Skip to main content
npj Biomedical Innovations logoLink to npj Biomedical Innovations
. 2026 Apr 9;3:27. doi: 10.1038/s44385-026-00082-w

Peptide-based targeted drug delivery strategies for osteoarthritis treatment

Bill Hakim 1, Hengli Zhang 1, Andrew Selvadoss 2, Ambika Bajpayee 1,2,✉
PMCID: PMC13065784  PMID: 42032264

Abstract

Peptide-based strategies offer promising solutions to overcome the complex, multi-tissue barriers of osteoarthritis. Their tunability, specificity, and versatility enable targeted drug delivery to cartilage, synovium, and subchondral bone, while some therapeutic peptides provide intrinsic anti-inflammatory, regenerative, or analgesic effects. Advances in peptide design, stability engineering, and in silico screening, alongside emerging human joint-on-chip models, are accelerating the development of targeted, stable, multi-tissue OA therapies.

Subject terms: Biotechnology, Computational biology and bioinformatics, Drug discovery

Introduction

Osteoarthritis (OA) remains without a cure, owing to the dual challenges of its complex, multi-tissue pathogenesis and the challenging barriers to effective drug delivery within the joint. OA is now recognized as a whole-joint disease, driven by dynamic crosstalk among multiple tissues, each exhibiting distinct pathological phenotypes1. While cartilage degradation and synovial inflammation are commonly addressed hallmarks of OA, other joint components, including subchondral bone (SB), fat pad, ligament, meniscus, and synovial fluid (SF), also contribute critically to disease progression and must be addressed for comprehensive intervention2. These diverse tissues create unique physicochemical and structural barriers that complicate the delivery of therapeutics, whether by intra-articular (IA) or systemic routes (Fig. 1). IA administration offers improved local bioavailability and reduced systemic exposure compared to systemic dosing. However, its pharmacokinetics are limited by rapid joint clearance, competitive binding with SF, enzymatic degradation, and restricted penetration through dense extracellular matrices (ECMs)3. Conversely, systemic administration enables delivery to vascularized tissues, including the synovium and subchondral bone, but suffers from poor joint specificity, enzymatic degradation, and rapid systemic clearance3. Together, these challenges underscore the pressing need for drug delivery systems capable of achieving efficient, tissue-specific distribution and retention within the joint.

Fig. 1. Challenges in drug delivery for OA treatment.

Fig. 1

Therapeutics for OA can be administered via IA or systemic injection, depending on the target tissue. IA delivery enables localized treatment of avascular cartilage but faces challenges including enzymatic degradation, competitive binding with SF constituents, rapid clearance through capillary and lymphatic drainage, and hindrance by the dense extracellular matrix, limiting tissue penetration (red arrow). Systemic administration can target vascularized tissues such as synovium and subchondral bone yet minimizing off-target delivery to other organs, maintaining drug stability in circulation, and achieving targeted joint accumulation remain major obstacles (green arrow). These challenges severely limit the bioavailable drugs delivered to the target tissue for therapeutic benefits (black arrow).

Among emerging strategies, peptides offer a uniquely versatile platform for targeted drug delivery. Their tunable amino acid sequences can be rationally designed to exhibit high affinity and specificity toward distinct tissue or cellular targets4,5. Positioned between small molecules and large biologics, peptides strike an ideal balance: offering superior surface interactions and stability relative to small molecules, while avoiding immunogenicity, limited tissue penetration, and high production costs that often constrain biologics. Their modularity further enables integration into diverse formulations like targeting ligands or carriers, and in some cases, they can function as therapeutics themselves. Collectively, these attributes highlight peptides as a powerful and adaptable class of agents for overcoming joint transport barriers and advancing next-generation OA therapies6. This review focuses on peptides for OA treatment, specifically those that enable targeted drug delivery to distinct joint tissues and possess intrinsic therapeutic activity addressing key OA pathophysiology mechanisms, including impaired anabolism, inflammation, and pain.

Discovery and synthesis

Two complementary strategies underpin the discovery of targeting peptides: library-based screening and rational design (Fig. 2). Library-based screening involves screening/biopanning of phage display’s random peptide library or well-defined peptide library against the target of interest. The majority of peptides used to target cartilage, synovium, and SB were identified through this technique. In contrast, rational design relies on mechanistic understanding of binding interactions to engineer peptides with defined physicochemical or structural features. This strategy often exploits dominant biophysical properties of the target tissue—such as charge, hydrophobicity, or matrix affinity—or adapts motifs derived from binding domains of natural proteins.

