Abstract
Candida auris is a pathogenic fungus associated with high-mortality infections and forms resilient biofilms on various surfaces. In this study, we introduced a novel antifungal strategy against C. auris by integrating an AI-powered protein design tool, ProteinMPNN, with classical molecular dynamics (MD) simulations to design artificial proteins from a miniprotein library. This combined approach accelerated and enhanced the design process, enabling the rapid development of effective miniprotein inhibitors specifically targeting C. auris biofilm formation. The miniproteins developed in this study exhibited potent inhibitory effects on C. auris biofilms, representing a significant advancement in antifungal therapy. Notably, the combined application of these miniproteins enhanced suppression of biofilm formation. These findings highlight not only the strong therapeutic potential of these designed miniproteins but also the power of combining AI-driven protein design with MD simulations to advance biomedical research.
Keywords: Proteindesign, AI-driven protein engineering, Candida auris, antifungal
Introduction
The integration of artificial intelligence (AI) into protein engineering has led to a transformative era in protein design with far-reaching implications for research and pharmacology [1, 2]. AI-driven tools facilitate the development of protein binders for target proteins, akin to monoclonal antibodies, which are vital for fundamental research and the generation of novel therapeutics. Among these approaches, de novo protein design has gained prominence, offering the ability to identify unique protein binders specific to receptor proteins.
Advances in deep learning have markedly improved the ability to predict protein structures. Programs such as AlphaFold [3] and RosseTTAfold [4], powered by deep learning algorithms, can reliably predict the three-dimensional structures of proteins based on their amino acid sequences [3, 4]. Additionally, ProteinMPNN [5], another deep learning-driven tool, helps predict amino acid sequences from predetermined protein structure frameworks, with its effectiveness validated through both computational modeling and empirical studies [6]. ProteinMPNN demonstrates great potential in engineering proteins that specifically bind to target proteins, as it predicts sequences within multi-chain protein complexes while maintaining the sequence integrity of the target receptors.
Despite the groundbreaking advances offered by AI-based tools, traditional computational methods remain indispensable and serve as complementary approaches to AI innovations. Molecular dynamics (MD) simulations [7] are particularly notable in this regard. MD simulations offer a dynamic perspective by simulating protein behavior under various thermal and pressure conditions, providing insights into protein stability and flexibility [7]. These simulations complement AI-based predictive binding models by revealing conformational shifts that can refine and validate binding prediction.
Candida albicans and Candida auris are both pathogenic yeasts capable of causing infections in humans, particularly in immunocompromised individuals [8, 9]. C. auris exhibits high antifungal resistance in some clades [10, 11]. The antifungal resistance of C. albicans are increasing in certain regions although the majority of C. albicans clinical isolates worldwide remain sensitive to antifungal agents. For example, fluconazole resistance in C. albicans has been reported in approximately 3–8% of global isolates [12].
Both species are known for their ability to form resilient biofilms, which enhance their survival and complicate treatment efforts [13]. C. auris biofilms, in particular, exhibit higher resilience and adaptability in clinical settings, contributing to significant challenges in infection control. C. auris can cause a spectrum of infections ranging from superficial infections, such as wound or ear infections, to severe systemic infections like bloodstream infections (candidemia). Patients infected with C. auris, especially those with weakened immune systems, face high mortality rates [14, 15].
In C. albicans, biofilm formation is facilitated by virulence factors such as the agglutinin-like sequence (ALS) protein family, which plays a central role in cell adhesion and biofilm development. The ALS gene in C. albicans includes ALS1-ALS7 and ALS9. The Als proteins are divided into four distinct domains: the N-terminal (NT) domain, T domain, central tandem repeat (TR) domain, and C-terminal (CT) domain. The TR domain, characterized by a repeated arrangement of serine and threonine residues, is central to the protein’s structure and serves as a key criterion for differentiating the subfamilies within the ALS family proteins [16]. The NT domain is directly involved in the adhesion of Als proteins to various substrates and contains two immunoglobulin-like (Ig-like) domains with a peptide-binding cavity (PBC) between them [17, 18]. Additionally, a highly conserved amyloid-forming region (AFR) lies between NT and T domain, and is predicted to facilitate binding between Als proteins [19]. The T domain serves as a connector between the NT and TR domains, though its precise function and structure remain poorly understood. The CT domain contains a glycosylphosphatidylinositol (GPI) anchor addition sequence, which is crucial for anchoring Als proteins to the fungal cell wall [20].
Miniprotein scaffold libraries, such as those developed by Long et al. [21], represent a diverse collection of protein frameworks characterized by their small size (50–60 amino acids), remarkable stability, and potent drug-like properties. These miniproteins are particularly well-suited for biomedical applications, serving as inhibitors of protein-protein interactions or as agonistic and antagonistic drugs targeting specific receptor proteins. Their unique attributes make them promising candidates for therapeutic development, especially in challenging contexts where traditional small molecules or biologics may fall short.
