Skip to main content
Nature Communications logoLink to Nature Communications
. 2023 Mar 10;14:1329. doi: 10.1038/s41467-023-37017-7

Alternatively spliced exon regulates context-dependent MEF2D higher-order assembly during myogenesis

Mónika Gönczi 1,2, João M C Teixeira 3, Susana Barrera-Vilarmau 3, Laura Mediani 4, Francesco Antoniani 4, Tamás Milán Nagy 5,6, Krisztina Fehér 5,6, Zsolt Ráduly 1,2, Viktor Ambrus 7, József Tőzsér 7, Endre Barta 7,8, Katalin E Kövér 5,6, László Csernoch 1,2, Serena Carra 4,, Monika Fuxreiter 3,
PMCID: PMC10006080  PMID: 36898987

Abstract

During muscle cell differentiation, the alternatively spliced, acidic β-domain potentiates transcription of Myocyte-specific Enhancer Factor 2 (Mef2D). Sequence analysis by the FuzDrop method indicates that the β-domain can serve as an interaction element for Mef2D higher-order assembly. In accord, we observed Mef2D mobile nuclear condensates in C2C12 cells, similar to those formed through liquid-liquid phase separation. In addition, we found Mef2D solid-like aggregates in the cytosol, the presence of which correlated with higher transcriptional activity. In parallel, we observed a progress in the early phase of myotube development, and higher MyoD and desmin expression. In accord with our predictions, the formation of aggregates was promoted by rigid β-domain variants, as well as by a disordered β-domain variant, capable of switching between liquid-like and solid-like higher-order states. Along these lines, NMR and molecular dynamics simulations corroborated that the β-domain can sample both ordered and disordered interactions leading to compact and extended conformations. These results suggest that β-domain fine-tunes Mef2D higher-order assembly to the cellular context, which provides a platform for myogenic regulatory factors and the transcriptional apparatus during the developmental process.

Subject terms: Computational biology and bioinformatics, Cell biology, Structural biology


Mef2D context-dependent higher-order assembly controls simultaneous interactions with the basal machinery and the myogenic factors to activate distinct gene expression programs for muscle lineage development.

Introduction

Myogenic lineage establishment and maintenance of terminal myogenic phenotype is controlled by precise dynamics of temporal and spatial expression, and hierarchical relationship between four myogenic regulatory factors (MRFs)1. Myocyte-specific Enhancer Factor 2 (Mef2) protein belongs to the MADS (MCM1-Agamous-Deficiens-serum response factor) box family of transcription factors, which potentiate the transcriptional activity of myogenic proteins2. Mef2 activity is precisely controlled during muscle development; in addition, the four isoforms encoded by separated genes in vertebrates further increase its functional variety3. The four MEF2 genes (MEF2A, -B, -C and -D) have spatially and temporally distinct expression during development4. Loss-of-function studies showed that mice lacking MEF2A and MEF2C were not viable owing to cardiac dysfunctions, however, MEF2D null mice were viable with cardiac defects5.

Mef2 is activated by myogenic regulatory factors6,7 and the synergy with basic helix-loop-helix (bHLH) proteins is critical for regulating the expression of muscle-specific genes8. The interactions between Mef2 and myogenic proteins appears to be rather complex, involving a dimerisation of Mef2 as well as its bHLH/E12 partners9. A physical interaction between these dimers through the DNA-binding and dimerisation motifs has been proposed8. While bound to DNA, the MyoD basic region was shown to mediate the protein-protein interactions with Mef210. Mutations of two basic residues of MyoD bHLH region, for example, impeded interactions with Mef2 and resulted in myogenic inactivity11. The proximity of these proteins on DNA and their higher local concentrations contribute to transcriptional synergy during myogenesis10.

Tissue-specific alternative splicing further regulates the activity of Mef2 proteins during muscle differentiation3,12. For example, the inclusion of a short acidic region, termed as the β-domain was in particular observed to potentiate transcription in all MEF2 gene products as compared to the splicing variants lacking this segment. The β-domain function was position-independent suggesting an autonomous transcriptional activity, not related to DNA binding or dimerisation13. Tissue-specific alternative splicing of short, disordered motifs often rewires protein interaction networks14,15. In accord, the alternative inclusion of the β-domain was proposed to influence the coordination with myogenic proteins during differentiation. The characteristic feature of this seven-residue segment is the abundance of acidic residues, the mutation of which abolishes transcription13. Therefore, the β-domain was proposed to serve as an acidic blob16 within the Mef2 disordered transactivation domain (TAD, Fig. 1a), which may directly interact with the basal machinery. These acidic blobs function without strong structure and sequence constraints17 through a multitude of alternative interactions formed between the transcription factor and its partner18. Growing structural data on transcriptional assemblies19,20 support that interaction plasticity is beneficial for fine-tuned regulation of the transcription machinery21. In addition, transcription regulation is also enabled by higher-order organisation of proteins22,23, including a wide range of non-stoichiometric clusters24.

Fig. 1. Predicted structure and dynamics characteristics of the wild-type Mef2D and variant sequences.

Fig. 1

a Mef2D is extensively disordered and predicted to form liquid-liquid phase separated condensates. The Mef2D structure predicted by Alphafold57 indicates a small structured domain involving the N-terminal ~100 residues and most of the transactivation domain (TAD) contains is disordered. The regions promoting formation of liquid-like droplets by the FuzDrop method58 are marked by blue. The β-domain (magenta) appears as an ordered motif within the disordered transactivation region. FuzDrop predictions26 shown on the right panels indicate high droplet-promoting probability (pDP) in particular for regions 155-268 residues and 341-520 residues, which are predicted to spontaneously form liquid-liquid phase separated condensates. The β-domain (magenta) and its flanking regions (cyan) are predicted to serve as ordered interaction motifs within the condensate (see also Supplementary Fig. 1). In addition, the β-domain region is capable of sampling a multiplicity of binding modes (MBM), indicating its sensitivity to the cellular context. b Sequences of the designed Mef2D variants. The β-domain and its flanking regions are shown for the wild-type (wt) Mef2D (UniProt code: Q14814; https://legacy.uniprot.org/uniprot/Q14814; 265-301 residues), var1 and var2 with similar β-domain dynamics (gray), var3 and var4 with mobile β-domains (green), var5-var8 with rigid β-domains (red) as compared to wild-type Mef2D. The sequence of the β-domain is magenta, mutated residues (orange) are highlighted. c Predicted β-domain disorder of Mef2D variants. Structural disorder in the unbound state of Mef2D were computed for the full protein sequence using the Espritz method30 as embedded in the FuzPred program25 and the pD values were averaged for residues 286-292. The var3 and var4 variants (green) are above the threshold between disorder and order (pD ≥ 0.308530). var1 (gray) has similar, var2 (gray) has slightly more mobile β-domain than the wild-type Mef2D (black). var5-var8 variants (red) are predicted to have more rigid β-domain than the wild-type. d Droplet landscape of the Mef2D variants. The droplet landscape shows the droplet probability (pDP) as a function of the multiplicity of binding modes (MBM)31,35. The assemblies below the diagonal are likely more solid-like, those above the diagonal are more liquid like33. High MBM values indicate an increased likelihood to change between liquid-like and solid-like forms, for example in case of var8. More mobile β-domain variants (var3, var4, green diamonds) exhibit increased probability to form droplets (higher pDP), whereas more rigid β-domain variants (var5-var8, red triangles) more likely form solid-like states depending on the cellular conditions (high MBM).

Based on these insights, we reasoned that the β-domain may influence the higher-order organisation of Mef2 proteins, enabling their coordination with both the myogenic regulatory factors and the basal machinery. To investigate how alternative inclusion of the β-domain contributes to myogenic transcription, we designed eight Mef2D variants with distinct β-domain properties using a combination of FuzPred method of predicting disordered interactions25 and the FuzDrop method of predicting the probability of forming protein condensates26. The variants with similar (var1, var2), mobile (var3, var4) and rigid (var5var8) β-domains as compared to the wild-type Mef2D (Figs. 1b, 1c) were also predicted to have different cellular behaviors and higher-order assembly (Fig. 1d). We in particular anticipated that the Mef2D variants with different β-domain dynamics will respond differently to changes in the cellular conditions during myogenesis. Then we have assessed the transcriptional activity of the Mef2D variants in reference to the wild-type protein and the isoform lacking the β-domain, termed as β-. We found a negative relationship between the β-domain dynamics and the transcriptional activity; more rigid variants were more potent to increase transcriptional activity in C2C12 cells. In parallel, we observed that more rigid variants, in particular var8 progressed the early phase of differentiation. Then we have characterised how β-domain dynamics affects Mef2D higher-order assembly. In accord with the predictions, we found that Mef2D formed nuclear puncta in C2C12 cells, the mobility of which resembled liquid-liquid phase separated condensates. In addition, we also observed solid-like aggregates in the cytosol, in particular promoted by a rigid β-domain variant (var8). Strikingly, solid aggregates were also formed by the mobile var4, which was predicted to undergo liquid-liquid phase separation as well as to readily convert between liquid-like and solid-like higher-order states (Fig. 1d). NMR and molecular dynamics simulations confirmed that depending on its flanking regions, the β-domain samples both ordered interactions, which can lead to solid-like aggregates as well as disordered interactions, which can result in liquid-like condensates. Based on these results we reason that the alternatively spliced β-domain serves as an interaction element for Mef2D higher-order assembly, which is required for transcription potentiation and differentiation. The characteristics of the assembly are fine-tuned by β-domain dynamics so that Mef2D can efficiently communicate with both the myogenic regulatory proteins and the basal machinery.