Fig. 2. Discovery of targeting and therapeutic peptides.

Fig. 2

Targeting peptides can be identified through library-based screening or rational design. In library-based screening, random or predefined peptide libraries are screened against ECM components, cells, tissues, or in vivo systems to isolate peptides with high affinity and specificity. Phage display is the most widely used method, in which bacteriophages displaying random peptides undergo iterative biopanning against a target. Rational design leverages dominant biophysical features—such as the anionic GAG network of cartilage or the cationic HAP of bone—or adapts known binding motifs from natural proteins (e.g., the heparin-binding domain of porcine EGFR or repetitive residues from bone binding proteins) to confer tissue-specific affinity for the peptide. Therapeutic peptides can be identified by analyzing differential protein expression between healthy and osteoarthritic cartilage, followed by interaction-network analysis to pinpoint candidate sequences. Additionally, drugs used in non-joint indications may be repurposed for OA interventions.

Therapeutic peptides for OA are frequently inspired by endogenous bioactive peptides that possess intrinsic anti-inflammatory, regenerative, or analgesic effects. Candidate sequences are often identified through comparative analyses of protein expression and molecular interaction networks involved in OA pathogenesis, which help pinpoint peptides with potential disease-modifying activity (Fig. 2). Following their discovery, optimization typically focuses on enhancing peptide pharmacokinetics and stability further elaborated in the next section.

Two common methods are used for peptide synthesis: solid-phase peptide synthesis (SPPS) and recombinant expression. SPPS remains the dominant method, providing precise control over sequence composition through iterative coupling and deprotection of amino acids on a solid resin support, followed by cleavage of the completed peptide from the resin. This approach is highly efficient for synthesizing short to medium-length peptides (typically < 50 residues) and allows the incorporation of noncanonical amino acids or chemical modifications. In contrast, recombinant expression leverages the cell’s translational machinery and is generally preferred for producing long peptides or peptide-protein fusions, where SPPS becomes inefficient. Both approaches permit the incorporation of modifications, some of which are method-specific, to improve peptide targeting and therapeutic performance.

Application: targeting peptide

The joint provides multiple tissue targets for OA therapy, including cartilage, synovium, and SB, which collectively drive disease progression. Targeting peptides can be incorporated into drug delivery systems through diverse strategies: covalent conjugation to therapeutic payloads, complex formation as peptide-payload assemblies, genetic fusion with protein therapeutics, or surface/scaffold functionalization of nano or microscale carriers.

Cartilage

Cartilage is essential for joint biomechanics, providing a low-friction, load-bearing surface. In OA, elevated pro-inflammatory and catabolic mediators, coupled with reduced anabolic activity, lead to structural deterioration, owing to ECM degradations, and chondrocyte dysfunction (Fig. 3a). Chondrocytes, being the sole resident cells, represent prime therapeutic targets yet are difficult to access due to their sparse distribution within a dense ECM. Conversely, the abundance of ECM constituents, such as collagens, aggrecan, and hyaluronic acid (HA), presents multiple accessible binding targets (Table 1).

Fig. 3. Cartilage: tissue phenotype in OA and examples of targeting peptides.

Fig. 3

a Schematic illustration of healthy versus OA cartilage, highlighting key structural and compositional alterations and potential molecular targets within the tissue. b(i) CPC exhibited strong intra-cartilage accumulation and retention for up to 7 days in a rabbit OA model after IA injection. Reprinted with permission from Elsevier, copyright 202520. b(ii) CPC-modified exosomes were able to fully penetrate cartilage thickness (left; red: AlexFluor647) and enabled GFP mRNA transfection in a rat OA model following IA injection (right; green: GFP). Reprinted with permission from Wiley, copyright 202424. c An 8-arm PEG system incorporating COLBP and HABP demonstrates localization to degenerated cartilage of a mouse OA model following IA injection (left: IHC of biotin-tagged peptide, brownish red; right: Safranin O staining). Reprinted with permission from Elsevier, copyright 201836. d(i) CAP-PEI complexes delivered GFP plasmids to cartilage following IA injection in healthy rat (blue: Hoechst 33258; green: GFP). Reprinted with permission from Elsevier, copyright 201138. d(ii) CAP-modified exosomes exhibited prolonged joint retention up to 6 days post-IA injection in rat joints, indicated by near-infrared signal. Reprinted with permission from Elsevier, copyright 202440.

