Immun. 1989;57:2420–2424. doi: 10.1128/iai.57.8.2420-2424.1989. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 394.Yoshimura S, Ikemura H, Watanabe H, Aimoto S, Shimonishi Y, Hara S, Takeda T, Miwatani T, Takeda Y. Essential structure for full enterotoxigenic activity of heat-stable enterotoxin produced by enterotoxigenic Escherichia coli. FEBS Lett. 1985;181:138–142. doi: 10.1016/0014-5793(85)81129-7. [DOI] [PubMed] [Google Scholar]
  • 395.Arshad N, Visweswariah SS. The multiple and enigmatic roles of guanylyl cyclase C in intestinal homeostasis. FEBS Lett. 2012;586:2835–2840. doi: 10.1016/j.febslet.2012.07.028. [DOI] [PubMed] [Google Scholar]
  • 396.Hasegawa M, Shimonishi Y. Recognition and signal transduction mechanism of Escherichia coli heat-stable enterotoxin and its receptor, guanylate cyclase C. J Pept Res. 2005;65:261–271. doi: 10.1111/j.1399-3011.2005.00218.x. [DOI] [PubMed] [Google Scholar]
  • 397.Steinbrecher KA. The multiple roles of guanylate cyclase C, a heat stable enterotoxin receptor. Curr Opin Gastroenterol. 2014;30:1–6. doi: 10.1097/MOG.0000000000000020. [DOI] [PubMed] [Google Scholar]
  • 398.Carpick BW, Gariépy J. The Escherichia coli heat-stable enterotoxin is a long-lived superagonist of guanylin. Infect Immun. 1993;61:4710–4715. doi: 10.1128/iai.61.11.4710-4715.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 399.Forte LR, Eber SL, Turner JT, Freeman RH, Fok KF, Currie MG. Guanylin stimulation of Cl− secretion in human intestinal T84 cells via cyclic guanosine monophosphate. J Clin Invest. 1993;91:2423–2428. doi: 10.1172/JCI116476. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 400.Krause WJ, Cullingford GL, Freeman RH, Eber SL, Richardson KC, Fok KF, Currie MG, Forte LR. Distribution of heat-stable enterotoxin/guanylin receptors in the intestinal tract of man and other mammals. J Anat. 1994;184:407–417. [PMC free article] [PubMed] [Google Scholar]
  • 401.Cohen MB, Mann EA, Lau C, Henning SJ, Giannella RA. A gradient in expression of the Escherichia coli heat-stable enterotoxin receptor exists along the villus-to-crypt axis of rat small intestine. Biochem Biophys Res Commun. 1992;186:483–490. doi: 10.1016/s0006-291x(05)80833-2. [DOI] [PubMed] [Google Scholar]
  • 402.Sellers ZM, Mann E, Smith A, Ko KH, Giannella R, Cohen MB, Barrett KE, Dong H. Heat-stable enterotoxin of Escherichia coli (STa) can stimulate duodenal HCO3(−) secretion via a novel GC-C- and CFTR-independent pathway. FASEB J. 2008;22:1306–1316. doi: 10.1096/fj.06-7540com. [DOI] [PubMed] [Google Scholar]
  • 403.Hitotsubashi S, Fujii Y, Yamanaka H, Okamoto K. Some properties of purified Escherichia coli heat-stable enterotoxin II. Infect Immun. 1992b;60:4468–4474. doi: 10.1128/iai.60.11.4468-4474.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 404.Akabas MH. Cystic fibrosis transmembrane conductance regulator. Structure and function of an epithelial chloride channel. J Biol Chem. 2000;275:3729–3732. doi: 10.1074/jbc.275.6.3729. [DOI] [PubMed] [Google Scholar]
  • 405.Guttman JA, Finlay BB. Tight junctions as targets of infectious agents. Biochim Biophys Acta. 2009;1788:832–841. doi: 10.1016/j.bbamem.2008.10.028. [DOI] [PubMed] [Google Scholar]
  • 406.Suzuki T. Regulation of intestinal epithelial permeability by tight junctions. Cell Mol Life Sci. 2013;70:631–659. doi: 10.1007/s00018-012-1070-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 407.Nakashima R, Kamata Y, Nishikawa Y. Effects of Escherichia coli heat-stable enterotoxin and guanylin on the barrier integrity of intestinal epithelial T84 cells. Vet Immunol Immunopathol. 2013;152:78–81. doi: 10.1016/j.vetimm.2012.09.026. [DOI] [PubMed] [Google Scholar]
  • 408.Levine MM, Prado V, Robins-Browne R, Lior H, Kaper JB, Moseley SL, Gicquelais K, Nataro JP, Vial P, Tall B. Use of DNA probes and HEp-2 cell adherence assay to detect diarrheagenic Escherichia coli. J Infect Dis. 1988;158:224–228. doi: 10.1093/infdis/158.1.224. [DOI] [PubMed] [Google Scholar]
  • 409.Paiva de Sousa C, Dubreuil JD. Distribution and expression of the astA gene (EAST1 toxin) in Escherichia coli and Salmonella. Int J Med Microbiol. 2001;291:15–20. doi: 10.1078/1438-4221-00097. [DOI] [PubMed] [Google Scholar]
  • 410.Savarino SJ, McVeigh A, Watson J, Cravioto A, Molina J, Echeverria P, Bhan MK, Levine MM, Fasano A. Enteroaggregative Escherichia coli heat-stable enterotoxin is not restricted to enteroaggregative E. coli. J Infect Dis. 1996;173:1019–1022. doi: 10.1093/infdis/173.4.1019. [DOI] [PubMed] [Google Scholar]
  • 411.Osek J. Detection of the enteroaggregative Escherichia coli heat-stable enterotoxin 1 (EAST1) gene and its relationship with fimbrial and enterotoxin markers in E. coli isolates from pigs with diarrhoea. Vet Microbiol. 2003;91:65–72. doi: 10.1016/s0378-1135(02)00262-6. [DOI] [PubMed] [Google Scholar]
  • 412.Noamani BN, Fairbrother JM, Gyles CL. Virulence genes of O149 enterotoxigenic Escherichia coli from outbreaks of postweaning diarrhea in pigs. Vet Microbiol. 2003;97:87–101. doi: 10.1016/j.vetmic.2003.08.006. [DOI] [PubMed] [Google Scholar]
  • 413.Frydendahl K. Prevalence of serogroups and virulence genes in Escherichia coli associated with postweaning diarrhoea and edema disease in pigs and a comparison of diagnostic approaches. Vet Microbiol. 2002;85:169–182. doi: 10.1016/s0378-1135(01)00504-1. [DOI] [PubMed] [Google Scholar]
  • 414.Liu W, Yuan C, Meng X, Du Y, Gao R, Tang J, Shi D. Frequency of virulence factors in Escherichia coli isolated from suckling pigs with diarrhoea in China. Vet J. 2014;199:286–289. doi: 10.1016/j.tvjl.2013.11.019. [DOI] [PubMed] [Google Scholar]
  • 415.Toledo A, Gómez D, Cruz C, Carreón R, López J, Giono S, Castro AM. Prevalence of virulence genes in Escherichia coli strains isolated from piglets in the suckling and weaning period in Mexico. J Med Microbiol. 2012;61:148–156. doi: 10.1099/jmm.0.031302-0. [DOI] [PubMed] [Google Scholar]
  • 416.Zajacova ZS, Konstantinova L, Alexa P. Detection of virulence factors of Escherichia coli focused on prevalence of EAST1 toxin in stool of diarrheic and non-diarrheic piglets and presence of adhesion involving virulence factors in astA positive strains. Vet Microbiol. 2012;154:369–375. doi: 10.1016/j.vetmic.2011.07.029. [DOI] [PubMed] [Google Scholar]
  • 417.Tzipori S, Montanaro J, Robins-Browne RM, Vial P, Gibson R, Levine MM. Studies with enteroaggregative Escherichia coli in the gnotobiotic piglet gastroenteritis model. Infect Immun. 1992;60:5302–5306. doi: 10.1128/iai.60.12.5302-5306.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 418.Yamamoto T, Echeverria P. Detection of the enteroaggregative Escherichia coli heat-stable enterotoxin 1 gene sequences in enterotoxigenic E. coli strains pathogenic for humans. Infect Immun. 1996;64:1441–1445. doi: 10.1128/iai.64.4.1441-1445.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 419.Bertin Y, Martin C, Girardeau JP, Pohl P, Contrepois M. Association of genes encoding P fimbriae, CS31A antigen and EAST 1 toxin among CNF1-producing Escherichia coli strains from cattle with septicemia and diarrhea. FEMS Microbiol Lett. 1998;162:235–239. doi: 10.1111/j.1574-6968.1998.tb13004.x. [DOI] [PubMed] [Google Scholar]
  • 420.Choi C, Cho W, Chung H, Jung T, Kim J, Chae C. Prevalence of the enteroaggregative Escherichia coli heat-stable enterotoxin 1 (EAST1) gene in isolates in weaned pigs with diarrhea and/or edema disease. Vet Microbiol. 2001a;81:65–71. doi: 10.1016/s0378-1135(01)00332-7. [DOI] [PubMed] [Google Scholar]
  • 421.Choi C, Kwon D, Chae C. Prevalence of the enteroaggregative Escherichia coli heat-stable enterotoxin 1 gene and its relationship with fimbrial and enterotoxin genes in E. coli isolated from diarrheic piglets. J Vet Diagn Invest. 2001b;13:26–29. doi: 10.1177/104063870101300106. [DOI] [PubMed] [Google Scholar]
  • 422.Ménard LP, Lussier JG, Lépine F, Paiva de Sousa C, Dubreuil JD. Expression, purification, and biochemical characterization of enteroaggregative Escherichia coli heat-stable enterotoxin 1. Protein Expr Purif. 2004;33:223–231. doi: 10.1016/j.pep.2003.09.008. [DOI] [PubMed] [Google Scholar]