Through extensive research, we identified significant sequence and structural homology between the ALS family proteins of C. albicans and C. auris. This discovery highlights Als proteins as central targets for antifungal therapy. In this study, we introduced a novel application of miniprotein design to develop specific inhibitors targeting C. auris biofilms. By leveraging the synergistic capabilities of ProteinMPNN and MD simulations, we successfully engineered miniproteins to disrupt the biofilm formation process in C. auris, representing a significant step forward in developing innovative antifungal therapies.
Material and Methods
Screening Binding Proteins from the Miniprotein Library Using PatchDock Module
The miniprotein library was downloaded from https://files.ipd.uw.edu/pub/robust_de_novo_design_minibinders_2021/supplemental_files/scaffolds.tar.gz [21]. PatchDock [22] was used to identify potential miniproteins that could bind to the target protein using a bash script (patchDockMulti). To parallelize this process, the 'parallel' command was implemented in a bash script (patchdock20). A separate bash script (crmsd) was used to select miniproteins that bound to a specific site of interest on the target protein.
Obtaining the Amino Acid Sequence Using ProteinMPNN Module
Using the coordinates of the miniprotein and target protein complex, the amino acid sequence of the miniprotein in complex with the target protein was determined using ProteinMPNN [5] in a script (mpnn). The generated sequences were evaluated for accurate 3D structure formation using ESMFold [6]. Sequences with a pLDDT value below 0.7 were discarded. The structures generated by ESMFold were superimposed onto the miniprotein structure input to ProteinMPNN using pTM-align [24], and RMSD values were calculated. Structures with RMSD values greater than 1.0 Å were rejected. Finally, the complex structure of the ProteinMPNN-generated miniprotein and target protein was obtained. Thirty complex structures were selected for the next step by visual inspection using PyMol [23].
Binding Analysis of Energy Minimized Complexes Using GROMACS Module
The complex structures obtained through the ProteinMPNN module were energy-minimized using the GROMACS [25], and their binding scores were evaluated using, PRODIGY [26]. Subsequently, an MD simulation for 10-ns was conducted using GROMAC, and the resulting MD simulated complex structure was assessed using PRODIGY. Finally, the binding scores of the initial energy-minimized complex and MD simulated complex were compared. The absolute scores and improvements in scores owing to the MD simulation were analyzed to select the final three candidates.
BLAST Analysis of C. albicans ALS3, C. albicans ALS9 in C. auris
To identify C. albicans ALS homologs in C. auris, the Basic Local Alignment Search Tool for Proteins (BLASTp) was used. The N-terminal domain sequence of C. albicans Als3 protein was derived from the crystal structure (PDB code: 4LE8), covering residues 18-316 [27]. The N-terminal domain sequence of C. albicans Als9 protein was obtained from its crystal structure (PDB code: 2Y7L), covering residues 18–329 [18]. These sequences were used as queries to search for similar sequences in C. auris (taxid: 498019), identifying homologous sequences for C. albicans Als proteins in C. auris. To compare with the N-terminal domains of CaAls3 and CaAls9, the sequence of CJJ09 (residues 1–329) was aligned and its sequence similarity was calculated.
Plasmid Construct and Protein Expression of the Miniproteins
The sequences of the designed miniproteins Als3_1224, Als3_3743, and Als9_1390 were codon optimized for expression in E. coli and synthesized by Gene Synthesis Services (Sangon Biotech, China) (Table 1). All miniprotein sequences were cloned into the pET28a vector (Merck, USA) using the NcoI and XhoI restriction sites. The recombinant miniprotein constructs were transformed into E. coli BL21(DE3) cells for protein overexpression and purification. Transformed cells were cultured in 1.5 L of LB medium containing 50 μg/ml kanamycin at 37°C until the optical density at 600 nm (OD600) reached 0.6. Protein overexpression was induced by adding 0.5 mM isopropyl-β-D-thiogalactoside (IPTG) to the medium, followed by incubation at 30°C for 6 h. The cells were then harvested by centrifugation at 5,500 ×g and stored at -80°C in a deep freezer until further purification.
Table 1.
Amino acid sequences for miniproteins.
Miniprotein | Sequence |
---|---|
Als3_1224 | GGYYKLVGKAVELGLPVTELMALISQASAQAGGDATATLAILAELLEAAGYPELAALVREALASS |
Als3_3743 | GLMADLQNLLLMYQRTGDPEYLKKVAQLALKAAGSEAAAEKMIAELVATLGLPAEVEKALKALLK |
Als9_1390 | LQAGLQVTQLCIEALQLARTDGAAAKAKLAQAKAVATAANNPALVAKVDATGALL |
Purification of the Miniproteins
Harvested E. coli cells expressing each miniprotein were resuspended in 50 ml lysis buffer (20 mM Tris-HCl pH 8.0, 150 mM NaCl) and lysed using a French press at 23 kpsi. The cell lysate was then centrifuged at 13,000 rpm for 30 min at 4°C to remove cell debris. The clarified lysate was incubated with Ni-NTA agarose resin (1 ml; Qiagen, Germany) by rolling at 4°C for 1 h. Unbound materials were removed from the resin by washing with 250 ml of wash buffer (20 mM Tris-HCl pH 8.0, 150 mM NaCl, 20 mM imidazole pH 8.0). Bound proteins were subsequently eluted with 20 ml of elution buffer (20 mM Tris-HCl pH 8.0, 150 mM NaCl, 250 mM imidazole pH 8.0). Subsequently, anion exchange chromatography was performed using a 5 ml HiTrap Q HP column (Cytiva) with a gradient from 0 mM to 1 M NaCl for elution. Als3_1224 was eluted at 300–450 mM NaCl, and Als9_1390 eluted at 200–350 mM NaCl, while Als3_3743 did not bind to the column (Fig. S1). Each eluted fraction or unbound solution was concentrated to a final volume of 5 mL using a Millipore centrifugal concentrator (3 kDa molecular weight cutoff; Millipore, USA). The purified protein solution was subsequently concentrated with a Millipore centrifugal concentrator (3 kDa molecular weight cutoff; Millipore) and stored at -80°C until further use.