Table 1.

Cartilage targeting peptides and their applications

Target Peptide Discovery Application Outcomes Citation
Collagen II WYRGRL; COLBP In vitro phage display Carrier functionalization: Functionalized poly(propylene sulfide) nanoparticle Higher accumulation of nanoparticle in cartilage ECM compared to random peptide modification 9
Peptide-drug conjugate: Modified tetrapodal DOTAM tethered with cathepsin D inhibitor Prolonged retention in rat knee for at least 7 days 112
Peptide-peptide conjugate: HA binding peptide (HABP)-COLBP with multi-arm PEG linker Reduced the expression of inflammatory genes, pain, and cartilage degradation in OA mice 36
Peptide-drug conjugate: COLBP-Dexamethasone Improved dexamethasone efficacy in OA cartilage explant by prolonged intra-cartilage retention 113
Carrier functionalization: Rapamycin and bilirubin-loaded functionalized nanoparticle Suppressed inflammation and showed cartilage protection effect in OA rat 10
Collagen XII DLQYWYPIWDTH; C5-24 In vitro phage display Peptide-contrast agent conjugate: Superparamagnetic iron oxide (SPIO)-C5-24 Enabled arthritic cartilage detection in OA pig 11
Peptide-ECM conjugate: HA-C5-24 Optimum cartilage lubrication effect on human OA cartilage explants and OA rat
Peptide-coated MSCs enhanced tissue repair in an arthritis rat model
Aggrecan RRRR(NNRRR)3R; CPC + 14 N Rational Design: electrostatic interactions with GAG Peptide-drug conjugate: CPC-Insulin-Like Growth factor-1 (IGF-1) Prolonged protection against matrix degradation in cartilage explant OA model by a single dose 21
Peptide-drug conjugate: CPC-Interleukin-1 Receptor Antagonist (IL-1Ra) Prolonged protection against matrix degradation in cartilage explant OA model by a single dose 22
Carrier functionalization: Surface-modified exosome for IL-1Ra delivery Enabled IL-Ra delivery to suppress cartilage matrix degradation in cartilage explant OA model 25
Carrier functionalization: Surface-modified exosome for IL-1Ra delivery Enabled mRNA delivery to articular chondrocytes of OA mouse 24
(RRAAAA)3RR; CPC + 8 Peptide-contrast agent conjugate: CPC- ioxaglate (IOX) Enhanced IOX intra-cartilage transport at lower dosage for CT imaging 28
GSGVPINVRCRGSR-DCLDPCRRAGMRFGR-CINSRCHCTP; Cysteine Dense Peptide (CDP) In vivo library screening Peptide-drug conjugate: CDP-triamcinolone acetonide (TAA) Localized distribution in cartilage and intervertebral disc (IVD) and reduced inflammation in OA rat 30
ε-Poly-l-lysine Rational Design: electrostatic interactions with GAG Peptide-drug conjugate: Kartogenin-ε-Poly-l-lysine Improved OA histological score and collagen II expression in OA rat 11
Carrier functionalization: Surface-modified mesenchymal stem cell-derived small extracellular vesicles Enhanced intra-cartilage transport, improved cartilage histology, and reduced pain response in OA rat 114
Poly-lysine; Branched Poly-lysine (BPL) Rational Design: electrostatic interactions with GAG Peptide-drug conjugate: BPL-methylprednisolone Prolonged retention in healthy mouse joint 115
Peptide-ECM conjugate: HA-BPL Adhered to cartilage and showed effective cartilage lubrication properties 116
Heparin Sulfate-GAG KKKRKGKGLG-KKRDPCLKKY Rational Design: known heparin binding (HB) domain of EGF (epidermal growth factor-like growth factor) Peptide-protein fusion: HB-IGF-1 Enhanced intra-cartilage retention and cartilage protection effect of IGF-1 in OA rat 117
HA GAHWQFNALTVR; HABP1 In vitro phage display Carrier functionalization: Functionalized PEG hydrogel Enhanced cartilage formation in OA rat 37
Peptide-peptide conjugate: HABPs-COLBP with multi-arm PEG linker Reduced the expression of inflammatory genes, pain, and cartilage degradation in OA mouse 36
RYPISRPRKRC; HABP2 Rational Design: homolog to proteoglycan link protein
STMMSRSHKTRSHHV Rational Design: homolog to Receptor for Hyaluronan-mediated Motility (RHAMM) protein Direct application: peptide-high molecular weight HA (HMWHA) supplementation Supplementation to IL-1-stimulated chondrocyte culture showed anti-inflammatory effect 118
Chondrocyte DWRVIIPPRPSA; Chondrocyte Affinity Peptide (CAP) In vitro phage display Peptide-payload complex: Polyethylenimine-CAP/plasmid (GFP and luciferase) complex Enhanced intra-cartilage transport enabling plasmid transfection into chondrocytes of healthy rat 38
Carrier functionalization: Surface-modified exosome for mir-140, MMP-13 siRNA, and antisense oligonucleotides (ASO) delivery Targeted cartilage delivery and prolonged joint retention, which enhanced payload efficacy in OA rat 39,40,119