  • 423.Savarino SJ, Fasano A, Watson J, Martin BM, Levine MM, Guandalini S, Guerry P. Enteroaggrega tive Escherichia coli heat-stable enterotoxin 1 represents another subfamily of E. coli heat-stable toxin. Proc Natl Acad Sci USA. 1993;90:3093–3097. doi: 10.1073/pnas.90.7.3093. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 424.Nataro JP, Deng Y, Cookson S, Cravioto A, Savarino SJ, Guers LD, Levine MM, Tacket CO. Heter ogeneity of enteroaggregative Escherichia coli virulence demonstrated in volunteers. J Infect Dis. 1995;171:465–468. doi: 10.1093/infdis/171.2.465. [DOI] [PubMed] [Google Scholar]
  • 425.Yamamoto T, Wakisaka N, Sato F, Kato A. Comparison of the nucleotide sequence of enteroaggregative Escherichia coli heat-stable enterotoxin 1 genes among diarrhea-associated Escherichia coli. FEMS Microbiol Lett. 1997b;147:89–95. doi: 10.1111/j.1574-6968.1997.tb10225.x. [DOI] [PubMed] [Google Scholar]
  • 426.Lai XH, Wang SY, Uhlin BE. Expression of cytotoxicity by potential pathogens in the standard Escherichia coli collection of reference (ECOR) strains. Microbiology. 1999;145:3295–3303. doi: 10.1099/00221287-145-11-3295. [DOI] [PubMed] [Google Scholar]
  • 427.Veilleux S, Dubreuil JD. Presence of Escherichia coli carrying the EAST1 toxin gene in farm animals. Vet Res. 2006;37:3–13. doi: 10.1051/vetres:2005045. [DOI] [PubMed] [Google Scholar]
  • 428.McVeigh A, Fasano A, Scott DA, Jelacic S, Moseley SL, Robertson DC, Savarino SJ. IS1414, an Escherichia coli insertion sequence with a heat-stable enterotoxin gene embedded in a transposase-like gene. Infect Immun. 2000;68:5710–5715. doi: 10.1128/iai.68.10.5710-5715.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 429.Yamamoto T, Nakazawa M. Detection and sequences of the enteroaggregative Escherichia coli heat-stable enterotoxin 1 gene in enterotoxigenic E. coli strains isolated from piglets and calves with diarrhea. J Clin Microbiol. 1997;35:223–227. doi: 10.1128/jcm.35.1.223-227.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 430.Ruan X, Crupper SS, Schultz BD, Robertson DC, Zhang W. Escherichia coli expressing EAST1 toxin did not cause an increase of cAMP or cGMP levels in cells, and no diarrhea in 5-day old gnotobiotic pigs. PLoS One. 2012;7:e43203. doi: 10.1371/journal.pone.0043203. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 431.Zajacova ZS, Faldyna M, Kulich P, Kummer V, Maskova J, Alexa P. Experimental infection of gnotobiotic piglets with Escherichia coli strains positive for EAST1 and AIDA. Vet Immunol Immunopathol. 2013;152:176–182. doi: 10.1016/j.vetimm.2012.09.011. [DOI] [PubMed] [Google Scholar]
  • 432.Lortie LA, Dubreuil JD, Harel J. Characterization of Escherichia coli strains producing heat-stable enterotoxin b (STb) isolated from humans with diarrhea. J Clin Microbiol. 1991;29:656–659. doi: 10.1128/jcm.29.3.656-659.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 433.Handl CE, Flock JI. STb producing Escherichia coli are rarely associated with infantile diarrhoea. J Diarrhoeal Dis Res. 1992;10:37–38. [PubMed] [Google Scholar]
  • 434.Whipp SC, Moon HW, Argenzio RA. Comparison of enterotoxic activities of heat-stable enterotoxins from class 1 and class 2 Escherichia coli of swine origin. Infect Immun. 1981;31:245–251. doi: 10.1128/iai.31.1.245-251.1981. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 435.Loos M, Geens M, Schauvliege S, Gasthuys F, van der Meulen J, Dubreuil JD, Goddeeris BM, Niewold T, Cox E. Role of heat-stable enterotoxins in the induction of early immune responses in piglets after infection with enterotoxigenic Escherichia coli. PLoS One. 2012;7:e41041. doi: 10.1371/journal.pone.0041041. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 436.Spitzer F, Vahjen W, Pieper R, Martinez-Vallespin B, Zentek J. A standardised challenge model with an enterotoxigenic F4+ Escherichia coli strain in piglets assessing clinical traits and faecal shedding of fae and est-II toxin genes. Arch Anim Nutr. 2014;68:448–459. doi: 10.1080/1745039X.2014.968701. [DOI] [PubMed] [Google Scholar]
  • 437.Dubreuil JD. Escherichia coli STb enterotoxin. Microbiology. 1997;143:1783–1795. doi: 10.1099/00221287-143-6-1783. [DOI] [PubMed] [Google Scholar]
  • 438.Lee CH, Moseley SL, Moon HW, Whipp SC, Gyles CL, So M. Characterization of the gene encoding heat-stable toxin II and preliminary molecular epidemiological studies of enterotoxigenic Escherichia coli heat-stable toxin II producers. Infect Immun. 1983;42:264–268. doi: 10.1128/iai.42.1.264-268.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 439.Picken RN, Mazaitis AJ, Maas WK, Rey M, Heyneker H. Nucleotide sequence of the gene for heat-stable enterotoxin II of Escherichia coli. Infect Immun. 1983;42:269–275. doi: 10.1128/iai.42.1.269-275.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 440.Sukumar M, Rizo J, Wall M, Dreyfus LA, Kupersztoch YM, Gierasch LM. The structure of Escherichia coli heat-stable enterotoxin b by nuclear magnetic resonance and circular dichroism. Protein Sci. 1995;4:1718–1729. doi: 10.1002/pro.5560040907. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 441.Taillon C, Nadeau E, Mourez M, Dubreuil JD. Heterogeneity of Escherichia coli STb enterotoxin isolated from diseased pigs. J Med Microbiol. 2008;57:887–890. doi: 10.1099/jmm.0.2008/000281-0. [DOI] [PubMed] [Google Scholar]
  • 442.Taillon C, Hancock MA, Mourez M, Dubreuil JD. Biochemical and biological characterization of Escherichia coli STb His12 to Asn variant. Toxicon. 2012;59:300–305. doi: 10.1016/j.toxicon.2011.11.015. [DOI] [PubMed] [Google Scholar]
  • 443.Handl CE, Harel J, Flock JI, Dubreuil JD. High yield of active STb enterotoxin from a fusion protein (MBP-STb) expressed in Escherichia coli. Protein Expr Purif. 1993;4:275–281. doi: 10.1006/prep.1993.1035. [DOI] [PubMed] [Google Scholar]
  • 444.Dubreuil JD, Fairbrother JM, Lallier R, Larivière S. Production and purification of heat-stable enterotoxin b from a porcine Escherichia coli strain. Infect Immun. 1991;59:198–203. doi: 10.1128/iai.59.1.198-203.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 445.Fujii Y, Hayashi M, Hitotsubashi S, Fuke Y, Yamanaka H, Okamoto K. Purification and characterization of Escherichia coli heat-stable enterotoxin II. J Bacteriol. 1991;173:5516–5522. doi: 10.1128/jb.173.17.5516-5522.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 446.Whipp SC. Protease degradation of Escherichia coli heat-stable, mouse-negative, pig-positive enterotoxin. Infect Immun. 1987;55:2057–2060. doi: 10.1128/iai.55.9.2057-2060.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 447.Whipp SC. Intestinal responses to enterotoxigenic Escherichia coli heat-stable toxin b in non-porcine species. Am J Vet Res. 1991;52:734–737. [PubMed] [Google Scholar]
  • 448.Dubreuil JD, Letellier A, Harel J. A recombinant Escherichia coli heat-stable enterotoxin b (STb) fusion protein eliciting neutralizing antibodies. FEMS Immunol Med Microbiol. 1996;13:317–323. doi: 10.1111/j.1574-695X.1996.tb00257.x. [DOI] [PubMed] [Google Scholar]
  • 449.You J, Xu Y, He M, McAllister TA, Thacker PA, Li X, Wang T, Jin L. Protection of mice against enterotoxigenic E. coli by immunization with a polyvalent enterotoxin comprising a combination of LTB, STa, and STb. Appl Microbiol Biotechnol. 2011;89:1885–1893. doi: 10.1007/s00253-010-2991-7. [DOI] [PubMed] [Google Scholar]
  • 450.Zhang W, Francis DH. Genetic fusions of heat-labile toxoid (LT) and heat-stable toxin b (STb) of porcine enterotoxigenic Escherichia coli elicit protective anti-LT and anti-STb antibodies. Clin Vaccine Immunol. 2010;17:1223–1231. doi: 10.1128/CVI.00095-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 451.Zhang W, Zhang C, Francis DH, Fang Y, Knudsen D, Nataro JP, Robertson DC. Genetic fusions of heat-labile (LT) and heat-stable (ST) toxoids of porcine enterotoxigenic Escherichia coli elicit neutralizing anti-LT and anti-STa antibodies. Infect Immun. 2010;78:316–325. doi: 10.1128/IAI.00497-09. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 452.Hitotsubashi S, Akagi M, Saitou A, Yamanaka H, Fujii Y, Okamoto K. Action of Escherichia coli heat-stable enterotoxin II on isolated sections of mouse ileum. FEMS Microbiol Lett. 1992a;69:249–252. doi: 10.1016/0378-1097(92)90655-8. [DOI] [PubMed] [Google Scholar]