Results

Designing Mef2D variants with altered β-domain dynamics and higher-order assembly

Proteins sample a wide range of states from ordered to disordered conformations both in free and bound forms27,28 and variations of structure and interaction patterns lead to functional plasticity29. Most of the transactivation region (TAD) of Mef2D is predicted to be disordered by the Espritz method30 in the free form, whereas the β-domain and its flanking regions appear to be more structured (Supplementary Fig. 1a). We used the FuzPred method to estimate the interaction behaviors, as this approach does not require the knowledge of the specific partner25. These predictions indicate that the majority of the TAD region forms heterogeneous, disordered interactions31, whereas the β-domain serves as a more ordered recognition element (Supplementary Fig. 1b), which can establish well-defined contacts with the partner. In addition, a few motifs, (239–247, 331–339, 355–363, 427–434 residues, Supplementary Fig. 1b) are predicted to form ordered interactions, out of which K245 was identified as an acetylation site32. Regions, which form disordered interactions through heterogeneous and variable contacts, often promote liquid-liquid phase separation26. Based on FuzDrop method26, the majority of the Mef2D TAD is predicted to promote formation of liquid-liquid phase separated condensates (Fig. 1a). The β-domain, however, cannot spontaneously form condensates due to structural order (Fig. 1a). On the other hand, the β-domain is estimated to have a multiplicity of binding modes (MBM, Fig. 1a), which suggests a change between ordered and disordered interactions, the latter facilitating Mef2D partitioning in condensates33.

We used three residue-specific dynamics characteristics to design β-domain variants: i) probability of structural disorder in the free state (pD, computed by the Espritz method30); ii) probability of disordered interactions (pDD, computed by the FuzPred method25); iii) droplet-promoting probability as predicted by the FuzDrop method (pDP, computed by the FuzDrop method26). Then we averaged these values for the β-domain (286-292 residues) and assessed the impact of mutations on three dynamics parameters (pD, pDD, pDP) using structural disorder as the primary ranking (Methods). Then we combined mutations to increase the impact on β-domain dynamics and higher-order assembly. Two variants with similar β-domain dynamics to the wild-type (var1, var2) had additional negatively charged residues introduced at the C-terminal flanking region (Figs. 1b, 1c). Two variants with mobile β-domains (var3, var4) contained positively charged and polar residues (Figs. 1b, 1c). The four variants with rigid β-domains (var5var8) contained more aromatic and hydrophobic residues (Figs. 1b, 1c).

In addition, we also predicted how the variants affect Mef2D higher-order assembly based on the droplet-promoting probability (pDP), which characterises the ability to spontaneously undergo liquid-liquid phase separation, and the multiplicity of binding modes (MBM), which indicates the likelihood of changing between liquid-like and solid-like states31. The complex cellular behavior is represented on the droplet landscape34,35, which displays the droplet-probability as a function of the MBM33 (Fig. 1d). For example, var3 and var4 both have disordered β-domain (Fig. 1c, Supplementary Table 1), yet they are predicted to exhibit different sensitivity to the cellular context. var3 has a positively charged lysine at position 292, which preferably forms disordered interactions and liquid-like condensates, almost independently on other cellular factors (low MBM, Fig. 1d). In contrast, var4 has an asparagine at position 292, which forms a NNN motif with the neighboring residues. This asparagine motif can sample both disordered and ordered interactions and thus is predicted to form liquid-like condensate or solid-like state depending on the cellular conditions (high MBM, Fig. 1d)33. Similarly, introducing an asparagine into the C-terminal flanking region of var1 or adding aromatic groups to the β-domain of var5 and var6 also increases the sensitivity to the cellular conditions (Fig. 1d). Introducing both a negative and aromatic residue in var8 results in comparable cellular sensitivity to the wild-type protein (Fig. 1d). Interestingly, var8 is located at the diagonal of the droplet landscape, suggesting that the transition from droplet to amyloid states can be achieved through a combination of deposition and condensation pathways33,34. The dynamic characteristics of the wild-type protein and the variants are detailed in Supplementary Table 1.

Taken together, we designed eight Mef2D variants containing two to three mutations with distinct impact on β-domain dynamics and higher-order assembly. These mutations have not been identified before and their combinations served to probe the role of the β-domain in muscle cell differentiation.

β-domain rigidity potentiates transcription activity

First, we measured the transcriptional activity of Mef2D variants in cycling and differentiated C2C12 cells. The variants were cloned into pCMV eukaryotic expression vectors and were transfected together with two reporter plasmids: MCK-Luc and pSV-βgal (Methods). Transcription efficiency was characterised by the luciferase activity of the variants, which was normalised to the galactosidase signal. In non-differentiating cells, all variants with rigid β-domains (var5var8) exhibited increased transcriptional activity as compared to the wild-type protein (Fig. 2a). Interestingly, var3 and var4 with mobile β-domains also exhibited slightly elevated transcriptional activity (Fig. 2a). In differentiated C2C12 cells, however, only the var8 exhibited significantly higher transcription activity as compared to the wild-type Mef2D (Fig. 2b). The β- variant was less potent to activate transcription in accord with previous results13 (Figs. 2a, 2b).

Fig. 2. Transcriptional activity of MEF2D variants in C2C12 cells.

Fig. 2

Luciferase activity normalised to galactosidase signal (Methods) is shown as a percentage of the wild-type (wt) control. Luciferase activity was measured in four biologically independent experiments, using three technical replicates in each with the same samples (n = 12 samples in 4 independent experiments). The points represent individual measured data, the rectangles in the box plots present the median and the 25 and 75 percentile values, while the error bars point to 1 and 99%. The luciferase signal is shown as mean  ±  SE, significance (* p < 0.05; ** p < 0.01; # p < 0.005; ## p < 0.001) was computed using two-sided student t-test. The different variants are grouped by their β-domain dynamics properties (Fig. 1c, Methods): var1 (gray diamond) and var2 (gray triangle) with similar β-domain dynamics; var3 (green diamond) and var4 (green triangle) with mobile β-domain; var5 (red diamond), var6 (red triangle), var7 (red circle) and var8 (red square) with rigid β-domain as compared to the wild-type. The β- variant is shown by blue diamond. a Transcriptional activity in non-differentiated C2C12 myoblasts. Variants with rigid β-domains show significantly higher transcriptional activity then the wild-type (var5 178 ± 9.6, var6 135.6 ± 9.3, var7 141.6±8.1 and var8 140.8±11.5 %), while variants with mobile β-domains show slightly increased transcription activity (var3 127.7 ± 4.9 and var4 123.9 ± 5.5 %) using n = 12 samples in 4 independent experiments. Significances (var3 p = 0.0001, var4 p = 0.0012, var5 p = 5.2*10−6, var6 p = 0.0027, var7 p = 0.0003, var8 p = 0.0044; β-minus p = 1.52*10−6) were computed using two-sided student t-test. b Transcriptional activity in differentiated C2C12 myotubes. var8 with rigid β-domain (red square) exhibits significantly higher transcriptional activity than the wild-type, while var3 (green diamond) and var4 (green triangle) with mobile β-domains, and var2 (gray triangle) with similar β-domain dynamics as the wild-type exhibit reduced transcriptional activity. (n = 12 samples in 4 independent experiments). Significances (var2 p = 2.9*10−9; var3 p = 0.008; var4 p = 1.02*10−7; var8 p = 0.0004) were computed using two-sided student t-test. c Lack of Mef2D blocks myotube formation in Mef2D knockout C2C12 cell line. Western blot images showing the lack of Mef2D, which are present endogenously in C2C12 cells. Three chosen stable KO cultures were followed through several passages to prove the stable lack of Mef2D (~70 kDa), while actin was used as inner control (~40 kDa). After 6 days of differentiation myotubes form in C2C12 cell line with endogeneous Mef2D (control, left panel), while cannot be observed in MEF2D KO cultures (right panel). Images were taken by transmitted microscopy, scale bars represent 400 µm. d Transcriptional activity in C2C12 KO cells. Rigid β-domain variants (red) have higher transcriptional activity than variants with similar dynamics to the wild-type (gray). Significances (var4 p = 0.0175, var5 p = 0.0096, var6 p = 0.0365; var7 p = 0.0022; var8 p = 0.0071) were computed using two-sided student t-test using n = 9 samples in 3 independent experiments).