Crystal Violet Biofilm Quantification Assay
Cells of C. auris (B8441), C. albicans (SC5314), and C. neoformans (H99) wild-type strains were cultured overnight at 30°C in 2 ml YPD liquid medium, washed twice with H2O, and resuspended in MOPS-buffered RPMI-1640 media (pH 7.4 with 0.165 M MOPS and 2% glucose). For the crystal violet assay, the cell suspension was prepared with a concentration equivalent to an OD600 of 0.5. Subsequently, 200 μl of the cell suspension was loaded into each well of a 96-well plate, each inhibitor was treated at a concentration of 10 μM, and the cultures were incubated at 37°C and 220 rpm for 1 day. The next day, the cell suspension was removed, and the samples were completely dried in a dry oven at 65°C. To each well, 150 μl of a 0.3% crystal violet solution was added, and the samples were stained at room temperature for 10 min. Subsequently, the crystal violet solution was completely removed, and the wells were washed three times with ddH2O. The samples were dried in an oven at 65°C. Next, 200 μl of 33% acetic acid was added to each well, and the crystal violet was dissolved completely for 1 min. The solution was transferred to a clean 96-well plate, and the absorbance was measured at OD595.
For the experiments involving C. auris biofilm treated with miniproteins at concentrations ranging from 1 nM to 5 μM, as well as in double and triple combinations, C. auris cells were cultured and harvested using the same method described earlier. And 200 μl of the cell suspension was loaded into each well of a 96-well plate. Subsequently, each inhibitor was tested at concentrations of 1 nM, 10 nM, 100 nM, 1 μM, 2 μM, and 5 μM. For combination treatments, each miniprotein was applied at a concentration of 1 μM. The quantification of biofilm formation using crystal violet staining was conducted as previously described.
Results
A Proposed Workflow for Identifying Miniproteins for Receptor Proteins
To develop protein binders, we employed miniproteins [21] as the foundational scaffolds. Miniproteins are designed to adopt specific, stable folds; however, they lack inherent binding specificity. Therefore, a specialized workflow is essential to engineer these miniproteins into receptor-specific binders with high affinity and selectivity.
To address this, we propose a workflow consisting of three consecutive modules: PatchDock, ProteinMPNN, and GROMACS. The first step, the PatchDock module, generates initial complex PDB files of receptor proteins and miniproteins, which have not yet been optimized for binding. PatchDock, a tool developed 20 years ago, primarily searches for docking solutions based on shape complementarity between ligands and receptor proteins, excluding electrostatic interactions [22]. This approach is particularly suitable at this stage because the miniproteins are still unrefined for binding to the target receptor. For this module, we randomly selected approximately 5,000 miniproteins from the scaffold library to use as ligand proteins in PatchDock. For each miniprotein, the top five docking solutions were ranked based on the distance between the center of mass of the miniprotein and the target site on the receptor protein. To refine the results, we prescreened the complex structures based on both distance and PatchDock scores, reducing the dataset to around 200 complexes. At this stage, called Checkpoint 1, we examined the structures using PyMoL [23] to ensure their viability for further optimization. This structural review resulted in the selection of approximately 100 complexes, which were progressed to the next module (Fig. 1).
Fig. 1. Workflow for the Design and Selection of Miniprotein Binders.
The workflow is divided into three modules: PatchDock, ProteinMPNN, and GROMACS module. The five Checkpoints are indicated as numbers in the circles. All scripts used in this study are available at https://github.com/snufoodbiochem/miniprotein_design/tree/master/miniscripts_ver0.1 (A) PatchDock module: The target receptor protein and a miniprotein library consisting of approximately 26,000 PDB files were input into PatchDock [22], which generated initial complex PDB files with five complexes produced per miniprotein using script patchdock20. Complexes in which the miniprotein bound to the receptor protein with a high binding score at the site of interest were selected at Checkpoint 1. (B) ProteinMPNN module: The complex PDB files were used as inputs for ProteinMPNN [5]. The receptor PDB is designated as the fixed chain, while the miniprotein is treated as the designed chain, generating the "designed miniprotein sequences" optimized for receptor binding. To verify whether the ProteinMPNNgenerated sequences could form the intended miniprotein structures, ESMFold [6] was utilized (scripts mpnn and ef_run). Sequences with a pLDDT value of less than 0.7 in ESMFold are rejected at Checkpoint 2. The designed miniprotein PDB files were combined with the receptor PDB file using the structural alignment program mTM-align [24], resulting in a complex PDB files containing the designed miniproteins using the script ef_align. Complex PDB files were rejected if the binding mode or position changed significantly (for example, RMSD values > 1.0 Å). (C) GROMACS module: The complex PDB files were input into the MD simulation program GROMACS (gmx) [25]. During MD simulation, the complex PDB files underwent energy minimization to determine the relaxed conformation at the binding interface. The PRODIGY program [26] was used to estimate the binding affinity energy (Kd) values. Complex PDB files with Kd values higher than 10-6 are rejected at Checkpoint 4. 10 ns MD simulations were performed on the energy-minimized PDB file using GROMACS (gmx). PRODIGY was used to estimate the binding energies or Kd values. Complex PDB files were rejected at Checkpoint 5 if the binding affinity decreased after the 10 ns MD simulation. Finally, the designed miniproteins in the complex were visually inspected using PyMOL [23], and the PDB files of one to three candidates were selected in the final step.