  • 453.Echeverria P, Seriwatana J, Taylor DN, Tirapat C, Rowe B. Escherichia coli contains plasmids coding for heat-stable b, other enterotoxins, and antibiotic resistance. Infect Immun. 1985;48:843–846. doi: 10.1128/iai.48.3.843-846.1985. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 454.Hu ST, Lee CH. Characterization of the transposon carrying the STII gene of enterotoxigenic Escherichia coli. Mol Gen Genet. 1988;214:490–495. doi: 10.1007/BF00330485. [DOI] [PubMed] [Google Scholar]
  • 455.Hu ST, Yang MK, Spandau DF, Lee CH. Characterization of the terminal sequences flanking the transposon that carries the Escherichia coli enterotoxin STII gene. Gene. 1987;55:157–167. doi: 10.1016/0378-1119(87)90276-9. [DOI] [PubMed] [Google Scholar]
  • 456.Lee CH, Hu ST, Swiatek PJ, Moseley SL, Allen SD, So M. Isolation of a novel transposon which carries the Escherichia coli enterotoxin STII gene. J Bacteriol. 1985;162:615–620. doi: 10.1128/jb.162.2.615-620.1985. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 457.Spandau DF, Lee CH. Determination of the promoter strength of the gene encoding Escherichia coli heat-stable enterotoxin II. J Bacteriol. 1987;169:1740–1744. doi: 10.1128/jb.169.4.1740-1744.1987. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 458.Erume J, Berberov EM, Moxley RA. Comparison of the effects of different nutrient media on production of heat-stable enterotoxin-b by Escherichia coli. Vet Microbiol. 2010;144:160–165. doi: 10.1016/j.vetmic.2009.12.043. [DOI] [PubMed] [Google Scholar]
  • 459.Busque P, Letellier A, Harel J, Dubreuil JD. Production of Escherichia coli STb enterotoxin is subject to catabolite repression. Microbiology. 1995;141:1621–1627. doi: 10.1099/13500872-141-7-1621. [DOI] [PubMed] [Google Scholar]
  • 460.Kupersztoch YM, Tachias K, Moomaw CR, Dreyfus LA, Urban R, Slaughter C, Whipp S. Secretio n of methanol-insoluble heat-stable enterotoxin (STB): energy- and secA-dependent conversion of pre-STB to an intermediate indistinguishable from the extracellular toxin. J Bacteriol. 1990;172:2427–2432. doi: 10.1128/jb.172.5.2427-2432.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 461.Foreman DT, Martinez Y, Coombs G, Torres A, Kupersztoch YM. TolC and DsbA are needed for the secretion of STB, a heat-stable enterotoxin of Escherichia coli. Mol Microbiol. 1995;18:237–245. doi: 10.1111/j.1365-2958.1995.mmi_18020237.x. [DOI] [PubMed] [Google Scholar]
  • 462.Arriaga YL, Harville BA, Dreyfus LA. Contribution of individual disulfide bonds to biological action of Escherichia coli heat-stable enterotoxin B. Infect Immun. 1995;63:4715–4720. doi: 10.1128/iai.63.12.4715-4720.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 463.Kobayashi N, Nishino K, Yamaguchi A. Novel macrolide-specific ABC-type efflux transporter in Escherichia coli. J Bacteriol. 2001;183:5639–5644. doi: 10.1128/JB.183.19.5639-5644.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 464.Kobayashi N, Nishino K, Hirata T, Yamaguchi A. Membrane topology of ABC-type macrolide antibiotic exporter MacB in Escherichia coli. FEBS Lett. 2003;546:241–246. doi: 10.1016/s0014-5793(03)00579-9. [DOI] [PubMed] [Google Scholar]
  • 465.Yamanaka H, Tadokoro S, Miyano M, Takahashi E, Kobayashi H, Okamoto K. Studies on the region involved in the transport activity of Escherichia coli TolC by chimeric protein analysis. Microb Pathog. 2007;42:184–192. doi: 10.1016/j.micpath.2007.01.006. [DOI] [PubMed] [Google Scholar]
  • 466.Yamanaka H, Kobayashi H, Takahashi E, Okamoto K. MacAB is involved in the secretion of Escherichia coli heat-stable enterotoxin II. J Bacteriol. 2008;190:7693–7698. doi: 10.1128/JB.00853-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 467.Tikhonova EB, Devroy VK, Lau SY, Zgurskaya HI. Reconstitution of the Escherichia coli macrolide transporter: the periplasmic membrane fusion protein MacA stimulates the ATPase activity of MacB. Mol Microbiol. 2007;63:895–910. doi: 10.1111/j.1365-2958.2006.05549.x. [DOI] [PubMed] [Google Scholar]
  • 468.Okamoto K, Yamanaka H, Takeji M, Fuji Y. Region of heat-stable enterotoxin II of Escherichia coli involved in translocation across the outer membrane. Microbiol Immunol. 2001;45:349–355. doi: 10.1111/j.1348-0421.2001.tb02630.x. [DOI] [PubMed] [Google Scholar]
  • 469.Labrie V, Harel J, Dubreuil JD. Oligomerization of Escherichia coli enterotoxin b through its C-terminal hydrophobic alpha-helix. Biochim Biophys Acta. 2001c;1535:128–133. doi: 10.1016/s0925-4439(00)00091-0. [DOI] [PubMed] [Google Scholar]
  • 470.Rousset E, Harel J, Dubreuil JD. Sulfatide from the pig jejunum brush border epithelial cell surface is involved in binding of Escherichia coli enterotoxin b. Infect Immun. 1998a;66:5650–5658. doi: 10.1128/iai.66.12.5650-5658.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 471.Chao KL, Dreyfus LA. Interaction of Escherichia coli heat-stable enterotoxin B with cultured human intestinal epithelial cells. Infect Immun. 1997;65:3209–3217. doi: 10.1128/iai.65.8.3209-3217.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 472.Rousset E, Harel J, Dubreuil JD. Binding characteristics of Escherichia coli enterotoxin b (STb) to the pig jejunum and partial characterization of the molecule involved. Microb Pathog. 1998b;24:277–288. doi: 10.1006/mpat.1997.0193. [DOI] [PubMed] [Google Scholar]
  • 473.Beausoleil HE, Labrie V, Dubreuil JD. Trypan blue uptake by chinese hamster ovary cultured epithelial cells: a cellular model to study Escherichia coli STb enterotoxin. Toxicon. 2002a;40:185–191. doi: 10.1016/s0041-0101(01)00222-7. [DOI] [PubMed] [Google Scholar]
  • 474.Gonçalves C, Berthiaume F, Mourez M, Dubreuil JD. Escherichia coli STb toxin binding to sulfatide and its inhibition by carragenan. FEMS Microbiol Lett. 2008;281:30–35. doi: 10.1111/j.1574-6968.2008.01075.x. [DOI] [PubMed] [Google Scholar]
  • 475.Labrie V, Beausoleil HE, Harel J, Dubreuil JD. Binding to sulfatide and enterotoxicity of various Escherichia coli STb mutants. Microbiology. 2001b;147:3141–3148. doi: 10.1099/00221287-147-11-3141. [DOI] [PubMed] [Google Scholar]
  • 476.Fujii Y, Okamuro Y, Hitotsubashi S, Saito A, Akashi N, Okamoto K. Effect of alterations of basic amino acid residues of Escherichia coli heat-stable enterotoxin II on enterotoxicity. Infect Immun. 1994;62:2295–2301. doi: 10.1128/iai.62.6.2295-2301.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 477.Dubreuil JD. Escherichia coli STb toxin and colibacillosis: knowing is half the battle. FEMS Microbiol Lett. 2008;278:137–145. doi: 10.1111/j.1574-6968.2007.00967.x. [DOI] [PubMed] [Google Scholar]
  • 478.Argenzio RA, Liacos J, Berschneider HM, Whipp SC, Robertson DC. Effect of heat-stable enterotoxin of Escherichia coli and theophylline on ion transport in porcine small intestine. Can J Comp Med. 1984;48:14–22. [PMC free article] [PubMed] [Google Scholar]
  • 479.Weikel CS, Nellans HN, Guerrant RL. In vivo and in vitro effects of a novel enterotoxin, STb, produced by Escherichia coli. J Infect Dis. 1986a;153:893–901. doi: 10.1093/infdis/153.5.893. [DOI] [PubMed] [Google Scholar]
  • 480.Fujii Y, Kondo Y, Okamoto K. Involvement of prostaglandin E2 synthesis in the intestinal secretory action of Escherichia coli heat-stable enterotoxin II. FEMS Microbiol Lett. 1995;130:259–265. doi: 10.1111/j.1574-6968.1995.tb07729.x. [DOI] [PubMed] [Google Scholar]
  • 481.Labrie V, Harel J, Dubreuil JD. Escherichia coli heat-stable enterotoxin b (STb) in vivo internalization within rat intestinal epithelial cells. Vet Res. 2002;33:223–228. doi: 10.1051/vetres:2002010. [DOI] [PubMed] [Google Scholar]
  • 482.Gonçalves C, Dubreuil JD. Effect of Escherichia coli STb toxin on NIH-3T3 cells. FEMS Immunol Med Microbiol. 2009;55:432–441. doi: 10.1111/j.1574-695X.2009.00541.x. [DOI] [PubMed] [Google Scholar]