Collagen constitutes roughly two-thirds of cartilage dry weight, with 90–95% being type II collagen, characterized by triple-helix domains rich in polar and hydrophobic residues7. Its unique structural motifs enable specific binding, particularly by peptides8. The collagen-binding peptide (COLBP; WYRGRL), identified by phage display, integrates charge and hydrophobicity for selective binding9. COLBP-decorated poly(propylene sulfide) nanoparticles localized in healthy rat cartilage following IA injection, while COLBP-modified mesoporous polydopamine nanoparticles enabled targeted delivery of reactive oxygen species (ROS) scavengers in rat OA joints10. Disease-induced ECM remodeling also creates new binding targets (Fig. 3a). The phage display-selected peptide C5-24 (DLQYWYPIWDTH) binds upregulated collagen XII in arthritic cartilage11. When conjugated to superparamagnetic iron oxide, C5-24 enabled MRI visualization of degenerated cartilage in a porcine OA model, and when linked to HA, it enhanced cartilage homing and lubrication versus HA alone.

Aggrecan, the proteoglycan “bottlebrush” densely decorated with glycosaminoglycans (GAGs), is the primary source of cartilage’s high negative fixed charge density12. This electrostatic environment not only imparts exceptional compressive load-bearing capacity but also drives strong Donnan-mediated uptake of cationic drug carriers13. Although aggrecan is among the first cartilage ECM components degraded during OA pathogenesis14, the remaining aggrecan-GAGs can still exhibit strong Donnan-mediated uptake of cationic carriers, enabling higher intra-cartilage accumulation compared to neutral counterparts15–17. Cationic peptide carriers (CPCs), arginine-rich peptides engineered for highly distributed positive charge and minimal hydrophobicity17, exemplify this principle, exhibiting rapid intra-cartilage penetration and prolonged retention16,18,19. In a rabbit OA model, CPCs achieved full-depth cartilage penetration and remained detectable for up to seven days after a single intra-articular injection20 (Fig. 3b (i)). These enhanced targeting properties of CPCs have been utilized to facilitate the delivery of protein therapeutics for sustained suppression of matrix degradation in a cartilage explant OA model21,22. CPCs can also be used to functionalize exosomes, imparting a positive surface charge that enhances transport through negatively charged tissues5,23. CPC-decorated exosomes demonstrated efficient tissue targeting and enabled deep-cartilage GFP mRNA transfection in rat OA joints (Fig. 3b (ii))24, and have been successfully used to deliver therapeutic cargo to cartilage25. Beyond cartilage, CPC-modified exosomes have also enabled delivery to other charge-dense tissues, including mucus26 and vitreous humor27. Additionally, owing to their rapid intra-cartilage penetration, CPCs are also well-suited to enhance imaging applications as exemplified by CPC–IOX which produced equivalent cartilage CT signals at 40-fold lower doses than free IOX28. Beyond CPCs, other cationic systems also exploit charge-based targeting. Cationic ε-poly-L-lysine improved kartogenin efficacy in a rat OA model after IA injection and potentially imparted protease resistance through its noncanonical residues29. In contrast to the rational design of CPC and ε-poly-L-lysine, cysteine-dense peptides (CDPs) were identified from a toxin library screening for peptide with the highest accumulation in cartilage after IV injection30. Their disulfide-stabilized structures preserved positive surface charge and resisted proteolysis in circulation. Intravenous doses of CDP–triamcinolone conjugate reduced arthritic rat joint inflammation while minimizing systemic steroid exposure. Extending beyond peptides, cationic proteins such as GFP and avidin also serve as viable platforms for cartilage-targeted drug delivery15,31–33.