Then we measured the transcriptional activity without the endogenous Mef2D background using knock-out (KO) cultures generated by CRISPR/Cas9 technique36 (Methods). The C2C12 KO cell line was not capable to generate multinucleated myotubes in the absence of Mef2D (Fig. 2c). The transcriptional activity of the variants without the endogenous wild-type background exhibited similar trends as observed in non-differentiated C2C12 cells. The variants with rigid β-domain (var5var8) potentiated transcription as compared to the wild-type Mef2D, while the variants with similar β-domain dynamics as the wild-type (var1, var2) showed comparable activity (Fig. 2D). The variants with mobile β-domain did not exhibit a uniform behavior, while the transcriptional activity of var3 was slightly decreased, that of var4 considerably increased as compared to the wild-type, indicating a more complex mechanism.

Transcriptional activity negatively correlated with the structural disorder of the β-domain (Supplementary Table 2), suggesting that its rigidity promotes interactions with the transcriptional apparatus.

β-domain rigidity promotes early myotube development

In the next step, we assessed the impact of the different variants on skeletal muscle differentiation followed by desmin immunocytochemistry and transmission light microscopy (Methods, Fig. 3). From day 2, we observed multinucleated myotubes with wild-type Mef2D and all variants, and to lesser extent in case of the β- variant. A marked difference between different variants appeared in particular on day 3, when more rigid variants promoted myotube formation as compared to the wild-type (Fig. 3a). At the end of the differentiation process a similar amount of myotubes were formed with all variants, except the one lacking the β-domain (Fig. 3a). The progress of differentiation was quantified by the fusion index, defined as the ratio of the nuclei number in multinucleated myocytes versus the total number of nuclei within the visual fields (Methods, Supplementary Fig. 3). Quantitative analysis corroborated that variants with rigid β-domain, in particular var8, promoted the early phase of differentiation (Supplementary Fig. 3). In addition, var4 with mobile β-domain, also showed a faster myotube development, which was not observed in the presence of var3 (Supplementary Fig. 3).

Fig. 3. Differentiation progress in the presence of Mef2D variants.

Fig. 3

a Early stage of myotube development (day 2 - day 4). The number of multinucleated, long myotubes in the presence of overexpressed Mef2D variants. Representative fluorescent and transmitted images represent randomly selected visual fields and were used to determine the fusion index of the appropriate cultures. Each experiment was independently repeated two times with similar results, at least 15 randomly selected visual fields were analysed. Scale bar is 50 µm. b, c Protein expression of myogenic regulatory factors MyoD (b) and Desmin (c). Normalized protein expression during the differentiation of C2C12 cells. Protein expression was plotted as a percentage of their wild-type control in each day of differentiation. Data was derived from quadruplicate measurements (n = 4 independent experiments), significances (*p = 0.0032; **p = 0.0172 for panel b, and *p = 0.0149; **p = 0.0002 for panel c) were computed using two-sided student t-test as compared to the wild-type control on the given day of differentiation. b Protein expression of the early differentiation regulator MyoD. Variants with rigid β-domains (var5-var8, red) exhibit higher level of MyoD expression on day 1 and day 2. Significant deviations (var5 p = 0.0032; var8 p = 0.0172) were observed in case of var5 and var8 using two-sided student t-test as compared to the wild-type control on the given day of differentiation. c Protein expression of the late differentiation marker desmin. More rigid β-domain variants (var5 p = 0.0149; var8 p = 0.0002, red) significantly increase desmin expression on days 1 and 2.

Mef2D physically interacts with myogenic regulatory factors8,9, thus we monitored their protein expression levels by Western blot analysis at each day of the differentiation process. We found increased levels of both the early differentiation regulator MyoD (Fig. 3b) and the late differentiation marker desmin (Fig. 3c) in the presence of rigid β-domain variants at the early phase of differentiation (days 1 and 2). The impact on desmin was prolonged also on day 3 of differentiation (Fig. 3c). This suggests that more ordered β-domains stabilise Mef2D interactions with the myogenic regulatory factors contributing to potentiation of transcription10. Along this line, we did not find higher desmin or MyoD levels in the presence of var4 with mobile β-domain (Figs. 3b, 3c), although this variant also exhibited progress in myotube development.

Taken together variants with rigid β-domain promote the early phase of differentiation and stabilise the myogenic factors.

Mef2D forms higher-order assemblies in C2C12 cells with both liquid-like and solid-like properties

Then we analyzed the cellular organisation of representative Mef2D variants and overexpressed the wild-type, var3, var4 and var8 in C2C12 cells grown under cycling conditions and in presence of differentiation medium. Rapid turnover and accumulation upon inhibition of the proteasome indicates that Mef2D and its variants are disordered37 (Supplementary Fig. 4a, Methods). Confocal microscopy revealed that wild-type Mef2D and var3, var4 and var8 formed higher-order assemblies, which are mainly located inside the nucleus (Fig. 4a). Fluorescence recovery after photobleaching (FRAP) analysis indicated high mobility of the wild-type protein as well as var3, var4 and var8 inside the nucleoplasm (Supplementary Fig. 4b) and nuclear foci (Fig. 4c), resembling liquid-liquid phase separated condensates38. FRAP analysis in U2OS cells corroborated the presence of mobile nuclear condensates (Supplementary Fig. 5), in case of all variants, irrespective of the β-domain dynamics. These results are in line with the FuzDrop predictions26 that Mef2D and all the variants are capable of spontaneously undergoing liquid-liquid phase separation (pLLPS ~ 0.99).

Fig. 4. Mef2D forms liquid-like and solid-like higher order assembly.

Fig. 4

a Mef2D foci in the nucleus and cytoplasm. Subcellular distribution of Mef2D wt, var3, var4 and var8 in C2C12 cells grown in cycling or differentiating medium exhibit foci formation in both the nucleus and cytoplasm. Higher-order assembly is most pronounced in case of var8 with rigid β-domain, but is also observed in case of var3 and var4 with mobile β-domain. 24 hrs post-transfection cells were fixed and stained with an antibody specific for Mef2D. Nucleic acid was stained using DAPI. The scale bar is 10 μm on the representative images. The experiment was performed four times (cycling medium) and three times (differentiating medium). Quantification is shown in panel b. b Quantification of MEF2D cells with cytoplasmic higher-order structures (foci). The percentage of Mef2D overexpressing cells with cytoplasmic aggregates is significantly higher in case of var8 with rigid β-domain. Cycling C2C12 cells: n = 4, ± s.e.m.; differentiating C2C12 cells: n = 3 independent experiments, ± s.e.m. Total number of cells counted > 150. Significances were computed by one-way ANOVA followed by Bonferroni-Holm Posthoc in reference to wt: var3 p = 0.13 (cycling) and p = 0.87 (differentiated), var4 p = 0.09 (cycling) and p = 0.60 (differentiated), var8 p = 0.04 (cycling) and p = 0.04 (differentiated). c, d Analysis of mobility of Mef2D higher-order assemblies in nuclear foci (c) and cytoplasmic foci (d). Mobility was assessed by fluorescence recovery after photobleaching (FRAP) performed after 24 hours post-transfection of GFP-tagged MEF2D wt, var3, var4 and var8 in C2C12 cells. The mean of the FRAP curve +/- standard error of the mean (s.e.m.) is shown. c Number of nuclear foci analyzed: wt (3); var3 (3); var4 (3); var8 (3). d number of cytoplasmic aggregates analyzed: wt (11); var3 (10); var4 (10); var8 (9). All Mef2D proteins show high mobility inside the nuclear foci (c) and nucleoplasm (Supplementary Fig. 5b). This is in sharp contrast with the low mobility inside cytoplasmic foci (d).

In addition, we observed cytoplasmic foci reminiscent of higher-order structures24 (Fig. 4a). In contrast to the nuclear condensates, the cytoplasmic foci exhibited low mobility (Fig. 4d), indicating solid-like states. The percentage of cells displaying cytoplasmic higher-order assemblies was significantly higher for var8 with rigid β-domain, both in cycling and differentiating myoblasts compared to wild-type Mef2D (Fig. 4b). Surprisingly, we also observed that var4 with mobile β-domain tends to promote the formation of cytoplasmic aggregates in cycling cells (Fig. 4b). The increased propensity of var8 and var4 to form higher-order structures was not due to higher expression levels, since we found similar protein levels in C2C12 cells (Supplementary Fig. 4a).

As both var8 and var4 promoted the early phase of myotube development, we reasoned that ordered higher-order assemblies facilitate myogenesis. In accord, we found a negative correlation between the transcription activity in non-differentiating cells and the probability of β-domain to form liquid-like condensates (Supplementary Table 2).