  • 483.Dreyfus LA, Harville B, Howard DE, Shaban R, Beatty DM, Morris SJ. Calcium influx mediated by the Escherichia coli heat-stable enterotoxin B (STB) Proc Natl Acad Sci USA. 1993;90:3202–3206. doi: 10.1073/pnas.90.8.3202. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 484.Fujii Y, Nomura T, Yamanaka H, Okamoto K. Involvement of Ca(2+)-calmodulin-dependent protein kinase II in the intestinal secretory action of Escherichia coli heat-stable enterotoxin II. Microbiol Immunol. 1997;41:633–636. doi: 10.1111/j.1348-0421.1997.tb01904.x. [DOI] [PubMed] [Google Scholar]
  • 485.Harville BA, Dreyfus LA. Involvement of 5-hydroxytryptamine and prostaglandin E2 in the intestinal secretory action of Escherichia coli heat-stable enterotoxin B. Infect Immun. 1995;63:745–750. doi: 10.1128/iai.63.3.745-750.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 486.Harville BA, Dreyfus LA. Release of serotonin from RBL-2H3 cells by the Escherichia coli peptide toxin STb. Peptides. 1996;17:363–366. doi: 10.1016/0196-9781(96)00033-2. [DOI] [PubMed] [Google Scholar]
  • 487.Peterson JW, Whipp SC. Comparison of the mechanisms of action of cholera toxin and the heat-stable enterotoxins of Escherichia coli. Infect Immun. 1995;63:1452–1461. doi: 10.1128/iai.63.4.1452-1461.1995. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 488.Gonçalves C, Vachon V, Schwartz JL, Dubreuil JD. The Escherichia coli enterotoxin STb permeabilizes piglet jejunal brush border membrane vesicles. Infect Immun. 2007;75:2208–2213. doi: 10.1128/IAI.01829-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 489.Labrie V, Potvin L, Harel J, Dubreuil JD, Schwartz J-L. Enterotoxin b of Escherichia coli (STb) forms ion channels in planar lipid bilayers. :A54. In (ed) [Google Scholar]
  • 490.Syed HC, Dubreuil JD. Escherichia coli STb toxin induces apoptosis in intestinal epithelial cell lines. Microb Pathog. 2012;53:147–153. doi: 10.1016/j.micpath.2012.06.003. [DOI] [PubMed] [Google Scholar]
  • 491.Ngendahayo Mukiza C, Dubreuil JD. Escherichia coli heat-stable toxin b impairs intestinal epithelial barrier function by altering tight junction proteins. Infect Immun. 2013;81:2819–2827. doi: 10.1128/IAI.00455-13. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 492.Popoff MR. Multifaceted interactions of bacterial toxins with the gastrointestinal mucosa. Future Microbiol. 2011;6:763–797. doi: 10.2217/fmb.11.58. [DOI] [PubMed] [Google Scholar]
  • 493.Schmidt E, Kelly SM, van der Walle CF. Tight junction modulation and biochemical characterisation of the zonula occludens toxin C-and N-termini. FEBS Lett. 2007;581:2974–2980. doi: 10.1016/j.febslet.2007.05.051. [DOI] [PubMed] [Google Scholar]
  • 494.Nassour H, Dubreuil JD. Escherichia coli STb enterotoxin dislodges claudin-1 from epithelial tight junctions. PLoS One. 2014;9:e113273. doi: 10.1371/journal.pone.0113273. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 495.Wu XY, Chapman T, Trott DJ, Bettelheim K, Do TN, Driesen S, Walker MJ, Chin J. Comparative analysis of virulence genes, genetic diversity, and phylogeny of commensal and enterotoxigenic Escherichia coli isolates from weaned pigs. Appl Environ Microbiol. 2007;73:83–91. doi: 10.1128/AEM.00990-06. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 496.Niewerth U, Frey A, Voss T, Le Bouguénec C, Baljer G, Franke S, Schmidt MA. The AIDA autotransporter system is associated with F18 and stx2e in Escherichia coli isolates from pigs diagnosed with edema disease and postweaning diarrhea. Clin Diagn Lab Immunol. 2001;8:143–149. doi: 10.1128/CDLI.8.1.143-149.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 497.Ngeleka M, Pritchard J, Appleyard G, Middleton DM, Fairbrother JM. Isolation and association of Escherichia coli AIDA-I/STb, rather than EAST1 pathotype, with diarrhea in piglets and antibiotic sensitivity of isolates. J Vet Diagn Invest. 2003;15:242–252. doi: 10.1177/104063870301500305. [DOI] [PubMed] [Google Scholar]
  • 498.Tarr PI, Bilge SS, Vary JC, Jr, Jelacic S, Habeeb RL, Ward TR, Baylor MR, Besser TE. Iha: a novel Escherichia coli O157:H7 adherence-conferring molecule encoded on a recently acquired chromosomal island of conserved structure. Infect Immun. 2000;68:1400–1407. doi: 10.1128/iai.68.3.1400-1407.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 499.Fleckenstein JM, Kopecko DJ, Warren RL, Elsinghorst EA. Molecular characterization of the tia invasion locus from enterotoxigenic Escherichia coli. Infect Immun. 1996;64:2256–2265. doi: 10.1128/iai.64.6.2256-2265.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 500.Elsinghorst EA, Weitz JA. Epithelial cell invasion and adherence directed by the enterotoxigenic Escherichia coli tib locus is associated with a 104-kilodalton outer membrane protein. Infect Immun. 1994;62:3463–3471. doi: 10.1128/iai.62.8.3463-3471.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 501.Lindenthal C, Elsinghorst EA. Enterotoxigenic Escherichia coli TibA glycoprotein adheres to human intestine epithelial cells. Infect Immun. 2001;69:52–57. doi: 10.1128/IAI.69.1.52-57.2001. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 502.Mammarappallil JG, Elsinghorst EA. Epithelial cell adherence mediated by the enterotoxigenic Escherichia coli tia protein. Infect Immun. 2000;68:6595–6601. doi: 10.1128/iai.68.12.6595-6601.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 503.Gutiérrez D, Pardo M, Montero D, Oñate A, Farfán MJ, Ruiz-Pérez F, Del Canto F, Vidal R. TleA, a Tsh-like autotransporter identified in a human enterotoxigenic Escherichia coli strain. Infect Immun. 2015;83:1893–1903. doi: 10.1128/IAI.02976-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 504.Kansal R, Rasko DA, Sahl JW, Munson GP, Roy K, Luo Q, Sheikh A, Kuhne KJ, Fleckenstein JM. Transcriptional modulation of enterotoxigenic Escherichia coli virulence genes in response to epithelial cell interactions. Infect Immun. 2013;81:259–270. doi: 10.1128/IAI.00919-12. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 505.Sheikh A, Luo Q, Roy K, Shabaan S, Kumar P, Qadri F, Fleckenstein JM. Contribution of the highly conserved EaeH surface protein to enterotoxigenic Escherichia coli pathogenesis. Infect Immun. 2014;82:3657–3666. doi: 10.1128/IAI.01890-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 506.Roy K, Hilliard GM, Hamilton DJ, Luo J, Ostmann MM, Fleckenstein JM. Enterotoxigenic Escherichia coli EtpA mediates adhesion between flagella and host cells. Nature. 2009;457:594–598. doi: 10.1038/nature07568. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 507.Luo Q, Kumar P, Vickers TJ, Sheikh A, Lewis WG, Rasko DA, Sistrunk J, Fleckenstein JM, Payne SM. Enterotoxigenic Escherichia coli secretes a highly conserved mucin-degrading metalloprotease to effectively engage intestinal epithelial cells. Infect Immun. 2014;82:509–521. doi: 10.1128/IAI.01106-13. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 508.Kumar P, Luo Q, Vickers TJ, Sheikh A, Lewis WG, Fleckenstein JM, Payne SM. EatA, an immunogenic protective antigen of enterotoxigenic Escherichia coli, degrades intestinal mucin. Infect Immun. 2014;82:500–508. doi: 10.1128/IAI.01078-13. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 509.Shepard SM. Phylogenetic and genomic characterization of porcine enterotoxigenic Escherichia coli. M.S. University of Minnesota; St. Paul, Minnesota: 2011. [Google Scholar]
  • 510.Wyrsch E, Roy Chowdhury P, Abraham S, Santos J, Darling AE, Charles IG, Chapman TA, Djordjevic SP. Comp arative genomic analysis of a multiple antimicrobial resistant enterotoxigenic E. coli O157 lineage from Australian pigs. BMC Genomics. 2015;16:165. doi: 10.1186/s12864-015-1382-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 511.Luo Q, Qadri F, Kansal R, Rasko DA, Sheikh A, Fleckenstein JM. Conservation and immunogenicity of novel antigens in diverse isolates of enterotoxigenic Escherichia coli. PLoS Negl Trop Dis. 2015;9:e0003446. doi: 10.1371/journal.pntd.0003446. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 512.Jones GW, Rutter JM. The association of K88 antigen with haemagglutinating activity in porcine strains of Escherichia coli. J Gen Microbiol. 1974;84:135–144. doi: 10.1099/00221287-84-1-135. [DOI] [PubMed] [Google Scholar]