Hyaluronic acid (HA), another negatively charged ECM component, can be targeted using HA-binding peptides (HABPs), which are generally cationic and enriched in polar residues enabling electrostatic and hydrogen-bonding interactions. HABPs such as GAHWQFNALTVR and RYPISRPRKRC were discovered through phage display34 or derived from link protein sequences35. Their use in OA therapy has shown promise when combined with other targeting motifs or scaffold functional groups. For example, a hybrid HABP-COLBP peptide-polymer localized in degenerated cartilage and other joint tissues of a mouse OA model following IA injection (Fig. 3c), resulting in slowed OA progression36. HABP-functionalized PEG hydrogels implanted in rat osteochondral defects enhanced cartilage formation compared with unmodified hydrogels37.

Chondrocytes. Chondrocyte affinity peptide (CAP; DWRVIIPPRPSA) enables direct targeting of chondrocytes38. Identified via phage display, CAP leverages both positive charge and hydrophobicity to interact with amphiphilic membrane domains, exhibiting ~30-fold higher binding than the scrambled control peptide. CAP-modified polyethylenimine (PEI) complexes successfully transfected green fluorescence protein (GFP) plasmids in rat cartilage following IA injection (Fig. 3d (i)). Moreover, CAP-functionalized exosomes showed prolonged joint retention up to 6 days after IA injection to rat joints (Fig. 3d (ii)). Thus, CAP-functionalized exosomes enabled delivery of gene payloads such as MMP-13 siRNA39 and miR-14040 in rat OA models, resulting in enhanced cartilage protection and repair.

Synovium

The synovium is a soft-tissue membrane that structurally integrates joint components and plays a central role in maintaining joint homeostasis. Rich in immune cells, fibroblasts, and sensory nerves, it is a major contributor to arthritic inflammation (synovitis) and pain (Fig. 4a)41. The synovium closely interacts with cartilage, bone, and fat pad, significantly influencing disease progression42. Its high vascularity compensates for the avascular nature of cartilage, enabling nutrient exchange, waste clearance, immune regulation, and inflammatory signaling43. Owing to this vascularity, the synovium not only represents the epicenter of inflammation in OA but also allows access to systemically delivered therapeutics. Moreover, its disease-specific phenotype, including macrophage infiltration, neovascularization, and altered matrix composition, offers opportunities to develop OA-specific targeting strategies that address both pain modulation and improved intra-articular drug retention44 (Table 2).

Fig. 4. Synovium: tissue phenotype in OA and examples of targeting peptides.

Fig. 4

a Schematic illustration of healthy versus OA synovium, showing key morphological and compositional changes as well as major molecular targets within the tissue. b Tissue specificity of the synovium-targeting peptide (HAP-1) and a scrambled control peptide (Con-P). Reprinted with permission from Elsevier, copyright 200345. c SyETP-modified nanoparticles exhibited preferential accumulation in inflamed rat joints (red box) compared with the non-targeting nanoparticles for up to 8 days following IV injection. Reprinted with permission from Elsevier, copyright 201850.

Table 2.