The second module, ProteinMPNN module, involved the sequential execution of ProteinMPNN [5] and ESMFold [6], and mTM-align [24] to optimize the sequences of the miniproteins binding to the receptor proteins. The sequences of the miniproteins in the complex generated by Checkpoint 1 were refined using the AI-driven program ProteinMPNN [5]. This step was automated using a bash script, which specified the chain ID of the ligand miniprotein for sequence design while keeping the receptor protein unchanged. After generating optimized sequences, we validated whether the predicted sequences of the miniprotein retained the original backbone structure using ESMFold [6], a protein structure prediction tool based on a large language model. Proteins with pLDDT (predicted Local Distance Difference Test) values below 0.7 were rejected at Checkpoint 2 (Fig. 1), as these values indicated insufficient structural confidence. Because ESMFold resets the origin and orientation of the PDB file during prediction, we realigned the miniprotein PDB files with the original complex PDB files from the initial PatchDock results. This realignment was performed using mTM-align [24]. Complexes showing significant differences between the original and the predicted miniproteins were rejected at Checkpoint 3 (Fig. 1).
In the final module, we incorporated MD simulations using the GROMACS program [25] to assess the strength of protein-protein interactions. MD simulations, combined with AI-driven protein-prediction tools, play pivotal roles in protein engineering by providing insights into protein functions and behaviors. The energy of the complex structure, comprising the receptor and ligand proteins generated by ESMFold, was minimized using the GROMACS program. Subsequently, we conducted a 10 ns MD simulation to study the dynamics of the complex. The binding strengths of the energy-minimized structure and the structure obtained after the 10 ns MD simulation were then compared. We utilized the predicted dissociation constant (Kd) values, calculated using PRODIGY [26], and the changes in Kd values after the MD simulation to assess the binding abilities of the designed miniprotein binders (Fig. 1). This analysis provided critical metrics for evaluating the efficacy of the miniproteins in formatting stable interactions with their target receptors.
Sequence Similarity of C. auris CJJ09 to NT Domain of C. albicans Als3 and Als9 Proteins
C. auris possesses ALS homologs that may share similar structural features with those in C. albicans, although further studies are required to fully elucidate these functions. Our analysis identified that the NT domain of CJJ09_005316 (called CJJ09 in this study) from C. auris exhibits the highest sequence similarity to the corresponding domain of C. albicans Als3 protein (Fig. 2A) [27]. Similarly, the NT domains of CJJ09 from C. auris showed the highest sequence similarity to the NT domain of C. albicans Als9 protein (Fig. 2B) [18]. The alignment of the NT sequences revealed that CJJ09 shares 74.0% similarity with the N-terminal Als3 protein, and 73.9%similarity with the N-terminal Als9 protein. These findings establish CJJ09 as ALS homologs in C. auris, potentially performing roles analogous to ALS3 and ALS9 in C. albicans.
Fig. 2. Amino acid sequences and the peptide binding cavities (PBC) of Als3 protein and Als9 protein from C. albicans.
(A) Sequence alignment of the N-terminal domains of Als3 and Als9 from C. albicans and the N-terminal domain of the ALS3/ALS9 homologue (CJJ09) from C. auris. Sequence alignment was performed using ClustalX [38] and ESPript server [39]. (B) Crystal structures of the N-terminal domains of Als3 (PDB code: 4LE8 [27]) and Als9 (PDB code: 2Y7L [18]). The PBC is indicated by the circles in the broken lines.
Design of Miniproteins for Binding C. albicans Als3 Protein
To inhibit biofilm formation by C. albicans and C. auris, we focused on the Als3 and Als9 proteins from C. albicans to develop specific protein binders. Als3 protein plays crucial roles in C. albicans' adhesion to host cells, biofilm formation, and iron acquisition from the host, all of which are vital for its pathogenicity. The NT domain of Als proteins, which is highly conserved across Candida species, is directly involved in adhesion to host cells [20, 28]. Given its functional importance, we selected Als proteins as targets for miniprotein design, focusing on the structure and sequence of their NT domain.