  • 513.Jones GW, Rutter JM. Contribution of the K88 antigen of Escherichia coli to enteropathogenicity; protection against disease by neutralizing the adhesive properties of K88 antigen. Am J Clin Nutr. 1974;27:1441–1449. doi: 10.1093/ajcn/27.12.1441. [DOI] [PubMed] [Google Scholar]
  • 514.Isaacson RE. K99 surface antigen of Escherichia coli: antigenic characterization. Infect Immun. 1978;22:555–559. doi: 10.1128/iai.22.2.555-559.1978. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 515.Sherman DM, Acres SD, Sadowski PL, Springer JA, Bray B, Raybould TJ, Muscoplat CC. Protecti on of calves against fatal enteric colibacillosis by orally administered Escherichia coli K99-specific monoclonal antibody. Infect Immun. 1983;42:653–658. doi: 10.1128/iai.42.2.653-658.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 516.Snodgrass DR. Evaluation of a combined rotavirus and enterotoxigenic Escherichia coli vaccine in cattle. Vet Rec. 1986;119:39–42. doi: 10.1136/vr.119.2.39. [DOI] [PubMed] [Google Scholar]
  • 517.Snodgrass DR, Nagy LK, Sherwood D, Campbell I. Passive immunity in calf diarrhea: vaccination with K99 antigen of enterotoxigenic Escherichia coli and rotavirus. Infect Immun. 1982;37:586–591. doi: 10.1128/iai.37.2.586-591.1982. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 518.Wittum TW, Dewey CE. Partial budget analysis of sow Escherichia coli vaccination. Swine Health Prod. 1996;1:9–13. [Google Scholar]
  • 519.Ascón MA, Ochoa-Repáraz J, Walters N, Pascual DW. Partially assembled K99 fimbriae are required for protection. Infect Immun. 2005;73:7274–7280. doi: 10.1128/IAI.73.11.7274-7280.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 520.Bakker D, van Zijderveld FG, van der Veen S, Oudega B, de Graaf FK. K88 fimbriae as carriers of heterologous antigenic determinants. Microb Pathog. 1990;8:343–352. doi: 10.1016/0882-4010(90)90093-6. [DOI] [PubMed] [Google Scholar]
  • 521.Chen H, Schifferli DM. Construction, characterization, and immunogenicity of an attenuated Salmonella enterica serovar typhimurium pgtE vaccine expressing fimbriae with integrated viral epitopes from the spiC promoter. Infect Immun. 2003;71:4664–4673. doi: 10.1128/IAI.71.8.4664-4673.2003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 522.Chen H, Schifferli DM. Enhanced immune responses to viral epitopes by combining macrophage-inducible expression with multimeric display on a Salmonella vector. Vaccine. 2001;19:3009–3018. doi: 10.1016/S0264-410X(00)00541-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 523.Chen H, Schifferli DM. Mucosal and systemic immune responses to chimeric fimbriae expressed by Salmonella enterica serovar typhimurium vaccine strains. Infect Immun. 2000;68:3129–3139. doi: 10.1128/iai.68.6.3129-3139.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 524.Rani DB, Bayer ME, Schifferli DM. Polymeric display of immunogenic epitopes from herpes simplex virus and transmissible gastroenteritis virus surface proteins on an enteroadherent fimbria. Clin Diagn Lab Immunol. 1999;6:30–40. doi: 10.1128/cdli.6.1.30-40.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 525.Thiry G, Clippe A, Scarcez T, Petre J. Cloning of DNA sequences encoding foreign peptides and their expression in the K88 pili. Appl Environ Microbiol. 1989;55:984–993. doi: 10.1128/aem.55.4.984-993.1989. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 526.Ascón MA, Hone DM, Walters N, Pascual DW. Oral immunization with a Salmonella typhimurium vaccine vector expressing recombinant enterotoxigenic Escherichia coli K99 fimbriae elicits elevated antibody titers for protective immunity. Infect Immun. 1998;66:5470–5476. doi: 10.1128/iai.66.11.5470-5476.1998. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 527.Attridge S, Hackett J, Morona R, Whyte P. Towards a live oral vaccine against enterotoxigenic Escherichia coli of swine. Vaccine. 1988;6:387–389. doi: 10.1016/0264-410x(88)90134-x. [DOI] [PubMed] [Google Scholar]
  • 528.Greenwood PE, Clark SJ, Cahill AD, Trevallyn-Jones J, Tzipori S. Development and protective efficacy of a recombinant-DNA derived fimbrial vaccine against enterotoxic colibacillosis in neonatal piglets. Vaccine. 1988;6:389–392. doi: 10.1016/0264-410x(88)90135-1. [DOI] [PubMed] [Google Scholar]
  • 529.Moon HW, Rogers DG, Rose R. Effects of an orally administered live Escherichia coli pilus vaccine on duration of lacteal immunity to enterotoxigenic Escherichia coli in swine. Am J Vet Res. 1988;49:2068–2071. [PubMed] [Google Scholar]
  • 530.Morona R, Morona JK, Considine A, Hackett JA, van den Bosch L, Beyer L, Attridge SR. Construction of K88- and K99-expressing clones of Salmonella typhimurium G30: immunogenicity following oral administration to pigs. Vaccine. 1994;12:513–517. doi: 10.1016/0264-410x(94)90309-3. [DOI] [PubMed] [Google Scholar]
  • 531.Bijlsma IG, van Houten M, Frik JF, Ruitenberg EJ. K88 variants K88ab, K88ac and K88ad in oral vaccination of different porcine adhesive phenotypes. Immunological aspects. Vet Immunol Immunopathol. 1987;16:235–250. doi: 10.1016/0165-2427(87)90020-1. [DOI] [PubMed] [Google Scholar]
  • 532.Van den Broeck W, Cox E, Goddeeris BM. Induction of immune responses in pigs following oral administration of purified F4 fimbriae. Vaccine. 1999;17:2020–2029. doi: 10.1016/s0264-410x(98)00406-x. [DOI] [PubMed] [Google Scholar]
  • 533.Chu H, Kang S, Ha S, Cho K, Park SM, Han KH, Kang SK, Lee H, Han SH, Yun CH, Choi Y. Lact obacillus acidophilus expressing recombinant K99 adhesive fimbriae has an inhibitory effect on adhesion of enterotoxigenic Escherichia coli. Microbiol Immunol. 2005;49:941–948. doi: 10.1111/j.1348-0421.2005.tb03687.x. [DOI] [PubMed] [Google Scholar]
  • 534.Joensuu JJ, Kotiaho M, Teeri TH, Valmu L, Nuutila AM, Oksman-Caldentey KM, Niklander-Teeri V. Glycosylated F4 (K88) fimbrial adhesin FaeG expressed in barley endosperm induces ETEC-neutralizing antibodies in mice. Transgenic Res. 2006;15:359–373. doi: 10.1007/s11248-006-0010-7. [DOI] [PubMed] [Google Scholar]
  • 535.Joensuu JJ, Verdonck F, Ehrstrom A, Peltola M, Siljander-Rasi H, Nuutila AM, Oksman-Caldentey KM, Teeri TH, Cox E, Goddeeris BM, Niklander-Teeri V. F4 (K88) fimbrial adhesin FaeG expressed in alfalfa reduces F4+ enterotoxigenic Escherichia coli excretion in weaned piglets. Vaccine. 2005 doi: 10.1016/j.vaccine.2005.11.056. [DOI] [PubMed] [Google Scholar]
  • 536.Sherman DM, Acres SD, Sadowski PL, Springer JA, Bray B, Raybould TJG, Muscoplat CC. Protec tion of calves against fatal enteric colibacillosis by orally administered Escherichia coli K99-specific monoclonal antibody. Infect Immun. 1983;42:653–658. doi: 10.1128/iai.42.2.653-658.1983. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 537.Acres SD, Isaacson RE, Khachatourians G, Babiuk L, Kapitany RA. In: Vaccination of cows with purified K99 antigen, K99+ anucleated live E coli, and whole cell bacterins containing enterotoxigenic E coli for prevention of enterotoxigenic colibacillosis of calves. Acres SD, editor. Veterinary Infectious Disease Organization; pp. 443–456. [Google Scholar]
  • 538.Bertschinger HU, Nief V, Tschäpe H. Active oral immunization of suckling piglets to prevent colonization after weaning by enterotoxigenic Escherichia coli with fimbriae F18. Vet Microbiol. 2000;71:255–267. doi: 10.1016/s0378-1135(99)00166-2. [DOI] [PubMed] [Google Scholar]
  • 539.Niewold TA, van Dijk AJ, Geenen PL, Roodink H, Margry R, van der Meulen J. Dietary specific antibodies in spray-dried immune plasma prevent enterotoxigenic Escherichia coli F4 (ETEC) post weaning diarrhoea in piglets. Vet Microbiol. 2007;124:362–369. doi: 10.1016/j.vetmic.2007.04.034. [DOI] [PubMed] [Google Scholar]