Structure and dynamics of Mef2D model peptides

To provide molecular insights how the β-domain modulates the Mef2D higher-order assembly, we have employed different NMR methods and molecular dynamics simulations (Methods) using a 37-residue peptide model of the wild-type Mef2D and representative variants (var3, var4 and var8) containing the β-domain and its flanking regions (UniProt code: Q14814, 265-301 residues, Fig. 1b).

Order parameters (S2) derived from the backbone chemical shifts based on the Random Coil Index (RCI)39 indicated the disordered nature of all peptides (Supplementary Fig. 6a). var8 exhibited an increased ordering in particular at D29 and W31 mutant residues. Higher R2/R1 values of var8, in particular at the C-terminal region suggested conformational exchange between compact and extended conformers corroborating partial ordering (Supplementary Fig. 6b). Diffusion ordered spectroscopy (DOSY) indicated a faster diffusion of var8 (D = 2.95*10−10 ± 1.15*10−10 m2/s) than the wild-type peptide (D = 1.54*10−10 ± 2.61*10−12 m2/s) suggesting more compact conformations (Supplementary Fig. 6c). In contrast, lower diffusion coefficient of var3 (Supplementary Fig. 6c) suggested more extended structures, consistently with the decreased order parameters (Supplementary Fig. 6a).

In accordance with the NMR data, molecular dynamics simulations indicated that the studied Mef2D model peptides (wild-type, var3, var4 and var8) sample a large regime of their conformational space (Supplementary Fig. 7a). In particular, the disordered Mef2D peptides adopt both compact and extended conformations (Supplementary Fig. 7b, Methods) and exhibit distinct contact patterns depending on their β-domain properties (Figs. 1c, 1d, Methods). The characteristic contacts in var8 model peptide are formed dominantly within the β-domain (56 % of all contacts), through a consecutive set of residues (Fig. 5a). The β-domain less frequently contributes to intra-molecular contacts in var4 and the wild-type peptide (34 % and 36% of the contacts, respectively) and is rarely involved in structure formation of var3 (Fig. 5a). In line with the NMR data, structure analysis indicates that var8 forms more compact structures (Fig. 5b, Supplementary Fig. 7b) mediated by hydrophobic contacts (Leu26 and Leu28 residues) and partly aromatic interactions (His25 and Trp31, Fig. 5b, Supplementary Fig. 7c). var4 can sample both compact conformations mediated by polar and aromatic contacts (Thr22, His25 and Asn30 residues), as well as extended conformations mediated by charge-charge interactions mostly with the C-terminal region (Glu23 and Arg33, Fig. 5b, Supplementary Fig. 7b and c). The compact conformations of the wild-type peptide were also mediated by hydrophobic interactions, which are less frequent than those in var8 (Fig. 5b, Supplementary Fig. 7b). In addition, the wild-type peptide also forms charge-charge interactions with the N-terminal region (eg. Asp27-Arg2, Fig. 5b). In contrast, var3 rarely samples compact conformations and forms some local, transient contacts at both the C- and N-terminal regions (Fig. 5b, Supplementary Fig. 7b).

Fig. 5. Representative structural features of Mef2D variant peptides from molecular dynamics simulations.

Fig. 5

Conformational analysis was performed using the 70-100 ns trajectory of each replica (9000 snapshots) (Methods). a Contacts maps of the clusters. Mef2D wt, var3, var4 and var8 peptides exhibit distinct intra-molecular interaction patterns (Methods). The β-domain (blue) contributes to structure organisation of var8 and to lesser extent to var4, while does not form persisting contacts in var3 (see also Supplementary Fig. 7). Color scales indicate the number of snapshots in the clusters, with the given contact sampled. b Representative structures of the of Mef2D variant peptides. More compact structures are formed through interactions of the β-domain (blue), such as in case of var8 and var4, while extended structures, such as in case of var3 sample variable interactions outside the β-domain. β-domain residues are displayed in blue, residues mutated in the different variants are orange labelled.

Structure analysis of model peptides suggests that different biophysical forces shape the conformational landscape of the Mef2D variants, and mutations in the β-domain remarkably change the structural variability and compactness of the peptide models.

Discussion

Elaborating the relationship between the protein state and its function presents a new paradigm in understanding of cellular processes40. Transcriptional programmes controlling cell-line identity are frequently regulated by high density of transcriptional apparatus41,42, often generating distinct compartments43. These transcriptional clusters, also termed as super-enhancers23, are stabilised by dynamic and heterogeneous interactions22. In general, the material states of such higher-order assemblies must be precisely controlled24,35. Solidifying the liquid-like state of a-kinase anchoring protein AKAP95, for example, has been shown to interfere with alternative splicing and initiate tumorigenesis44, while ASC interactions are conditioned to the hardening of NLRP6 condensates45.

Skeletal muscle development may also involve transcriptional clusters46 formed by myogenic proteins and Mef22,8. Proximity of their DNA-binding sites (Supplementary Fig. 8) promotes physical interactions between these factors8,10, which is required to activate transcription of muscle-specific genes46. We reasoned that the alternative spliced, acidic β-domain contributes to the orchestration of myogenic regulatory factors. Based on sequence analysis and structure predictions (Fig. 1), we anticipated that the β-domain serves as an ordered interaction element within the disordered transactivation region (Supplementary Fig. 1). Thus, by introducing mutations into the β-domain and its flanking region based on FuzDrop predictions, we aimed at modulating Mef2D higher-order assembly.

We have found a negative correlation between the transcriptional activity of the Mef2D variants and β-domain dynamics (Fig. 2, Supplementary Table 2); in particular rigid β-domain variants (var5var8) were more potent to activate transcription in C2C12 cells before differentiation (Fig. 2). Along these lines, the increased transcription activity of the rigid β-domain variants also promoted the early phase of myotube development (Fig. 3, Supplementary Fig. 3), also reflected by altered expression of MyoD and desmin (Fig. 3). Surprisingly, var4 with mobile β-domain also promoted transcription and early phase differentiation (Figs. 2, 3, Supplementary Fig. 3), without increasing the expression of myogenic regulatory proteins (Fig. 3).

We observed that Mef2D forms both nuclear and cytoplasmic foci (Fig. 4). The mobility of the nuclear foci in both C2C12 and U2OS cells resembled mobile nuclear condensates formed through liquid-liquid phase separation (Fig. 4c, Supplementary Figs. 4 and 6). In contrast, we observed the lack of mobility in the cytoplasmic foci (Fig. 4d), indicating the presence of solid-like aggregates. Formation of solid-like assemblies were promoted by var8 with rigid β-domain, as well as by var4 with mobile β-domain (Fig. 4b). var4 was predicted to spontaneously undergo liquid-liquid phase separation as well as to convert between liquid-like and solid-like states (Fig. 1d, Supplementary Table 1). The presence of higher-order structures with both liquid-like and solid-like characters may be explained by two molecular mechanisms. In the first scenario, these assemblies are formed independently, the liquid-like condensates through phase separation and the solid-like aggregates through ordered assembly or deposition33,34. In the second scenario, the maturation of the liquid-like condensates leads to the formation of solid-like aggregates. The distinct behaviors of the mobile β-domain variants var3 and var4 seem to be consistent with the second scenario. These two variants exhibit remarkably different cellular context-sensitivity as indicated by the droplet landscape (Fig. 1d). The context-dependent var4 is more potent to activate transcription and promotes differentiation as compared to the less context-dependent var3 (Figs. 2, 3), indicating that a transition of Mef2D between liquid-like and solid-like states may be required during myogenesis. We cannot exclude the possibility that the liquid-like and solid-like states are formed independently due to the different cellular milieu in the nucleus and cytosol. In this case, however, formation of these higher-order assemblies must be regulated through independent pathways during muscle cell differentiation. Instead, we favor the simpler model, in which the transition between the liquid-like and solid like states is required for potentiation of transcriptional programmes during myogenesis.

Based on these results, we propose that transcription potentiation of Mef2D is linked with its higher-order assembly, which enables simultaneous interactions with both the basal machinery and the myogenic factors to activate distinct gene expression programs for muscle lineage development. Our results support the model that Mef2D assemblies are formed by disordered interactions of the transactivation domain. The alternatively spliced β-domain serves as an ordered interaction element to stabilise the disordered assembly. The sensitivity of the β-domain and its flanking regions to the cellular context may facilitate switching between ordered and disordered interactions and, thereby, the adaptation of this segment to the cellular conditions during different stages of the muscle development. Along these lines, we observe both liquid-like and solid-like Mef2D assemblies in C2C12 cells, raising the possibility of their interconversion. The transcription activation and differentiation progress by the droplet-promoting and context-dependent var4, in contrast to the context-insensitive var3, conforms to this scenario. A similar mechanism likely operates during myofibrillogenesis to organise Z-disc formation by FATZ condensates47.

In summary, our results shed light on how dynamic properties of an alternatively spliced segment fine-tune Mef2D higher-order assembly to the cellular context, providing a complex regulatory mechanism for gene-expression during skeletal muscle development.