Synovium targeting peptides and their applications

Target Peptide Discovery Application Outcomes Citation
Synovium Endothelium CKSTHDRLC; Synovial endothelium targeting peptide (SyETP) In vivo phage display Peptide-small molecule conjugate: Cyclized SyETP-sinomenine Selectively accumulated in the inflamed mice joints and alleviated acute inflammation 120
Peptide-protein fusion: IL-4-MMP cleavage site-3x cyclized SyETP Selectively targeted synovial graft and activated cargo protein in OA mice 51
Polymeric-nanoparticle functionalization: SyETP-IgG2 on methotrexate loaded lactic acid/poly-caprolactone/PEG (tBNP) Enhanced retention in inflamed mouse and rat joint, preventing neoangiogenesis 50
DRL Rational Design: analog of SyETP Peptide-fluorophore conjugate: DRL-5-carboxytetramethylrhodamine (TAM) Allowed confocal laser scanning microscopy (CLSM)-based screening on rat synovium-derived primary cells (RSPC) 121
FLS SFHQFARATLAS; HAP-1 In vitro phage display Peptide-peptide fusion: HAP-1-KLAK Lead synovial apoptosis and concomitant reduction of OA rabbit’s inflammation and synovitis 45
Carrier functionalization: HAP-1 on NF-κB-blocking peptide (NBD peptide)-loaded liposome Selective targeting and inhibition of NF-kB pathway in arthritic rat 46
Carrier functionalization: PEG microgel with HAP-1 Prolonged retention in inflamed rat joint 47
HIQLSPFSQSWR; HAP-2 In vitro phage display N/A N/A
Synovium Neovasculature CDCRGDCFC; RGD-4C In vitro phage display Peptide-peptide fusion: RGD-4C-KLAK Reduced arthritis score of OA mice 52
Macrophage/ Immune cells CRVLRSGSC; CRV In vitro phage display Peptide-small molecule conjugate: CRV-Dexamethasone Improved therapeutic efficacy and safety of dexamethasone in OA mice 48
CTTHWGFTLC In vitro phage display Carrier functionalization: surface modification of rapamycin-loaded mesoporous prussian blue nanoparticles (RAPA@MPB-MMP9) Decreased macrophage pyroptosis, promoted mitophagy, and improved synovial lesions of OA mice 122
cFLFLF Rational Design: neutrophil formyl peptide receptor (FPR) antagonist Peptide-contrast agent conjugate: cFLFLF-PEG-64Cu Served as fluorescent probe for PET/CTa and showed enhanced contrast in OA mice 123

Synoviocytes. Fibroblast-like synoviocytes (FLS) are among the most extensively studied targets for peptide-mediated delivery. Phage display biopanning against the rabbit synoviocyte cell line HIG-82 identified the peptide SFHQFARATLAS (HAP-1), which exhibits high specificity for synovial cells (Fig. 4b)45. A fusion construct of HAP-1 with the pro-apoptotic antimicrobial peptide KLAK induced selective synoviocyte apoptosis, and IA administration in a rabbit arthritis model significantly reduced inflammation and synovitis. HAP-1–modified microgels and liposomes also demonstrated improved joint retention and targeted delivery following IA injection in a rat arthritis model46,47. In contrast, selective peptides for macrophage-like synoviocytes (MLS) and synovial macrophages remain underexplored. Most studies have therefore repurposed existing macrophage-targeting sequences for joint applications. For example, the macrophage-homing peptide CRV (CRVLRSGSC) has been utilized for reactive oxygen species (ROS)-responsive dexamethasone delivery via IV administration in a rat arthritis model48. Although specific MLS markers have been identified, relatively few studies have explored the development of peptides uniquely selective for these synovial subpopulations44.

Synovial endothelium. The synovial endothelium represents another promising therapeutic target. The Synovial Endothelium Targeting Peptide (SyETP; CKSTHDRLC), identified through combined ex vivo and in vivo phage display screening in a human/SCID mouse model, binds selectively to CD34⁺ synovial endothelial cells49,50. Even though CD34 is broadly expressed across vascular and epithelial tissues, the exceptional joint specificity of SyETP suggests additional molecular interactions may underlie its targeting mechanism. SyETP is considered one of the most selective and well-validated synovial-targeting peptides51. In a rat rheumatoid arthritis model, poly-lactic acid, poly-caprolactone, and PEG nanoparticles with SyETP coating accumulated in inflamed joints following intraperitoneal administration with enhanced retention for at least 8 days compared to healthy or non-SyETP nanoparticle-treated groups (Fig. 4c)50. Consequently, these synovium-targeting nanoparticles were able to deliver methotrexate and suppress synovial inflammation.

Synovial neovasculature. OA-associated neovascularization within the inflamed synovium also presents an attractive target for peptide-based interventions (Fig. 4a). The RGD-4C peptide, identified by phage display, exhibits high selectivity for the neovasculature through binding to αvβ3 and αvβ5 integrins52. IV injection of RGD-4C fused with the pro-apoptotic KLAK peptide induced selective destruction of synovial neovessels and significantly lowered arthritis severity scores in murine models. Such vascular-targeted strategies highlight the potential of leveraging pathological angiogenesis in OA for targeted drug delivery.