  • 540.Moonens K, De Kerpel M, Coddens A, Cox E, Pardon E, Remaut H, De Greve H. Nanobody mediated inhibition of attachment of F18 Fimbriae expressing Escherichia coli. PLoS One. 2014;9:e114691. doi: 10.1371/journal.pone.0114691. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 541.Moonens K, Van den Broeck I, Okello E, Pardon E, De Kerpel M, Remaut H, De Greve H. Structural insight in the inhibition of adherence of F4 fimbriae producing enterotoxigenic Escherichia coli by llama single domain antibodies. Vet Res (Faisalabad) 2015;46:14. doi: 10.1186/s13567-015-0151-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 542.Sarrazin E, Bertschinger HU. Role of fimbriae F18 for actively acquired immunity against porcine enterotoxigenic Escherichia coli. Vet Microbiol. 1997;54:133–144. doi: 10.1016/s0378-1135(96)01275-8. [DOI] [PubMed] [Google Scholar]
  • 543.Verdonck F, Cox E, van Gog K, Van der Stede Y, Duchateau L, Deprez P, Goddeeris BM. Different kinetic of antibody responses following infection of newly weaned pigs with an F4 enterotoxigenic Escherichia coli strain or an F18 verotoxigenic Escherichia coli strain. Vaccine. 2002;20:2995–3004. doi: 10.1016/s0264-410x(02)00220-7. [DOI] [PubMed] [Google Scholar]
  • 544.Felder CB, Vorlaender N, Gander B, Merkle HP, Bertschinger HU. Microencapsulated enterotoxigenic Escherichia coli and detached fimbriae for peroral vaccination of pigs. Vaccine. 2000;19:706–715. doi: 10.1016/s0264-410x(00)00264-4. [DOI] [PubMed] [Google Scholar]
  • 545.Snoeck V, Huyghebaert N, Cox E, Vermeire A, Vancaeneghem S, Remon JP, Goddeeris BM. Enteri c-coated pellets of F4 fimbriae for oral vaccination of suckling piglets against enterotoxigenic Escherichia coli infections. Vet Immunol Immunopathol. 2003;96:219–227. doi: 10.1016/j.vetimm.2003.08.003. [DOI] [PubMed] [Google Scholar]
  • 546.Alexa P, Salajka E, Salajková Z, Máchová A. Combined parenteral and oral immunization against enterotoxigenic Escherichia coli diarrhea in weaned piglets. Vet Med (Praha) 1995;40:365–370. [PubMed] [Google Scholar]
  • 547.Van der Stede Y, Cox E, Verdonck F, Vancaeneghem S, Goddeeris BM. Reduced faecal excretion of F4+-E coli by the intramuscular immunisation of suckling piglets by the addition of 1alpha,25-dihydroxyvitamin D3 or CpG-oligodeoxynucleotides. Vaccine. 2003;21:1023–1032. doi: 10.1016/s0264-410x(02)00553-4. [DOI] [PubMed] [Google Scholar]
  • 548.Hashish EA, Zhang C, Ruan X, Knudsen DE, Chase CC, Isaacson RE, Zhou G, Zhang W. A multiepitope fusion antigen elicits neutralizing antibodies against enterotoxigenic Escherichia coli and homologous bovine viral diarrhea virus in vitro. Clin Vaccine Immunol. 2013;20:1076–1083. doi: 10.1128/CVI.00249-13. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 549.Ruan X, Liu M, Casey T, Zhang W. A Tripartite Fusion, FaeG-FedF-LT192A2:B, of Enterotoxigenic Escherichia coli (ETEC) Elicits Antibodies Neutralizing CT Toxin, Inhibiting Adherence of K88 (F4) and F18 Fimbriae, and Protecting Pigs against K88ac/LT ETEC Infection. Clin Vaccine Immunol. 2011 doi: 10.1128/CVI.05120-11. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 550.Zhang C, Zhang W. Escherichia coli K88ac fimbriae expressing heat-labile (LT) and heat-stable (STa) toxin epitopes elicit antibodies that neutralize cholerae toxin and STa toxin and inhibit adherence of K88ac fimbrial E. coli. Clin Vaccine Immunol. 2010;17:1859–1867. doi: 10.1128/CVI.00251-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 551.Zhang W, Robertson DC, Zhang C, Bai W, Zhao M, Francis DH. Escherichia coli constructs expressing human or porcine enterotoxins induce an identical diarrheal disease in a piglet infection model. Appl Environ Microbiol. 2008;74:5832–5837. doi: 10.1128/AEM.00893-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 552.Bianchi AT, Scholten JW, van Zijderveld AM, van Zijderveld FG, Bokhout BA. Parenteral vaccination of mice and piglets with F4+ Escherichia coli suppresses the enteric anti-F4 response upon oral infection. Vaccine. 1996;14:199–206. doi: 10.1016/0264-410x(95)00192-4. [DOI] [PubMed] [Google Scholar]
  • 553.Van den Broeck W, Bouchaut H, Cox E, Goddeeris BM. F4 receptor-independent priming of the systemic immune system of pigs by low oral doses of F4 fimbriae. Vet Immunol Immunopathol. 2002;85:171–178. doi: 10.1016/s0165-2427(01)00429-9. [DOI] [PubMed] [Google Scholar]
  • 554.Melkebeek V, Goddeeris BM, Cox E. ETEC vaccination in pigs. Vet Immunol Immunopathol. 2013;152:37–42. doi: 10.1016/j.vetimm.2012.09.024. [DOI] [PubMed] [Google Scholar]
  • 555.Golchin M, Aitken R. Isolation by phage display of recombinant antibodies able to block adherence of Escherichia coli mediated by the K99 colonisation factor. Vet Immunol Immunopathol. 2008;121:321–331. doi: 10.1016/j.vetimm.2007.10.005. [DOI] [PubMed] [Google Scholar]
  • 556.Martín MJ, Martín-Sosa S, Hueso P. Binding of milk oligosaccharides by several enterotoxigenic Escherichia coli strains isolated from calves. Glycoconj J. 2002;19:5–11. doi: 10.1023/a:1022572628891. [DOI] [PubMed] [Google Scholar]
  • 557.Mouricout M, Petit JM, Carias JR, Julien R. Glycoprotein glycans that inhibit adhesion of Escherichia coli mediated by K99 fimbriae: treatment of experimental colibacillosis. Infect Immun. 1990;58:98–106. doi: 10.1128/iai.58.1.98-106.1990. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 558.Nollet H, Laevens H, Deprez P, Sanchez R, Van Driessche E, Muylle E. The use of non-immune plasma powder in the prophylaxis of neonatal Escherichia coli diarrhoea in calves. Zentralbl Veterinarmed A. 1999;46:185–196. doi: 10.1046/j.1439-0442.1999.00208.x. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 559.Ofek I, Hasty DL, Doyle RJ. Bacterial adhesion to animal cells and tissues. ASM Press; Washington, D.C.: 2003. Antiadhesion therapy; pp. 157–176. [Google Scholar]
  • 560.Ofek I, Hasty DL, Sharon N. Anti-adhesion therapy of bacterial diseases: prospects and problems. FEMS Immunol Med Microbiol. 2003;38:181–191. doi: 10.1016/S0928-8244(03)00228-1. [DOI] [PubMed] [Google Scholar]
  • 561.Atroshi F, Alaviuhkola T, Schildt R, Sandholm M. Fat globule membrane of sow milk as a target for adhesion of K88-positive Escherichia coli. Comp Immunol Microbiol Infect Dis. 1983;6:235–245. doi: 10.1016/0147-9571(83)90016-4. [DOI] [PubMed] [Google Scholar]
  • 562.Atroshi F, Schildt R, Sandholm M. K 88-mediated adhesion of E. coli inhibited by fractions in sow milk. Zentralbl Veterinarmed B. 1983;30:425–433. doi: 10.1111/j.1439-0450.1983.tb01864.x. [DOI] [PubMed] [Google Scholar]
  • 563.Lindahl M. Binding of F41 and K99 fimbriae of enterotoxigenic Escherichia coli to glycoproteins from bovine and porcine colostrum. Microbiol Immunol. 1989;33:373–379. doi: 10.1111/j.1348-0421.1989.tb01985.x. [DOI] [PubMed] [Google Scholar]
  • 564.Martín MJ, Martín-Sosa S, Alonso JM, Hueso P. Enterotoxigenic Escherichia coli strains bind bovine milk gangliosides in a ceramide-dependent process. Lipids. 2003;38:761–768. doi: 10.1007/s11745-003-1124-7. [DOI] [PubMed] [Google Scholar]
  • 565.Chandler DS, Mynott TL. Bromelain protects piglets from diarrhoea caused by oral challenge with K88 positive enterotoxigenic Escherichia coli. Gut. 1998;43:196–202. doi: 10.1136/gut.43.2.196. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 566.Mynott TL, Luke RK, Chandler DS. Oral administration of protease inhibits enterotoxigenic Escherichia coli receptor activity in piglet small intestine. Gut. 1996;38:28–32. doi: 10.1136/gut.38.1.28. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 567.Spencer RJ, Chesson A. The effect of Lactobacillus spp. on the attachment of enterotoxigenic Escherichia coli to isolated porcine enterocytes. J Appl Bacteriol. 1994;77:215–220. doi: 10.1111/j.1365-2672.1994.tb03066.x. [DOI] [PubMed] [Google Scholar]
  • 568.Avila FA, Paulillo AC, Schocken-Iturrino RP, Lucas FA, Orgaz A, Quintana JL. A comparative study of the efficiency of a pro-biotic and the anti-K99 and anti-A14 vaccines in the control of diarrhea in calves in Brazil. Rev Elev Med Vet Pays Trop. 1995;48:239–243. [PubMed] [Google Scholar]
  • 569.Blomberg L, Henriksson A, Conway PL. Inhibition of adhesion of Escherichia coli K88 to piglet ileal mucus by Lactobacillus spp. Appl Environ Microbiol. 1993;59:34–39. doi: 10.1128/aem.59.1.34-39.1993. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 570.Ouwehand AC, Conway PL. Purification and characterization of a component produced by Lactobacillus fermentum that inhibits the adhesion of K88 expressing Escherichia coli to porcine ileal mucus. J Appl Bacteriol. 1996;80:311–318. doi: 10.1111/j.1365-2672.1996.tb03225.x. [DOI] [PubMed] [Google Scholar]