The crystal structure of the wild-type Als3 protein from C. albicans (CaAls3, PDB code: 4LE8) has been used, which encompasses the sequence of the NT domain (residues 1-299) [27]. A key feature of the PBC in the protein is an invariant lysine residue at its terminus, which stabilizes interactions by forming a salt bridge with the C-terminal carboxyl group of peptide ligands. Previous studies have underscored the importance of PBC in facilitating the adhesion of C. albicans to host cells and other abiotic surfaces (Fig. 2B) [27, 29].
To design miniproteins, we used PatchDock [22] to dock CaAls3 with 2,000 randomly selected members from a miniprotein library. Based on the PatchDock scores, we selected the top 200 miniprotein sequences that are bound to the PBC. We then optimized these sequences using ProteinMPNN [5], fixing CaAls3 to the binary complexes. The resulting sequences were confirmed by ESMFold [6], and miniproteins with root-mean-square deviation (RMSD) values exceeding 1 Å (as determined by mTM-align [24]) were excluded.
Next, MD simulations were performed using GROMACS program [25] to refine the CaAls3-miniprotein complexes. The complex structures were energy-minimized, equilibrated, and subjected to a 10 ns MD simulation. We then compared the estimated Kd values between the energy-minimized and MD-simulated structures, using PRODIGY [26]. Complexes with Kd values exceeding 10-9 M or those whose Kd values increased after MD simulation were excluded. After thoroughly reviewing the complex structures, we identified two promising candidates: Als3_1224 and Als3_3743 (Fig. 3A and 3B). These miniproteins are expected to function as strong potential inhibitors of CaAls3, targeting their role in biofilm formation and pathogenicity.
Fig. 3. The complex models of the Als3 (pink, green) and Als9 (bright blue) N-terminal domain and their miniprotein binders.
The complex models were built by structural superposition based on the GROMACS output. (A) The miniprotein binder Als3_1224 (pink) binds to the PBC of Als3 from C. albicans. (B) The miniprotein binder Als3_3743 (green) binds to the PBC of Als3 from C. albicans. (C) The mini-protein binder Als9_1390 (bright blue) binds to the PBC of Als9 from C. albicans.
Design of Miniprotein for Binding C. albicans Als9 Protein
The Als9 protein contributes to adhesion in C. albicans, although its role is a less prominent role than Als3 protein [28, 30]. Given the known crystal structure of C. albicans Als9 protein, we sought to develop miniproteins targeting this structure. As C. auris has a homologous counterpart to C. albicans Als9 protein, these miniproteins may also effectively disrupt biofilm formation in C. auris.
Using the same approach as in designing CaAls3 binding miniproteins, we designed miniproteins targeting the NT domain of the Als9 protein from C. albicans (CaAls9, PDB code: 2Y7L) [18]. The CaAls9 NT domain structure used in this study included a bound fibrinogen-γ peptide. To create miniproteins that inhibit the binding of this peptide binding PBC, we omitted the bound fibrinogen-γ peptide from the structure and designed binders targeting the PBC. Through PatchDock module, we selected top miniproteins from our library based on their binding affinities. Miniproteins that effectively blocked access to the PBC were prioritized for further analysis. After identifying the optimal binding positions, we generated amino acid sequences for the miniproteins using the ProteinMPNN module. Structural refinement and validation were carried out using ESMFold [6], mTM-align [24], and GROMACS program [25] from the GROMACS module, as previously described. Miniproteins with a PRODIGY [26] score greater than 10-9 M or those whose Kd values increased after MD simulation in the GROMACS module were excluded. Following a thorough examination of the complexes, we selected miniprotein called Als9_1390 as the final candidate due to its exceptional performance. This miniprotein exhibited a Kd value of 0.18 nM after a 10-ns MD simulation, highlighting its strong binding affinity to CaAls9 (Fig. 3C).
Biofilm Formation Inhibition in Pathogenic Fungi by Designed Miniproteins
The effects of Als proteins inhibitors on biofilm formation were assessed using a crystal violet biofilm quantification assay [31] in three major pathogenic fungi: C. albicans (SC5314), C. auris (B8441), and C. neoformans (H99). Biofilm formation was quantified after treatment with the Als protein inhibitors Als3_1224, and Als3_3743, and Als9_1390, each at a concentration of 10 μM.
The Als protein inhibitors significantly reduced biofilm formation in both C. auris and C. albicans (Fig. 4). However, these inhibitors had no significant effect on C. neoformans, which lack ALS genes. Interestingly, the miniproteins designed for Als proteins in C. albicans demonstrated greater efficacy in inhibiting C. auris biofilms. We hypothesized that the target of these miniproteins is likely CJJ09, given their sequential similarity of CaAls3 and CaAls9.
Fig. 4. Inhibition of biofilm formation in major pathogenic fungi by Als inhibitors.
Biofilms of C. auris, C. albicans, and C. neoformans were treated with Als3_1224, Als3_3743, and Als9_1390 (10 μM) for 24 h, followed by crystal violet staining. The absorbance of the destaining solution was measured at 595 nm under all treatment conditions. Statistical analysis was conducted using a one-way ANOVA with Bonferroni’s multiple comparison test against the control group (* p < 0.05; ** p < 0.01; *** p < 0.001; **** p < 0.0001).