Subchondral bone (SB)

SB provides essential structural and metabolic support to cartilage. In OA, it undergoes aberrant remodeling characterized by increased bone turnover, hypervascularization, and aberrant sensory nerve ingrowth, collectively disrupting SB-cartilage crosstalk and accelerating disease progression (Fig. 5a)53. As a result, SB is increasingly recognized as a key target for OA intervention. Targets such as mesenchymal stem cells (MSCs), osteoclasts, osteoblasts, and hydroxyapatite (HAP) of bone matrix are accessible via systemic administration, yet SB-directed strategies remain underexplored (Table 3). Most targeting peptides were developed for osteoporosis (OP) but held strong potential for OA therapy.

Fig. 5. Subchondral bone (SB): tissue phenotype in OA and examples of targeting peptides.

Fig. 5

a Schematic illustration of healthy and OA SB, highlighting key structural and compositional alterations and major molecular targets within the tissue. b A fusion peptide combining a heptaglutamate (E7) sequence with a collagen-mimetic, osteoconductive DGEA motif enabled targeted accumulation in rat fibula up to 24 h following IV injection. Reprinted with permission from Elsevier, copyright 201363. c Dual modification with an osteoblast-targeting CH6 aptamer and a HAP-binding C11 peptide enabled enhanced bone accumulation of CH6-PAMAM-C11 dendrimers compared to unmodified PAMAM-PEG for up to 12 h after IV administration. Reprinted with permission from RCS, copyright 202164.

Table 3.

SB targeting peptides and their applications

Target Peptide Discovery Application Outcomes Citation
MSC EPLQLKM In vitro phage display Scaffold functionalization: Functionalized polycaprolactone (PCL) scaffold Implanted scaffold improved endogenous MSCs mobilization to the defect sites of OA rat 55
Osteoblast SDSSD In vitro phage display Carrier functionalization: Surface-modified polyurethane (PU) nanomicelles for anti-miR-214 delivery Selective localization in bone and enhanced anti-miR-214 efficacy in alleviating OP progression in mouse 58
Osteoclast TPLSYLKGLVTV In vitro phage display Carrier functionalization: Surface-modified red blood cell extracellular vesicles (RBCEVs) for anti-miR-214 delivery Selective localization in bone and enhanced anti-miR-214 efficacy in alleviating OP progression in mouse 59
HAP Poly(E) Rational Design: inspired by repeating residues of hydroxyapatite-binding non-collagenous protein such as osteopontin and sialoprotein Peptide-peptide fusion: Osteoinductive peptide (DGEA) fusion with heplaglutamate (E7) Enabled retention of osteoinductive peptide in rat bone for up to 24 h 63
Peptide-peptide fusion: Bone morphogenetic protein-2 (BMP-2)-derived peptide fusion with heptaglutamate Facilitated retention of the BMP-2-derived peptide within allografts implanted in rat for at least one month. 124
Poly(D) Carrier functionalization: Surface-modified PLGA for simvastatin delivery Targeted bone accumulation and improved simvastatin-induced bone growth in OP rat 125
(DSS)6 Rational Design: inspired by repeating residues of dentin phosphoprotein Carrier functionalization: Surface-modified DOTAP-based cationic liposomes for Plekho1 siRNA delivery Selective Plekho1 siRNA enrichment in osteogenic cells enhanced bone formation in OP rat 126
STDKTKREEVD; C11 Rational Design: derived for 11 residues at the C-terminus of amelogenin Carrier functionalization: PAMAM dendrimer conjugated with C11 and osteoblast-binding CH6 aptamer (CH6-PAMAM-C11) Rapid accumulation in rat bone 4 h post-injection with targeted accumulation at osteoblast sites 64

MSCs are attractive OA targets due to their self-renewal capacity and their ability to differentiate into both chondrocytes and osteoblasts, making them central to osteochondral repair54. MSC-homing peptides can enhance cell recruitment and retention at defect sites. The phage-display-identified peptide EPLQLKM, when conjugated to polycaprolactone scaffolds, significantly increased MSC recruitment and reduced inflammatory cell infiltration in a rat cartilage defect model55. Incorporation of matrix-binding motifs can further potentiate MSC-based therapies: hyaluronic acid- and chondroitin sulfate-binding peptide embedded within collagen-mimetic scaffolds promoted BM-MSC chondrogenesis56, while MSCs coated with the collagen XII-binding peptide C5-24 and HA exhibited superior cartilage repair upon transplantation into OA rat joints compared to uncoated MSCs11.