  • 571.Bomba A, Nemcová R, Gancarcíková S, Herich R, Kastel R. Potentiation of the effectiveness of Lactobacillus casei in the prevention of E. coli induced diarrhea in conventional and gnotobiotic pigs. Adv Exp Med Biol. 1999;473:185–190. doi: 10.1007/978-1-4615-4143-1_18. [DOI] [PubMed] [Google Scholar]
  • 572.Konstantinov SR, Smidt H, Akkermans AD, Casini L, Trevisi P, Mazzoni M, De Filippi S, Bosi P, de Vos WM. Feeding of Lactobacillus sobrius reduces Escherichia coli F4 levels in the gut and promotes growth of infected piglets. FEMS Microbiol Ecol. 2008;66:599–607. doi: 10.1111/j.1574-6941.2008.00517.x. [DOI] [PubMed] [Google Scholar]
  • 573.Gopal PK, Prasad J, Smart J, Gill HS. In vitro adherence properties of Lactobacillus rhamnosus DR20 and Bifidobacterium lactis DR10 strains and their antagonistic activity against an enterotoxigenic Escherichia coli. Int J Food Microbiol. 2001;67:207–216. doi: 10.1016/s0168-1605(01)00440-8. [DOI] [PubMed] [Google Scholar]
  • 574.Daudelin JF, Lessard M, Beaudoin F, Nadeau E, Bissonnette N, Boutin Y, Brousseau JP, Lauzon K, Fairbrother JM. Administration of probiotics influences F4 (K88)-positive enterotoxigenic Escherichia coli attachment and intestinal cytokine expression in weaned pigs. Vet Res (Faisalabad) 2011;42:69. doi: 10.1186/1297-9716-42-69. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 575.Krause DO, Bhandari SK, House JD, Nyachoti CM. Response of nursery pigs to a synbiotic preparation of starch and an anti-Escherichia coli K88 probiotic. Appl Environ Microbiol. 2010;76:8192–8200. doi: 10.1128/AEM.01427-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 576.Tsukahara T, Tsuruta T, Nakanishi N, Hikita C, Mochizuki M, Nakayama K. The preventive effect of Bacillus subtilus strain DB9011 against experimental infection with enterotoxcemic Escherichia coli in weaning piglets. Anim Sci J. 2013;84:316–321. doi: 10.1111/asj.12003. [DOI] [PubMed] [Google Scholar]
  • 577.Jin LZ, Marquardt RR, Zhao X. A strain of Enterococcus faecium (18C23) inhibits adhesion of enterotoxigenic Escherichia coli K88 to porcine small intestine mucus. Appl Environ Microbiol. 2000;66:4200–4204. doi: 10.1128/aem.66.10.4200-4204.2000. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 578.Devriendt B, Stuyven E, Verdonck F, Goddeeris BM, Cox E. Enterotoxigenic Escherichia coli (K88) induce proinflammatory responses in porcine intestinal epithelial cells. Dev Comp Immunol. 2010;34:1175–1182. doi: 10.1016/j.dci.2010.06.009. [DOI] [PubMed] [Google Scholar]
  • 579.Finamore A, Roselli M, Imbinto A, Seeboth J, Oswald IP, Mengheri E. Lactobacillus amylovorus inhibits the TLR4 inflammatory signaling triggered by enterotoxigenic Escherichia coli via modulation of the negative regulators and involvement of TLR2 in intestinal Caco-2 cells and pig explants. PLoS One. 2014;9:e94891. doi: 10.1371/journal.pone.0094891. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 580.Guerra-Ordaz AA, González-Ortiz G, La Ragione RM, Woodward MJ, Collins JW, Pérez JF, Martín-Orúe SM. Lactulose and Lactobacillus plantarum, a potential complementary synbiotic to control postweaning colibacillosis in piglets. Appl Environ Microbiol. 2014;80:4879–4886. doi: 10.1128/AEM.00770-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 581.Lee JS, Awji EG, Lee SJ, Tassew DD, Park YB, Park KS, Kim MK, Kim B, Park SC. Effect of Lactobacillus plantarum CJLP243 on the growth performance and cytokine response of weaning pigs challenged with enterotoxigenic Escherichia coli. J Anim Sci. 2012;90:3709–3717. doi: 10.2527/jas.2011-4434. [DOI] [PubMed] [Google Scholar]
  • 582.Klose V, Bayer K, Bruckbeck R, Schatzmayr G, Loibner AP. In vitro antagonistic activities of animal intestinal strains against swine-associated pathogens. Vet Microbiol. 2010;144:515–521. doi: 10.1016/j.vetmic.2010.02.025. [DOI] [PubMed] [Google Scholar]
  • 583.Huja S, Oren Y, Trost E, Brzuszkiewicz E, Biran D, Blom J, Goesmann A, Gottschalk G, Hacker J, Ron EZ, Dobrindt U. Genomic avenue to avian colisepticemia. MBio. 2015;6:e01681–14. doi: 10.1128/mBio.01681-14. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 584.Guinée PA, Agterberg CM, Jansen WH, Frik JF. Serological identification of pig enterotoxigenic Escherichia coli strains not belonging to the classical serotypes. Infect Immun. 1977;15:549–555. doi: 10.1128/iai.15.2.549-555.1977. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 585.Söderlind O, Möllby R. Enterotoxins, O-groups, and K88 antigen in Escherichia coli from neonatal piglets with and without diarrhea. Infect Immun. 1979;24:611–616. doi: 10.1128/iai.24.3.611-616.1979. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 586.Wilson RA, Francis DH. Fimbriae and enterotoxins associated with Escherichia coli serogroups isolated from pigs with colibacillosis. Am J Vet Res. 1986;47:213–217. [PubMed] [Google Scholar]
  • 587.Fairbrother JM, Larivière S, Johnson WM. Prevalence of fimbrial antigens and enterotoxins in nonclassical serogroups of Escherichia coli isolated from newborn pigs with diarrhea. Am J Vet Res. 1988;49:1325–1328. [PubMed] [Google Scholar]
  • 588.Suarez S, Paniagua C, Alvarez M, Rubio P. Features of enterotoxigenic Escherichia coli strains of porcine origin that express K88 and 987P fimbrial antigens. Vet Microbiol. 1987;13:65–68. doi: 10.1016/0378-1135(87)90099-x. [DOI] [PubMed] [Google Scholar]
  • 589.Dean-Nystrom EA, Casey TA, Schneider RA, Nagy B. A monoclonal antibody identifies 2134P fimbriae as adhesins on enterotoxigenic Escherichia coli isolated from postweaning pigs. Vet Microbiol. 1993;37:101–114. doi: 10.1016/0378-1135(93)90185-a. [DOI] [PubMed] [Google Scholar]
  • 590.Lintermans PF, et al. Characterization and purification of the F17 adhesin on the surface of bovine enteropathogenic and septicemic Escherichia coli. Am J Vet Res. 1988;49:1794–1799. [PubMed] [Google Scholar]
  • 591.Contrepois M, Bertin Y, Pohl P, Picard B, Girardeau JP. A study of relationships among F17 a producing enterotoxigenic and non-enterotoxigenic Escherichia coli strains isolated from diarrheic calves. Vet Microbiol. 1998;64:75–81. doi: 10.1016/s0378-1135(98)00253-3. [DOI] [PubMed] [Google Scholar]
  • 592.Oswald E, de Rycke J, Lintermans P, van Muylem K, Mainil J, Daube G, Pohl P. Virulence factors associated with cytotoxic necrotizing factor type two in bovine diarrheic and septicemic strains of Escherichia coli. J Clin Microbiol. 1991;29:2522–2527. doi: 10.1128/jcm.29.11.2522-2527.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 593.Orskov I, Orskov F, Sojka WJ, Wittig W. K antigens K88ab(L) AND K88ac(L) in E. coli - A new O antigen - 0147 and a new K antigen - K89(B) Acta Pathol Microbiol Scand. 1964;62:439–447. doi: 10.1111/apm.1964.62.3.439. [DOI] [PubMed] [Google Scholar]
  • 594.Ørskov I, Ørskov F. Serologic classification of fimbriae. Curr Top Microbiol Immunol. 1990;151:71–90. [PubMed] [Google Scholar]
  • 595.Guinée PA, Jansen WH. Detection of enterotoxigenicity and attachment factors in Escherichia coli strains of human, porcine and bovine origin; a comparative study. Zentralbl Bakteriol [Orig A] 1979;243:245–257. [PubMed] [Google Scholar]
  • 596.Nagy B, Orskov I, Rátz F. Pilus antigen 987P produced by strains of Escherichia coli serotypes O141:K–, H- and O8:K85:H–. Acta Microbiol Acad Sci Hung. 1982;29:129–135. [PubMed] [Google Scholar]
  • 597.Evans MG, Waxler GL, Newman JP. Prevalence of K88, K99, and 987P pili of Escherichia coli in neonatal pigs with enteric colibacillosis. Am J Vet Res. 1986;47:2431–2434. [PubMed] [Google Scholar]
  • 598.Djønne BK, Liven E. Fimbriae in Escherichia coli isolated from the small intestine of piglets. Acta Vet Scand. 1986;27:235–242. doi: 10.1186/BF03548167. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 599.García D, Cavazza ME, Botero L, Gorziglia M, Urbina G, Liprandi F, Esparza J. Preliminary characterization of Escherichia coli isolated from pigs with diarrhoea in Venezuela. Vet Microbiol. 1987;13:47–56. doi: 10.1016/0378-1135(87)90097-6. [DOI] [PubMed] [Google Scholar]