To assess the inhibitory potency, the effects of the miniproteins on C. auris biofilm formation were tested across a range of concentrations. Increasing the concentration of the miniproteins led to progressively greater reductions in biofilm formation (Fig. 5A). Statistical analysis of miniprotein treatments ranging from 1 nM to 5 μM revealed that Als3_1224, Als3_3743, and Als9_1390 achieved 50% biofilm formation at a concentration of 1 μM. This concentration-dependent inhibition underscores the therapeutic potential of miniproteins in modulating C. auris biofilm development (Fig. 5A).
Fig. 5. Dose-dependent and additive effects of miniproteins on C. auris biofilm formation.
(A) The dosedependent effects of miniproteins on C. auris biofilm formation. Biofilm formation was measured using crystal violet staining at various concentrations. (B) The effects of combinatorial treatments of miniproteins (1 μM each) on C. auris. Biofilm formation levels were assessed using crystal violet staining. Statistical analysis was conducted using one-way ANOVA with Bonferroni’s multiple comparison test against the control (*, p < 0.05; **, p < 0.01; ***, p < 0.001; ****, p < 0.0001).
Given these promising results, we further examined the combined effects of the miniproteins on C. auris biofilm formation. Co-treatment with Als3_1224, Als3_3743, and Als9_1390 enhanced biofilm inhibition compared to individual treatments (Fig. 5B). While a single miniprotein treatment at 1 μM reduced biofilm formation by approximately 50%, the combination of two miniproteins at 1 μM each achieved a 70% reduction in biofilm formation. Moreover, the treatment combining all three miniproteins at 1 μM each resulted in an 80% reduction in biofilm formation. These findings suggest an additive effect of the miniproteins, highlighting the overlapping functions of Als proteins in C. auris biofilm formation. Our results indicate that blocking a single Als protein is insufficient to fully prevent biofilm formation in C. auris. However, simultaneously targeting multiple Als proteins significantly amplifies their inhibitory effect, making this a promising strategy for managing C. auris biofilm development.
Discussion
Numerous methods have been developed to design proteins that specifically bind to target proteins [32-36]. Our study introduces a novel approach for selecting miniprotein binders from a miniprotein library and optimizing their protein sequences using programs like PatchDock [22], ProteinMPNN [5], ESMFold [6], and MD simulations. This integrated workflow enabled the development of miniprotein inhibitors targeting C. auris biofilm formation, demonstrating potent inhibitory effects. This combined approach significantly enhanced biofilm suppression and underscored the therapeutic potential of the designed miniproteins and the effectiveness of integrating AI-driven programs with MD simulations in biomedicine.
Interestingly, the designed miniproteins exhibited greater efficacy against C. auris than C. albicans. This difference may be attributed to variations in the polymorphic forms of these two species. C. albicans can exist in yeast, pseudohyphal, and true hyphal forms, which enhance their adaptability and pathogenic potential. This polymorphic nature allows C. albicans to survive and thrive under diverse environmental and host conditions including fluctuations in temperature, pH, oxygen, and carbon dioxide levels. Conversely, while C. auris can also transition between yeast and hyphal forms, its polymorphism is less pronounced, especially with respect to true hyphal formation [37]. This reduced morphological complexity may explain why the miniproteins were more effective against C. auris, although further studies are needed to confirm this observation.
Despite these promising results, current miniprotein design techniques face notable limitations. One major challenge lies in designing miniproteins with dissociation constants (Kd) in the nanomolar range, which is critical for achieving high-affinity binding to target proteins. The inability to routinely design miniproteins with such strong binding affinities highlights a significant technological gap in the field. Advancing miniprotein design to overcome this limitation will require the development of new algorithms and methodologies, potentially incorporating enhanced molecular dynamics simulations, advanced AI models, or hybrid approaches that combine computational and experimental techniques.
Our findings align with the growing recognition of C. auris as a major fungal pathogen, primarily because of its high antifungal resistance and ability to spread in healthcare settings. These results provide valuable insights into the role of the Als protein family in C. auris and highlight the potential of using combinations of miniproteins as a more effective strategy to inhibit biofilm formation. This approach could pave the way for the development of novel therapeutic strategies targeting C. auris infections, which are notoriously difficult to treat with conventional antifungal therapies owing to the protective nature of biofilms.
In summary, the integration of AI-driven protein design with MD simulations represents a promising avenue for developing innovative antifungal agents. By targeting biofilm formation through precise miniprotein inhibitors, this approach offers a new direction for combating infections caused by C. auris and other biofilm-forming pathogens.
Supplemental Materials
Supplementary data for this paper are available on-line only at http://jmb.or.kr.
Acknowledgments
This research was supported by the Korea Institute of Planning and Evaluation for Technology in Food, Agriculture, Forestry and Fisheries (IPET), funded by Ministry of Agriculture, Food and Rural Affairs (MAFRA)(RS-2021-IP321036 to N.-C.H.). This research was also supported by the Bio & Medical Technology Development Program of the National Research Foundation (NRF) funded by the Ministry of Science & ICT (RS-2024-00344154 to N.-C.H.). Furthermore, this work was supported by the National Research Foundation of Korea funded by the Korean government (MSIT) (2021R1A2B5B03086596, 2021M3A9I4021434, 2018R1A5A1025077 to Y.-S.B.).