Methods

Computational design

We considered the human Mef2D sequence (UniProt code: Q14814; https://legacy.uniprot.org/uniprot/Q14814) and computed three residue-specific dynamics characteristics: i) structural disorder in the unbound state using the Espritz method (pD)30 as implemented into the FuzPred algorithm (https://fuzpred.bio.unipd.it) ii) disordered interactions as predicted by the FuzPred method (pDD)25 iii) droplet-promoting probability as predicted by the FuzDrop method (pDP)26 and we averaged the values of dynamics descriptors (pD, pDD, pDP) for the β-domain (residues 286-292). We introduced mutations in 286-301 residues and computed the differences between the mutant and wild-type β-domain dynamics: i) structural disorder ΔpD = pD(mut) - pD(wt); ii) disordered interactions ΔpDD = pDD(mut) - pDD(wt); iii) droplet-promoting probability ΔpDP = pDP(mut) - pDP(wt), where each probability value is the average of the respective probabilities of the β-domain residues. Mutations with largest impact on the β-domain ΔpD and with most diverse chemical nature were selected (Fig. 1B). We also considered the droplet-promoting probability (ΔpDP) and the multiplicity of binding modes (MBM) for ranking, to generate variants with distinct higher-order assembly31. The droplet landscape was used to inform on the cellular behavior of the higher-order assembly, in particular the likelihood of changing between liquid-like and solid-like higher-order assemblies33,34 (Fig. 1D). The variants included two sequences with similar β-domain dynamics to the wild-type (var1, var2), two variants with more mobile β-domain (var3, var4), and four variants with more rigid β-domain (var5 - var8) as compared to the wild-type (Figs. 1B, 1C, 1D). The dynamics characteristics of the variants are summarised in Supplementary Table 1.

Cell culturing and differentiation

HEK293 (human embryonic kidney) cells and mouse immortalized C2C12 myoblast cell lines (both from ATCC) were cultured in High Glucose DMEM (Biosera, Nuaille, France) supplemented with 10% fetal bovine serum (Gibco by Life Technologies, Carlsbad, California, USA), 1% Penicillin-Streptomycin (Gibco), and 1% L-glutamine (Biosera). The medium was changed every other day, and cells were sub-cultured at 80-90% confluence. The culturing media was exchanged to DMEM containing 2% horse serum (Gibco) to differentiate C2C12 myoblasts into multinucleated myotubes. Differentiation was followed by transmission microscopy for 6 days.

CRISPR-Cas9 experiments

C2C12 cells were transfected with MEF2D specific CRISPR/Cas9 knockout and HDR plasmid constructs, targeting 3 different places in coding sequence (in exon# 3, 4 and 5; Santa Cruz Technology, Dallas, TX, USA). Forty-eight hours after the lipid-mediated transfection puromycin selection (1.5 µg/ml) was applied for 5 days than single cells were sorted by the presence of GFP and PRF expressed from the KO and HDR vectors, respectively, using FACS Aria III flow cytometer (BD Biosciences). MEF2D-KO colonies were grown from individual single cells.

Determination of transcription activity, reporter plasmids

MEF2D variants with modified dynamical properties were cloned into pCMV-HA eukaryotic expression vector (Genscript, Piscataway, NJ, USA). To determine the transcriptional activity of Mef2D variants, MCK-Luc reporter plasmid (Addgene, Watertone, MA, USA) and pSV-β-galactosidase control vector (Promega) were used together with the variant plasmids. Control and MEF2D-KO cells (description for the generation of KO cultures is in the section above) were transfected with the vectors of the variants using Lipofectamine 2000 transfection reagent (Life Technologies, Carlsbad, CA, USA). 48 hours later luciferase and galactosidase activity were determined by Luciferase and β-galactosidase enzyme assays (both from Promega) following the manufacturer´s instructions. Luminescent and absorbance data were collected by Synergy H1 microplate reader to quantify the transcriptional activity of the samples. Microsoft Excel 2016 was used to process transcription and differentiation data.

Immunocytochemistry and calculation of fusion index

Cultured cells were fixed with 4% PFA followed by washing with 0.1 M glycine in PBS to neutralize excess formaldehyde. Cells were permeabilized with 0.25% Triton-X (Sigma-Aldrich) and blocked with PBS containing 1% BSA. The samples were incubated with primary antibodies (anti-desmin, 1:1000) diluted in blocking solution overnight at 4 °C. Following the application of fluorophore-conjugated secondary antibodies (Biotinylated anti-mouse IgG (1:300), Alexa Fluor 488 conjugated Streptavidin (1:100); both from Thermo Fisher Scientific) mounting medium containing DAPI (Vector Laboratories, Burlingame, USA) was added to each coverslip. Immunolabelled samples were investigated with a Zeiss LSM510 laser scanning confocal microscope (Zeiss, Oberkochen, Germany). Fusion index was quantified as the ratio of the nuclei number in myocytes with two or more nuclei versus the total number of nuclei within a visual field.

Immunofluorescence on cultured cells

C2C12 cells were grown on polylysine-coated glass coverslip. C2C12 cells were transfected using Lipofectamine 3000 (Life Technologies) following manufacturer instructions. 24 hrs post-transfection, cells were washed with cold PBS and fixed with 3.7% formaldehyde in PBS for 9 minutes at room temperature, followed by permeabilization with ice-cold acetone for 5 minutes at −20 °C. PBS containing 3% BSA and 0.1% Triton X-100 was used for blocking and incubation with primary (MEF2D, 14353-1-AP, Proteintech) and secondary antibodies (Alexa Fluor® 488, A‐21202, Thermo Scientific). Images were obtained using a Leica TCS-SP8 (Leica Microsystems) and a 63x oil immersion lens.

Western blot analysis

For Western blot analysis cells were harvested in lysis buffer, the protein content of samples was measured by a BCA protein assay (Pierce, Rockford, IL, USA). Protein samples were separated in 7.5% SDS–polyacrylamide gels, then transferred to nitrocellulose membranes (Whatman, Maidstone, England). After blocking non-specific binding sites, membranes were exposed to primary antibodies overnight at 4 °C as follows: mouse monoclonal anti-MEF2D (1:500; BD Biosciences, San Jose, CA, USA), monoclonal mouse myoD (Novus Biologicals, Abington, UK) antibody in 1:200 dilution, mouse monoclonal anti-desmin in 1:1000 dilution (BD Biosciences) and goat polyclonal anti-actin (1:250; Santa Cruz Biotechnology, Dallas, USA). Following incubation with horseradish peroxidase-conjugated, respective anti-goat or anti-mouse IgG antibodies (Bio-Rad, Hercules, CA, USA; 1:1000, 1 hour) the immunoreactive bands were visualized by enhanced chemiluminescence (Pierce or Millipore, Billerica, MA, USA). The optical density of signals was measured using a Kodak Gel Logic 1500 system and further analyzed by using ImageJ 1.40g freeware.

Confocal microscopy and Fluorescence recovery after photobleaching (FRAP) analysis

FRAP measurements on C2C12 and U2OS cells transfected with GFP-tagged Mef2D WT, var3, var4 and var8 were performed using a confocal microscope Leica TCS SP8 (Leica Systems). For FRAP analysis we used a 63x oil immersion objective. Bleaching was obtained by using a laser intensity of 100% at 405 nm for 1 s. Recovery was recorded for 120 time points after bleaching (120 s). Analysis of the recovery curves were carried out with the FIJI/ImageJ. Fluorescent density analysis was performed using FIJI/ImageJ and selecting specific region of interest (ROI). The flow of the protein was measured by quantifying the recovery of the bleached area at the cost of the unbleached region and using a custom written FIJI/ImageJ routine. The bleached region was corrected for general bleaching during image acquisition. We quantified the molecules that move from the unbleached region to the bleached region, leading to recovery of the bleached region. Prior to FRAP analysis, the images were corrected for drift using the StackReg plug‐in function of the FIJI software suite. The equation used for FRAP analysis is: ((Ibleach − Ibackground)/(Ibleach(t0) − Ibackground(to)))/((Itotal‐Ibackground)/(Itotal(t0) − Ibackground(to))), where Itotal is the fluorescence intensity of the entire cellular structure, Ibleach represents the fluorescence intensity in the bleach area, and Ibackground the background of the camera offset. FRAP curves were averaged to obtain the mean and standard error mean.

Graphics and statistics

Pooled data were expressed as mean ± standard error of the mean (SEM). The mean and SEM were calculated as weighted averages and weighted standard errors with weight corresponding to the number of samples and number of experiments. Box plots and line graphs were constructed using Origin 8.6 graphic software. In all box-plot type presentations the rectangles in the box plots present the median and the 25 and 75 percentile values, while the error bars point to 1 and 99%. The differences between control cultures and cells overexpressing Mef2D variants were assessed using one-way analysis of variance (ANOVA) and student’s t-test function of Microsoft Excel 2016, the significance and a p value of less than 0.05 was considered statistically significant. Vector graphics were prepared by Inkscape 0.92.5 (2060ec1f9f, 2020-04-08), https://www.inkscape.org.