  • 600.Söderlind O, Thafvelin B, Möllby R. Virulence factors in Escherichia coli strains isolated from Swedish piglets with diarrhea. J Clin Microbiol. 1988;26:879–884. doi: 10.1128/jcm.26.5.879-884.1988. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 601.Takahashi K, Takahashi N, Yamamoto A, Uemura T, Imose J. Isolation of Escherichia coli expressing 987P fimbrial antigen from suckling piglets. Nippon Juigaku Zasshi. 1990;52:1113–1115. doi: 10.1292/jvms1939.52.1113. [DOI] [PubMed] [Google Scholar]
  • 602.Supar, Hirst RG, Patten BE. The importance of enterotoxigenic Escherichia coli containing the 987P antigen in causing neonatal colibacillosis in piglets in Indonesia. Veterinary Microbiology. 1991;26:393–400. doi: 10.1016/0378-1135(91)90032-b. [DOI] [PubMed] [Google Scholar]
  • 603.Osek J, Truszczyński M. Occurrence of fimbriae and enterotoxins in Escherichia coli strains isolated from piglets in Poland. Comp Immunol Microbiol Infect Dis. 1992;15:285–292. doi: 10.1016/0147-9571(92)90008-f. [DOI] [PubMed] [Google Scholar]
  • 604.Wray C, McLaren IM, Carroll PJ. Escherichia coli isolated from farm animals in England and Wales between 1986 and 1991. Vet Rec. 1993;133:439–442. doi: 10.1136/vr.133.18.439. [DOI] [PubMed] [Google Scholar]
  • 605.Shin SJ, Chang YF, Timour M, Lauderdale TL, Lein DH. Hybridization of clinical Escherichia coli isolates from calves and piglets in New York State with gene probes for enterotoxins (STaP, STb, LT), Shiga-like toxins (SLT-1, SLT-II) and adhesion factors (K88, K99, F41, 987P) Vet Microbiol. 1994;38:217–225. doi: 10.1016/0378-1135(94)90003-5. [DOI] [PubMed] [Google Scholar]
  • 606.Ojeniyi B, Ahrens P, Meyling A. Detection of fimbrial and toxin genes in Escherichia coli and their prevalence in piglets with diarrhoea. The application of colony hybridization assay, polymerase chain reaction and phenotypic assays. Zentralbl Veterinarmed B. 1994;41:49–59. doi: 10.1111/j.1439-0450.1994.tb00205.x. [DOI] [PubMed] [Google Scholar]
  • 607.Garabal JI, Vázquez F, Blanco J, Blanco M, González EA. Colonization antigens of enterotoxigenic Escherichia coli strains isolated from piglets in Spain. Vet Microbiol. 1997;54:321–328. doi: 10.1016/s0378-1135(96)01291-6. [DOI] [PubMed] [Google Scholar]
  • 608.Blanco M, Blanco JE, Gonzalez EA, Mora A, Jansen W, Gomes TA, Zerbini LF, Yano T, de Castro AF, Blanco J. Genes coding for enterotoxins and verotoxins in porcine Escherichia coli strains belonging to different O:K:H serotypes: relationship with toxic phenotypes. J Clin Microbiol. 1997;35:2958–2963. doi: 10.1128/jcm.35.11.2958-2963.1997. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 609.Kwon D, Kim O, Chae C. Prevalence of genotypes for fimbriae and enterotoxins and of O serogroups in Escherichia coli isolated from diarrheic piglets in Korea. J Vet Diagn Invest. 1999;11:146–151. doi: 10.1177/104063879901100207. [DOI] [PubMed] [Google Scholar]
  • 610.Matayoshi M, Kaiga M, Ooshiro S, Nakazawa M. Biological properties and virulence genes of enterotoxigenic Escherichia coli (ETEC) isolated from diarrheic piglets in Okinawa Prefecture. J Jpn Vet Med Assoc. 2001;54:595–600. Japanese. [Google Scholar]
  • 611.Do T, Stephens C, Townsend K, Wu X, Chapman T, Chin J, McCormick B, Bara M, Trott DJ. Rap id identification of virulence genes in enterotoxigenic Escherichia coli isolates associated with diarrhoea in Queensland piggeries. Aust Vet J. 2005;83:293–299. doi: 10.1111/j.1751-0813.2005.tb12745.x. [DOI] [PubMed] [Google Scholar]
  • 612.Do TN, Cu PH, Nguyen HX, Au TX, Vu QN, Driesen SJ, Townsend KM, Chin JJ, Trott DJ. Pathot ypes and serogroups of enterotoxigenic Escherichia coli isolated from pre-weaning pigs in north Vietnam. J Med Microbiol. 2006;55:93–99. doi: 10.1099/jmm.0.46247-0. [DOI] [PubMed] [Google Scholar]
  • 613.Lee SI, Kang SG, Kang ML, Yoo HS. Development of multiplex polymerase chain reaction assays for detecting enterotoxigenic Escherichia coli and their application to field isolates from piglets with diarrhea. J Vet Diagn Invest. 2008;20:492–496. doi: 10.1177/104063870802000413. [DOI] [PubMed] [Google Scholar]
  • 614.Isaacson RE. K99 surface antigen of Escherichia coli: purification and partial characterization. Infect Immun. 1977;15:272–279. doi: 10.1128/iai.15.1.272-279.1977. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 615.Altmann K, Pyliotis NA, Mukkur TK. A new method for the extraction and purification of K99 pili from enterotoxigenic Escherichia coli and their characterization. Biochem J. 1982;201:505–513. doi: 10.1042/bj2010505. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 616.Isaacson RE, Richter P. Escherichia coli 987P pilus: purification and partial characterization. J Bacteriol. 1981;146:784–789. doi: 10.1128/jb.146.2.784-789.1981. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 617.de Graaf FK, Klaasen P. Organization and expression of genes involved in the biosynthesis of 987P fimbriae. Mol Gen Genet. 1986;204:75–81. doi: 10.1007/BF00330190. [DOI] [PubMed] [Google Scholar]
  • 618.Lintermans P, Pohl P, Deboeck F, Bertels A, Schlicker C, Vandekerckhove J, Van Damme J, Van Montagu M, De Greve H. Isolation and nucleotide sequence of the F17-A gene encoding the structural protein of the F17 fimbriae in bovine enterotoxigenic Escherichia coli. Infect Immun. 1988;56:1475–1484. doi: 10.1128/iai.56.6.1475-1484.1988. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 619.Grange PA, Mouricout MA. Transferrin associated with the porcine intestinal mucosa is a receptor specific for K88ab fimbriae of Escherichia coli. Infect Immun. 1996;64:606–610. doi: 10.1128/iai.64.2.606-610.1996. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 620.Erickson AK, Baker DR, Bosworth BT, Casey TA, Benfield DA, Francis DH. Characterization of porcine intestinal receptors for the K88ac fimbrial adhesin of Escherichia coli as mucin-type sialoglycoproteins. Infect Immun. 1994;62:5404–5410. doi: 10.1128/iai.62.12.5404-5410.1994. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 621.Erickson AK, Willgohs JA, McFarland SY, Benfield DA, Francis DH. Identification of two porcine brush border glycoproteins that bind the K88ac adhesin of Escherichia coli and correlation of these glycoproteins with the adhesive phenotype. Infect Immun. 1992;60:983–988. doi: 10.1128/iai.60.3.983-988.1992. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 622.Grange PA, Erickson AK, Levery SB, Francis DH. Identification of an intestinal neutral glycosphingolipid as a phenotype-specific receptor for the K88ad fimbrial adhesin of Escherichia coli. Infect Immun. 1999;67:165–172. doi: 10.1128/iai.67.1.165-172.1999. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 623.Baker DR, Billey LO, Francis DH. Distribution of K88 Escherichia coli-adhesive and nonadhesive phenotypes among pigs of four breeds. Vet Microbiol. 1997;54:123–132. doi: 10.1016/s0378-1135(96)01277-1. [DOI] [PubMed] [Google Scholar]
  • 624.Bijlsma IG, de Nijs A, van der Meer C, Frik JF. Different pig phenotypes affect adherence of Escherichia coli to jejunal brush borders by K88ab, K88ac, or K88ad antigen. Infect Immun. 1982;37:891–894. doi: 10.1128/iai.37.3.891-894.1982. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 625.Hu ZL, Hasler-Rapacz J, Huang SC, Rapacz J. Studies in swine on inheritance and variation in expression of small intestinal receptors mediating adhesion of the K88 enteropathogenic Escherichia coli variants. J Hered. 1993;84:157–165. doi: 10.1093/oxfordjournals.jhered.a111309. [DOI] [PubMed] [Google Scholar]
  • 626.Python P, Jörg H, Neuenschwander S, Asai-Coakwell M, Hagger C, Bürgi E, Bertschinger HU, Stranzinger G, Vögeli P. Inheritance of the F4ab, F4ac and F4ad E. coli receptors in swine and examination of four candidate genes for F4acR. J Anim Breed Genet. 2005;122(Suppl 1):5–14. doi: 10.1111/j.1439-0388.2005.00490.x. [DOI] [PubMed] [Google Scholar]

RESOURCES