Footnotes
Conflict of Interest
The authors have no financial conflicts of interest to declare.
References
- 1.Eisenstein M. AI-enhanced protein design makes proteins that have never existed. Nat. Biotechnol. 2023;41:303–305. doi: 10.1038/s41587-023-01705-y. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2.Ding W, Nakai K, Gong H. Protein design via deep learning. Brief. Bioinform. 2022;23:bbac102. doi: 10.1093/bib/bbac102. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Jumper J, Evans R, Pritzel A, Green T, Figurnov M, Ronneberger O, et al. Highly accurate protein structure prediction with AlphaFold. Nature. 2021;596:583–589. doi: 10.1038/s41586-021-03819-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 4.Baek M, DiMaio F, Anishchenko I, Dauparas J, Ovchinnikov S, Lee GR, et al. Accurate prediction of protein structures and interactions using a three-track neural network. Science. 2021;373:871–876. doi: 10.1126/science.abj8754. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Dauparas J, Anishchenko I, Bennett N, Bai H, Ragotte RJ, Milles LF, et al. Robust deep learning-based protein sequence design using proteinMPNN. Science. 2022;378:49–56. doi: 10.1126/science.add2187. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Lin Z, Akin H, Rao R, Hie B, Zhu Z, Lu W, et al. Evolutionary-scale prediction of atomic-level protein structure with a language model. Science. 2023;379:1123–1130. doi: 10.1126/science.ade2574. [DOI] [PubMed] [Google Scholar]
- 7.Hollingsworth SA, Dror RO. Molecular dynamics simulation for all. Neuron. 2018;99:1129–1143. doi: 10.1016/j.neuron.2018.08.011. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Odds FC. Pathogenesis of Candida infections. J. Am. Acad. Dermatol. 1994;31:S2–S5. doi: 10.1016/S0190-9622(08)81257-1. [DOI] [PubMed] [Google Scholar]
- 9.Jeffery-Smith A, Taori SK, Schelenz S, Jeffery K, Johnson EM, Borman A, et al. Candida auris: a review of the literature. Clin. Microbiol. Rev. 2018;31:10.1128/cmr.00029-00017. doi: 10.1128/CMR.00029-17. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Costa-de-Oliveira S, Rodrigues AG. Candida albicans antifungal resistance and tolerance in bloodstream infections: the triad yeast-host-antifungal. Microorganisms. 2020;8:154. doi: 10.3390/microorganisms8020154. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Kim JS, Cha H, Bahn YS. Comprehensive overview of Candida auris: an emerging multidrug-resistant fungal pathogen. J. Microbiol. Biotechnol. 2024;34:1365–1375. doi: 10.4014/jmb.2404.04040. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Forsberg K, Woodworth K, Walters M, Berkow EL, Jackson B, Chiller T, et al. Candida auris: the recent emergence of a multidrug-resistant fungal pathogen. Med. Mycol. 2018;57:1–12. doi: 10.1093/mmy/myy054. [DOI] [PubMed] [Google Scholar]
- 13.Mayer FL, Wilson D, Hube B. Candida albicans pathogenicity mechanisms. Virulence. 2013;4:119–128. doi: 10.4161/viru.22913. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Sherry L, Ramage G, Kean R, Borman A, Johnson EM, Richardson MD, et al. Biofilm-forming capability of highly virulent, multidrug-resistant Candida auris. Emerg. Infect. Dis. 2017;23:328–331. doi: 10.3201/eid2302.161320. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Malinovská Z, Čonková E, Váczi P. Biofilm formation in medically important Candida Species. J. Fungi. 2023;9:955. doi: 10.3390/jof9100955. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Hoyer LL, Green CB, Oh S-H, Zhao X. Discovering the secrets of the Candida albicans agglutinin-like sequence (ALS) gene family - a sticky pursuit. Med. Mycol. 2008;46:1–15. doi: 10.1080/13693780701435317. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Sheppard DC, Yeaman MR, Welch WH, Phan QT, Fu Y, Ibrahim AS, et al. Functional and structural diversity in the Als protein family of Candida albicans. J. Biol. Chem. 2004;279:30480–30489. doi: 10.1074/jbc.M401929200. [DOI] [PubMed] [Google Scholar]
- 18.Salgado PS, Yan R, Taylor JD, Burchell L, Jones R, Hoyer LL, et al. Structural basis for the broad specificity to host-cell ligands by the pathogenic fungus Candida albicans. Proc. Natl. Acad. Sci. USA. 2011;108:15775–15779. doi: 10.1073/pnas.1103496108. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Otoo HN, Lee KG, Qiu W, Lipke PN. Candida albicans Als adhesins have conserved amyloid-forming sequences. Eukaryot. Cell. 2008;7:776–782. doi: 10.1128/EC.00309-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Zhao X, Daniels KJ, Oh S-H, Green CB, Yeater KM, Soll DR, et al. Candida albicans Als3p is required for wild-type biofilm formation on silicone elastomer surfaces. Microbiology. 2006;152:2287–2299. doi: 10.1099/mic.0.28959-0. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Cao L, Coventry B, Goreshnik I, Huang B, Sheffler W, Park JS, et al. Design of protein-binding proteins from the target structure alone. Nature. 2022;605:551–560. doi: 10.1038/s41586-022-04654-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Schneidman-Duhovny D, Inbar Y, Nussinov R, Wolfson HJ. PatchDock and SymmDock: servers for rigid and symmetric docking. Nucleic Acids Res. 2005;33:W363–W367. doi: 10.1093/nar/gki481. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.DeLano WL. Pymol: an open-source molecular graphics tool. CCP4 Newsl. Protein Crystallogr. 2002;40:82–92. [Google Scholar]