Molecular Dynamics (MD) simulations

Model system

The starting models of the 37 residue peptides of the wild-type protein, var4 and var8 terminated by acetyl (ACE) and N-methyl (NME) groups were generated by the LEaP module of AMBERTools1748. The solute was neutralised by adding Na+ and Cl- ions randomly and then solvated by 12 Å of TIP3 water49. Periodic boundary conditions using a truncated octahedron geometry with cell edge of 151 Å was used with particle-mesh Ewald method50 for long-range electrostatic interactions and 8 Å non-bonded interaction cut-off. All simulations were performed using a Charmm36m force field, which was developed for intrinsically disordered proteins51.

Computational protocol

Extended conformations of the models were subjected to minimization by steepest descent and conjugate gradient methods. The system was heated from 0 K to 50 K in 50 ps using Langevin thermostat, then from 50 K to 310 K in 1 ns using Berendsen thermostat while applying a harmonic restraint of 4 kcal mol−12 for all atoms. Water density was adjusted to ~1 g/cm3 in 500 ps NPT simulation using Berendsen barostat, applying 1 kcal mol−12 restraint on the backbone atoms, which was then released for 1 ns NPT simulation. Then three independent 100 ns NPT simulations at 310 K and 1 bar were carried out for each model, with 2 fs timestep applying the SHAKE algorithm on the hydrogen geometry. Coordinates were saved in each 10 ps. The translational center of mass motions was removed in a wrapping procedure every 1000 steps.

MD analysis

The MD trajectories were analysed using the MDTraj Python package v1.9752. We considered the 70 to 100 ns trajectory of each replica based on the RMSD values in reference to the average structure (Supplementary Fig. 7). Radius of gyration of was computed based on the method developed for disordered proteins52, using MDTraj Python package. Clustering of the conformations of the disordered peptides was based on the contact map similarity31. Contacts were computed using GetContacts (https://getcontacts.github.io, commit: b0777f7148a327387133d9632f8ed1e34bfaa282). We defined the similarity between two contact maps as: fS=CiCj(CiCj)(CiCj), where Ci and Cj are the set of contacts in snapshot i and j, the numerator is the common contacts of the two sets and the denominator is the total number of different contacts of the two sets. We clustered two snapshots if fS > 0.5, and the clusters were joined based on the frequencies of the common contacts. For graphical clarity, we visualised contacts only in the four most populated clusters. The calculations were performed with Python (https://pypi.org) and Numpy (https://numpy.org) libraries, plots were prepared using the matplotlib python package (https://matplotlib.org/). Structure visualisation was done using PyMol (The PyMOL Molecular Graphics System, Version 2.0 Schrödinger, LLC).

NMR analysis

37-residue peptide sequences of the wild-type, var3, var4 and var8 containing the β-domain and its flanking residues (UniProt code: Q14814, 265-301 residues) were 15N labelled on leucines (as underlined SRKPDLRVITSQAGKGLMHHLTEDHLDLNNAQRLGVS). All NMR experiments were carried out on a Bruker Avance Neo (700 MHz 1H frequency) spectrometer equipped with a Prodigy TCI cryoprobe, and the temperature was set to 298 K. Chemical shifts were referenced to DSS. Peptides were dissolved in 5% D2O and 95% H2O 20 mM PBS buffer solution, with a final peptide concentration of 1 mM. For NMR data acquisition and evaluation, Bruker’s Topspin 4.0 software package was utilized.

NMR resonance assignment

2D correlation spectra, including 1H-1H TOCSY and 1H-1H ROESY with 15N decoupling, 13C-1H HSQC, and 13C-HSQC-TOCSY, 15N-1H HSQC, 15N-1H HSQC-TOCSY, and -ROESY.

Determination of order parameters (S2) from chemical shifts

Chemical shifts (Cα, Cβ, and Hα) were used to extract Random Coil Indices and NMR order parameters (S2). First, the offset-corrected data were converted to secondary shifts, then site-specific corrections were applied to calculate Random Coil Indices53. Residue order parameters (S2) were derived from the chemical shifts of Cα, Cβ, and Hα backbone atoms39.

Relaxation measurements

15N-relaxation data (T1, T2) were obtained by Bruker pseudo 3D 15N-1H correlation experiments with double INEPT-transfer and decoupling during acquisition. The relaxation delay times were set to 10, 20, 40, 80, 120, 160, 200, 300, 400, 600, 1200, and 2400 ms for T1 and the Carl-Purcell-Meiboom-Gill (CPMG) pulse trains of 17, 34, 51, 68, 85, 102, 119, 153, 204, 254, and 305 ms were used for T2-measurements. 64 increments were collected, and the number of transients was 8 for T1/T2-measurements and 80 for the heteronuclear (15N-1H) NOE experiment to obtain a proper S/N ratio. Reduced Spectral Densities54 and R2/R1 ratios of 15N nuclei of isotopically labeled leucine residues were derived from relaxation data (15N T1, T2 and NOE).

Diffusion ordered spectroscopy

(DOSY) Diffusion coefficients were derived from a measurement with a stimulated spin echo LED (Longitudinal-Eddy-current Delay) sequence with bipolar gradients and two spoil gradients55. The length of the diffusion delay (75 ms) and gradient pulses (2 ms) were optimized by short, one-dimensional (1D) experiments. The gradient strength was split to 32 increments, linearly varying between 5 % and 95 % of its maximum value. The maximum gradient strength of the probe was 57.7 G/cm. The number of scans was set to 16. Data processing was performed and 2D DOSY plots were generated by the dosy module of Topspin. Diffusion coefficients were calculated by an exponential fit of the signal intensity decays obtained with increasing gradient strength.

ChIP-Seq Protocol

C2C12 myoblasts and myotubes from late differentiation stage were cross-linked using disuccinimidyl glutarate (DSG, Sigma) followed by fixation with 1% methanol-free ultrapure formaldehyde (Thermo Scientific). After washing, cells were harvested in ChIP lysis buffer and centrifuged at 12,000g for 1 min at 4 °C. Resuspended chromatin samples were sonicated to get fragments between 100 and 2000bp. Chromatin IP was performed using anti-MEF2D antibody (NBP-1-80567, Novus Biologicals) with overnight incubation at 4 °C. Antibody-chromatin complex was centrifuged (3,500 rpm, 20 min, 4 °C), then samples were incubated with paramagnetic beads (Dynabeads Protein A, Thermo Scientific) for 6h at 4 °C. Antibody-chromatin-bead complexes were washed with different buffers, then DNA-protein complexes were eluted and de-cross-linked by adding NaCl (0.2 M). ChIPed DNA was purified using Qiagen MinElute columns and prepared for sequencing according to the manufacturer’s instructions (Illumina).

ChIP-seq data analysis

The library was sequenced at the Genomic Medicine and Bioinformatics Core Facility at the University of Debrecen, Hungary using single end 75 bp Illumina technology. The raw reads were aligned to the mm10 reference genome sequence using Burrows-Wheeler Aligner. The resulted file was further analyzed using the Homer approach56, involving the peak calling, the denovo motif finding and the annotation of the peaks and motifs under the peaks. The top 1000 peaks based on the Homer’s peak scores were analyzed for denovo motifs. The most enriched motifs, the hlf motif (https://jaspar.genereg.net/matrix/MA0043.2/), and the Mef2A motif were used to annotate the peaks in the Mef2D enhancer region. In addition to Mef2D, transcription factors binding to the creatine kinase gene (Mck) enhancer region were derived from the ChIPSummitDB database (https://summit.med.unideb.hu/summitdb/).

Reporting summary

Further information on research design is available in the Nature Portfolio Reporting Summary linked to this article.

Supplementary information

Reporting Summary (424.5KB, pdf)

Acknowledgements

This research was supported by AIRC IG 26229 (M.F.), AFM-Telethon project 23542 (S.C.) MDA project 952598 (S.C.), National Research, Development and Innovation Office of Hungary grants NKFI/ OTKA NN 128368 (K.E.K.), 2019-1.1.1-PIACI-KFI-2019-00109 (J.T., V.A.), Thematic Excellence Program grant TKP2021-NKTA-34 (B.E.), Hungarian Academy of Sciences HAS-11015 (M.F.), European Regional Development Fund projects GINOP-2.3.3-15-2016-00004 and GINOP-2.3.2–15-2016–00044), NKFI OTKA: K 137600 (L.C.) and K 132814 (B.E.). L.C. acknowledges the support by UD Scientific Excellence. S.C. acknowledges Dr. Jonathan Vinet and the microscopy facility CIGS for technical support.