- 24.Dong R, Peng Z, Zhang Y, Yang J. mTM-align: an algorithm for fast and accurate multiple protein structure alignment. Bioinformatics. 2017;34:1719–1725. doi: 10.1093/bioinformatics/btx828. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Pronk S, Páll S, Schulz R, Larsson P, Bjelkmar P, Apostolov R, et al. GROMACS 4.5: a high-throughput and highly parallel open source molecular simulation toolkit. Bioinformatics. 2013;29:845–854. doi: 10.1093/bioinformatics/btt055. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Xue LC, Rodrigues JP, Kastritis PL, Bonvin AM, Vangone A. PRODIGY: a web server for predicting the binding affinity of protein-protein complexes. Bioinformatics. 2016;32:3676–3678. doi: 10.1093/bioinformatics/btw514. [DOI] [PubMed] [Google Scholar]
- 27.Lin J, Oh SH, Jones R, Garnett JA, Salgado PS, Rusnakova S, et al. The peptide-binding cavity is essential for Als3-mediated adhesion of Candida albicans to human cells. J. Biol. Chem. 2014;289:18401–18412. doi: 10.1074/jbc.M114.547877. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Liu Y, Filler SG. Candida albicans Als3, a multifunctional adhesin and invasion. Eukaryot. Cell. 2011;10:168–173. doi: 10.1128/EC.00279-10. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Oh SH, Hoyer LL. Assessing Als3 peptide-binding cavity and amyloid-forming region contributions to Candida albicans invasion of human oropharyngeal epithelial cells. Front. Cell Infect. Microbiol. 2022;12:890839. doi: 10.3389/fcimb.2022.890839. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Muñoz JF, Welsh RM, Shea T, Batra D, Gade L, Howard D, et al. Clade-specific chromosomal rearrangements and loss of subtelomeric adhesins in Candida auris. Genetics. 2021;218:iyab029. doi: 10.1093/genetics/iyab029. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31.Wilson C, Lukowicz R, Merchant S, Valquier-Flynn H, Caballero J, Sandoval J, et al. Quantitative and qualitative assessment methods for biofilm growth: a mini-review. Res. Rev. J. Eng .Technol. 2017;6 http://www.rroij.com/open-access/quantitative-andqualitative-assessment-methods-for-biofilm-growth-a-minireview-.pdf ., Epub 2017 Oct 24. [PMC free article] [PubMed] [Google Scholar]
- 32.Sha F, Salzman G, Gupta A, Koide S. Monobodies and other synthetic binding proteins for expanding protein science. Protein Sci. 2017;26:910–924. doi: 10.1002/pro.3148. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 33.Stumpp MT, Binz HK, Amstutz P. DARPins: a new generation of protein therapeutics. Drug Discov. Today. 2008;13:695–701. doi: 10.1016/j.drudis.2008.04.013. [DOI] [PubMed] [Google Scholar]
- 34.Löfblom J, Feldwisch J, Tolmachev V, Carlsson J, Ståhl S, Frejd FY. Affibody molecules: engineered proteins for therapeutic, diagnostic and biotechnological applications. FEBS Lett. 2010;584:2670–2680. doi: 10.1016/j.febslet.2010.04.014. [DOI] [PubMed] [Google Scholar]
- 35.Ahmad ZA, Yeap SK, Ali AM, Ho WY, Alitheen NB, Hamid M. scFv antibody: principles and clinical application. Clin. Dev. Immunol. 2012;2012:980250. doi: 10.1155/2012/980250. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 36.Shimamoto G, Gegg C, Boone T, Quéva C. Peptibodies: a flexible alternative format to antibodies. MAbs. 2012;4:586–591. doi: 10.4161/mabs.21024. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Yue H, Bing J, Zheng Q, Zhang Y, Hu T, Du H, et al. Filamentation in Candida auris, an emerging fungal pathogen of humans: passage through the mammalian body induces a heritable phenotypic switch. Emerg. Microbes Infect. 2018;7:188. doi: 10.1038/s41426-018-0187-x. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 38.Thompson JD, Gibson TJ, Higgins DG. Multiple sequence alignment using ClustalW and ClustalX. Curr. Protoc. Bioinform. Chapter 2: Unit 2 3. 2002. [DOI] [PubMed] [Google Scholar]
- 39.Robert X, Gouet P. Deciphering key features in protein structures with the new ENDscript server. Nucleic Acids Res. 2014;42:W320–W324. doi: 10.1093/nar/gku316. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.