Source data

Source data (1.3MB, xlsx)

Author contributions

Conceptualisation: M.F., Experiment design: S.C., M.G., K.E.K.; Data collection: M.G., L.M., F.A., Z.R., K.F., T.M.N., V.A., E.B., J.T.; Analysis of the results: M.G., J.M.C.T., S.B.V., K.F., E.B., L.C., S.C., M.F.; Visualisation: M.G., J.M.C.T., S.B.V., T.M.N., V.A., E.B., S.C.; Supervision: S.C., K.E.K., L.C., J.T., M.F.; Writing the original manuscript: M.F., M.G., K.E.K; Revising the manuscript: S.C., M.F.

Peer review

Peer review information

: Nature Communications thanks the other anonymous reviewer(s) for their contribution to the peer review of this work.

Data availability

Source data are provided with this paper. The data that support the findings are available in the data repository of University of Debrecen at 10.48428/ADATTAR/3RFQRC. ChIP-seq sequencing data can be accessed in the SRA database of NCBI project number PRJNA887931, and GEO accession code GSE224053. Transcription factors binding to the creatine kinase gene (Mck) enhancer region used for ChIP-seq data analysis were derived from the ChIPSummitDB database (https://summit.med.unideb.hu/summitdb/). Mef2D sequence was derived from the UniProt database (https://www.uniprot.org/) Q14814 (main isoform). NMR assignments have been deposited in BMRB database with the codes BMR51840 [10.13018/BMR51840] (wt), BMR51841 [10.13018/BMR51841] (var3), BMR51842 [10.13018/BMR51842] (var4), BMR51843 [10.13018/BMR51843] (var8). Molecular dynamics trajectories were deposited as 10.5281/zenodo.7657119. Source data are provided with this paper.

Code availability

The scripts used to process the trajectories and the results generated by MDTraj Software version 1.9.7 and GetContacts (https://getcontacts.github.io/commit:b0777f7) as well as to produce the plots used in the article are available: https://drive.google.com/drive/folders/1IDFZwTUmoCPy4T_B_AGRKCL2OQq_rZOC. The link also contains the processed MD trajectories used for analysis. The underlying libraries are: Python, Numpy (https://numpy.org) and matplotlib (https://matplotlib.org/).

Competing interests

The authors declare no competing interests.

Footnotes

Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Contributor Information

Serena Carra, Email: serena.carra@unimore.it.

Monika Fuxreiter, Email: monika.fuxreiter@unipd.it.

Supplementary information

The online version contains supplementary material available at 10.1038/s41467-023-37017-7.

References

  • 1.Hernández-Hernández JM, García-González EG, Brun CE, Rudnicki MA. The myogenic regulatory factors, determinants of muscle development, cell identity and regeneration. Semin Cell Dev. Biol. 2017;72:10–18. doi: 10.1016/j.semcdb.2017.11.010. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 2.Molkentin JD, Olson EN. Combinatorial control of muscle development by basic helix-loop-helix and MADS-box transcription factors. Proc. Natl Acad. Sci. USA. 1996;93:9366–9373. doi: 10.1073/pnas.93.18.9366. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Taylor MV, Hughes SM. Mef2 and the skeletal muscle differentiation program. Semin Cell Dev. Biol. 2017;72:33–44. doi: 10.1016/j.semcdb.2017.11.020. [DOI] [PubMed] [Google Scholar]
  • 4.Martin JF, et al. A Mef2 gene that generates a muscle-specific isoform via alternative mRNA splicing. Mol. Cell Biol. 1994;14:1647–1656. doi: 10.1128/mcb.14.3.1647. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Kim Y, et al. The MEF2D transcription factor mediates stress-dependent cardiac remodeling in mice. J. Clin. Invest. 2008;118:124–132. doi: 10.1172/JCI33255. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Dedieu S, Mazères G, Cottin P, Brustis JJ. Involvement of myogenic regulator factors during fusion in the cell line C2C12. Int J. Dev. Biol. 2002;46:235–241. [PubMed] [Google Scholar]
  • 7.Dodou E, Xu SM, Black BL. mef2c is activated directly by myogenic basic helix-loop-helix proteins during skeletal muscle development in vivo. Mech. Dev. 2003;120:1021–1032. doi: 10.1016/S0925-4773(03)00178-3. [DOI] [PubMed] [Google Scholar]
  • 8.Molkentin JD, Black BL, Martin JF, Olson EN. Cooperative activation of muscle gene expression by MEF2 and myogenic bHLH proteins. Cell. 1995;83:1125–1136. doi: 10.1016/0092-8674(95)90139-6. [DOI] [PubMed] [Google Scholar]
  • 9.Kaushal S, Schneider JW, Nadal-Ginard B, Mahdavi V. Activation of the myogenic lineage by MEF2A, a factor that induces and cooperates with MyoD. Science. 1994;266:1236–1240. doi: 10.1126/science.7973707. [DOI] [PubMed] [Google Scholar]
  • 10.Black BL, Molkentin JD, Olson EN. Multiple roles for the MyoD basic region in transmission of transcriptional activation signals and interaction with MEF2. Mol. Cell Biol. 1998;18:69–77. doi: 10.1128/MCB.18.1.69. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Davis RL, Weintraub H. Acquisition of myogenic specificity by replacement of three amino acid residues from MyoD into E12. Science. 1992;256:1027–1030. doi: 10.1126/science.1317057. [DOI] [PubMed] [Google Scholar]
  • 12.Sebastian S, et al. Tissue-specific splicing of a ubiquitously expressed transcription factor is essential for muscle differentiation. Genes Dev. 2013;27:1247–1259. doi: 10.1101/gad.215400.113. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Zhu B, Ramachandran B, Gulick T. Alternative pre-mRNA splicing governs expression of a conserved acidic transactivation domain in myocyte enhancer factor 2 factors of striated muscle and brain. J. Biol. Chem. 2005;280:28749–28760. doi: 10.1074/jbc.M502491200. [DOI] [PubMed] [Google Scholar]
  • 14.Ellis JD, et al. Tissue-specific alternative splicing remodels protein-protein interaction networks. Mol. Cell. 2012;46:884–892. doi: 10.1016/j.molcel.2012.05.037. [DOI] [PubMed] [Google Scholar]
  • 15.Buljan M, et al. Tissue-Specific Splicing of Disordered Segments that Embed Binding Motifs Rewires Protein Interaction Networks. Mol. Cell. 2012;46:871–883. doi: 10.1016/j.molcel.2012.05.039. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Sigler PB. Transcriptional activation. Acid blobs and negative noodles. Nature. 1988;333:210–212. doi: 10.1038/333210a0. [DOI] [PubMed] [Google Scholar]
  • 17.Tompa P, Fuxreiter M. Fuzzy complexes: polymorphism and structural disorder in protein-protein interactions. Trends Biochem Sci. 2008;33:2–8. doi: 10.1016/j.tibs.2007.10.003. [DOI] [PubMed] [Google Scholar]
  • 18.Graham TA, Ferkey DM, Mao F, Kimelman D, Xu W. Tcf4 can specifically recognize beta-catenin using alternative conformations. Nat. Struct. Biol. 2001;8:1048–1052. doi: 10.1038/nsb718. [DOI] [PubMed] [Google Scholar]
  • 19.Brzovic PS, et al. The acidic transcription activator Gcn4 binds the mediator subunit Gal11/Med15 using a simple protein interface forming a fuzzy complex. Mol. Cell. 2011;44:942–953. doi: 10.1016/j.molcel.2011.11.008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 20.Hatos A, Monzon AM, Tosatto SCE, Piovesan D, Fuxreiter M. FuzDB: a new phase in understanding fuzzy interactions. Nucleic Acids Res. 2021;50:D509–D517. doi: 10.1093/nar/gkab1060. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21.Fuxreiter M, et al. Malleable machines take shape in eukaryotic transcriptional regulation. Nat. Chem. Biol. 2008;4:728–737. doi: 10.1038/nchembio.127. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Chong S, et al. Imaging dynamic and selective low-complexity domain interactions that control gene transcription. Science. 2018;361:eaar2555. doi: 10.1126/science.aar2555. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Sabari BR, et al. Coactivator condensation at super-enhancers links phase separation and gene control. Science. 2018;361:eaar3958. doi: 10.1126/science.aar3958. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Wu H, Fuxreiter M. The Structure and Dynamics of Higher-Order Assemblies: Amyloids, Signalosomes, and Granules. Cell. 2016;165:1055–1066. doi: 10.1016/j.cell.2016.05.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Miskei M, Horvath A, Vendruscolo M, Fuxreiter M. Sequence-Based Prediction of Fuzzy Protein Interactions. J. Mol. Biol. 2020;432:2289–2303. doi: 10.1016/j.jmb.2020.02.017. [DOI] [PubMed] [Google Scholar]
  • 26.Hardenberg M, Horvath A, Ambrus V, Fuxreiter M, Vendruscolo M. Widespread occurrence of the droplet state of proteins in the human proteome. Proc. Natl Acad. Sci. USA. 2020;117:33254–33262. doi: 10.1073/pnas.2007670117. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Sormanni P, et al. Simultaneous quantification of protein order and disorder. Nat. Chem. Biol. 2017;13:339–342. doi: 10.1038/nchembio.2331. [DOI] [PubMed] [Google Scholar]
  • 28.Fuxreiter M. Fuzziness in Protein Interactions-A Historical Perspective. J. Mol. Biol. 2018;430:2278–2287. doi: 10.1016/j.jmb.2018.02.015. [DOI] [PubMed] [Google Scholar]
  • 29.Gianni S, et al. Fuzziness and Frustration in the Energy Landscape of Protein Folding, Function, and Assembly. Acc. Chem. Res. 2021;54:1251–1259. doi: 10.1021/acs.accounts.0c00813. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Walsh I, Martin AJ, Di Domenico T, Tosatto SC. ESpritz: accurate and fast prediction of protein disorder. Bioinformatics. 2012;28:503–509. doi: 10.1093/bioinformatics/btr682. [DOI] [PubMed] [Google Scholar]
  • 31.Barrera-Vilarmau S, Teixeira JMC, Fuxreiter M. Protein interactions: anything new? Essays Biochem. 2022;66:821–830. doi: 10.1042/EBC20220044. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Choudhary C, et al. Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009;325:834–840. doi: 10.1126/science.1175371. [DOI] [PubMed] [Google Scholar]
  • 33.Horvath A, Vendruscolo M, Fuxreiter M. Sequence-based Prediction of the Cellular Toxicity Associated with Amyloid Aggregation within Protein Condensates. Biochemistry. 2022;61:2461–2469. doi: 10.1021/acs.biochem.2c00499. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Vendruscolo M, Fuxreiter M. Sequence determinants of the aggregation of proteins within condensates generated by liquid-liquid phase separation. J. Mol. Biol. 2021;434:167201. doi: 10.1016/j.jmb.2021.167201. [DOI] [PubMed] [Google Scholar]
  • 35.Vendruscolo M, Fuxreiter M. Protein condensation diseases: therapeutic opportunities. Nat. Commun. 2022;13:5550. doi: 10.1038/s41467-022-32940-7. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Ran FA, et al. Genome engineering using the CRISPR-Cas9 system. Nat. Protoc. 2013;8:2281–2308. doi: 10.1038/nprot.2013.143. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Asher G, Reuven N, Shaul Y. 20S proteasomes and protein degradation “by default”. Bioessays. 2006;28:844–849. doi: 10.1002/bies.20447. [DOI] [PubMed] [Google Scholar]
  • 38.Zhu L, Brangwynne CP. Nuclear bodies: the emerging biophysics of nucleoplasmic phases. Curr. Opin. Cell Biol. 2015;34:23–30. doi: 10.1016/j.ceb.2015.04.003. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39.Cilia E, Pancsa R, Tompa P, Lenaerts T, Vranken WF. From protein sequence to dynamics and disorder with DynaMine. Nat. Commun. 2013;4:2741. doi: 10.1038/ncomms3741. [DOI] [PubMed] [Google Scholar]
  • 40.Fuxreiter M, Vendruscolo M. Generic nature of the condensed states of proteins. Nat. cell Biol. 2021;23:587–594. doi: 10.1038/s41556-021-00697-8. [DOI] [PubMed] [Google Scholar]
  • 41.Whyte WA, et al. Master transcription factors and mediator establish super-enhancers at key cell identity genes. Cell. 2013;153:307–319. doi: 10.1016/j.cell.2013.03.035. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Hnisz D, et al. Super-enhancers in the control of cell identity and disease. Cell. 2013;155:934–947. doi: 10.1016/j.cell.2013.09.053. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Cho WK, et al. Mediator and RNA polymerase II clusters associate in transcription-dependent condensates. Science. 2018;361:412–415. doi: 10.1126/science.aar4199. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44.Li W, et al. Biophysical properties of AKAP95 protein condensates regulate splicing and tumorigenesis. Nat. cell Biol. 2020;22:960–972. doi: 10.1038/s41556-020-0550-8. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45.Shen C, et al. Phase separation drives RNA virus-induced activation of the NLRP6 inflammasome. Cell. 2021;184:5759–5774.e20. doi: 10.1016/j.cell.2021.09.032. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46.Sandmann T, et al. A temporal map of transcription factor activity: mef2 directly regulates target genes at all stages of muscle development. Dev. cell. 2006;10:797–807. doi: 10.1016/j.devcel.2006.04.009. [DOI] [PubMed] [Google Scholar]
  • 47.Sponga A, et al. Order from disorder in the sarcomere: FATZ forms a fuzzy but tight complex and phase-separated condensates with alpha-actinin. Sci. Adv. 2021;7:eabg7653. doi: 10.1126/sciadv.abg7653. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.D. A. Case DSC et al. AMBER 2017 (University of California, San Francisco 2017).
  • 49.Jorgensen WL, Chandrasekhar J, Madura JD, Impey RW, Klein ML. COMPARISON OF SIMPLE POTENTIAL FUNCTIONS FOR SIMULATING LIQUID WATER. J. Chem. Phys. 1983;79:926–935. doi: 10.1063/1.445869. [DOI] [Google Scholar]
  • 50.Darden T, York D, Pedersen L. PARTICLE MESH EWALD - AN N.LOG(N) METHOD FOR EWALD SUMS IN LARGE SYSTEMS. J. Chem. Phys. 1993;98:10089–10092. doi: 10.1063/1.464397. [DOI] [Google Scholar]
  • 51.Huang J, et al. CHARMM36m: an improved force field for folded and intrinsically disordered proteins. Nat. Methods. 2017;14:71–73. doi: 10.1038/nmeth.4067. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Bernado P, Blackledge M. A self-consistent description of the conformational behavior of chemically denatured proteins from NMR and small angle scattering. Biophys. J. 2009;97:2839–2845. doi: 10.1016/j.bpj.2009.08.044. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Berjanskii MV, Wishart DS. A simple method to predict protein flexibility using secondary chemical shifts. J. Am. Chem. Soc. 2005;127:14970–14971. doi: 10.1021/ja054842f. [DOI] [PubMed] [Google Scholar]
  • 54.Kaderavek P, et al. Spectral density mapping protocols for analysis of molecular motions in disordered proteins. J. Biomol. NMR. 2014;58:193–207. doi: 10.1007/s10858-014-9816-4. [DOI] [PubMed] [Google Scholar]
  • 55.Wu DH, Chen AD, Johnson CS. An Improved Diffusion-Ordered Spectroscopy Experiment Incorporating Bipolar-Gradient Pulses. J. Magn. Reson. 1995;115:260–264. doi: 10.1006/jmra.1995.1176. [DOI] [Google Scholar]
  • 56.Heinz S, et al. Simple combinations of lineage-determining transcription factors prime cis-regulatory elements required for macrophage and B cell identities. Mol. Cell. 2010;38:576–589. doi: 10.1016/j.molcel.2010.05.004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Jumper J, et al. Highly accurate protein structure prediction with AlphaFold. Nature. 2021;596:583–589. doi: 10.1038/s41586-021-03819-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58.Hatos A, Tosatto SCE, Vendruscolo M, Fuxreiter M. FuzDrop on AlphaFold: visualizing the sequence-dependent propensity of liquid-liquid phase separation and aggregation of proteins. Nucleic Acids Res. 2022;50:W337–344. doi: 10.1093/nar/gkac386. [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Reporting Summary (424.5KB, pdf)

Data Availability Statement

Source data are provided with this paper. The data that support the findings are available in the data repository of University of Debrecen at 10.48428/ADATTAR/3RFQRC. ChIP-seq sequencing data can be accessed in the SRA database of NCBI project number PRJNA887931, and GEO accession code GSE224053. Transcription factors binding to the creatine kinase gene (Mck) enhancer region used for ChIP-seq data analysis were derived from the ChIPSummitDB database (https://summit.med.unideb.hu/summitdb/). Mef2D sequence was derived from the UniProt database (https://www.uniprot.org/) Q14814 (main isoform). NMR assignments have been deposited in BMRB database with the codes BMR51840 [10.13018/BMR51840] (wt), BMR51841 [10.13018/BMR51841] (var3), BMR51842 [10.13018/BMR51842] (var4), BMR51843 [10.13018/BMR51843] (var8). Molecular dynamics trajectories were deposited as 10.5281/zenodo.7657119. Source data are provided with this paper.

The scripts used to process the trajectories and the results generated by MDTraj Software version 1.9.7 and GetContacts (https://getcontacts.github.io/commit:b0777f7) as well as to produce the plots used in the article are available: https://drive.google.com/drive/folders/1IDFZwTUmoCPy4T_B_AGRKCL2OQq_rZOC. The link also contains the processed MD trajectories used for analysis. The underlying libraries are: Python, Numpy (https://numpy.org) and matplotlib (https://matplotlib.org/).


Articles from Nature Communications are provided here courtesy of Nature Publishing Group

RESOURCES