Osteoblasts and osteoclasts. Bone remodeling in OA is dysregulated due to the imbalance between osteoblast-driven formation and osteoclast-mediated resorption57. The osteoblast-targeting peptide SDSSD, identified via phage display, was used to functionalize polyurethane nanomicelles and enabled targeted delivery of anti-miR-214. This enhanced osteoblast activity and improved bone structure after IV administration in a mouse osteoporosis (OP) model58. For osteoclasts, the tartrate-resistant acid phosphatase (TRAP)-binding peptide (TPLSYLKGLVTV) was used to modify red blood cell-derived extracellular vesicles loaded with anti-miR-214, enabling targeted suppression of osteoclast activity and improved bone density in the same model59.

Hydroxyapatite (HAP). Bone is primarily composed of HAP, an inorganic mineral that constitutes ~70% of its mass and confers structural integrity60. Its abundance provides an opportunity for mineral-targeted delivery. HAP-binding peptides, typically enriched in acidic residues inspired by non-collagenous bone proteins, utilize electrostatic interactions with calcium. Such peptides have been exploited for osteoinduction, remineralization, and bone-targeted drug delivery61. For instance, FITC-labeled poly-aspartic acid demonstrated a femoral half-life of ~14 days after subcutaneous administration in mice62, while fusion of heptaglutamate with the osteoconductive DGEA motif achieved high accumulation in fibula within 24 h of IV injection in rats (Fig. 5b)63. Using a similar approach, another HAP-binding peptide, C11 (STDKTKREEVD), was derived from amelogenin, a protein responsible for tooth enamel formation. Combined with osteoblast targeting aptamer CH6, CH6-PAMAM-C11 dendrimer exhibited a high accumulation in bones up to 12 h post-IV injection (Fig. 5c)64.

Application: therapeutic peptide

Peptides can function as therapeutics by exerting anti-inflammatory, chondroprotective, regenerative, and analgesic effects—offering a multifaceted approach to disease modification and symptom relief (Table 4). Their growing therapeutic prominence is underscored by the broader pharmaceutical landscape, where 22 peptide drugs have received FDA approval within the past four years, more than half the total approvals from the previous decade65,66.

Table 4.

OA therapeutic peptides

Category Peptide Discovery and Mechanism of Action Modifications Outcomes Citation
Anti-inflammatory Adrenocorticotropic hormone (ACTH) peptide; SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF Rational design: modified to improve half-life; binds to melanocortin 1 receptor Fusion to latency affinity peptide to prevent inactivation in joint Demonstrated anti-inflammatory OA attenuation effect in vivo 127,128
Glucagon-like peptide 1 (GLP-1) agonist analogs; HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG Rational design: modified to improve half-life; binds to GLP-1 receptor Amino acid substitutions and side chain modifications Activated P13K/Akt pathway in chondrocytes, protecting against IL-1 stimulation and ameliorating OA progression in vivo 69
Melanocyte-stimulating hormone (MSH) peptides; α: SYSMEHFRWGKPV; β: AEKKDEGPYRMEHFRWGSPPKD; γ: YVMGHFRWDRFG Rational design: modified to improve half-life; binds to melanocortin 1 receptor Amino acid substitutions and fusion to latency affinity peptide Modulated inflammatory activation of chondrocytes and synoviocytes in vitro and inhibited macrophage infiltration and cartilage degeneration in vivo 127–129
Vasoactive Intestinal Peptide (VIP); HSDAVFTDNYTRLRKQMAVKKYLNSILN Rational design: modified to improve half-life; binds to VPAC1 and VPAC2 receptors Fusion to latency affinity peptide to prevent inactivation in joint Alleviated cartilage damage through NF-κB pathway inhibition in vivo 127,130
Chondroprotective and regenerative peptides C-type natriuretic peptide (CNP); GLSKGCFGLKLDRIGSMSGLGC Rational design: modified to improve half-life; binds to NPRB receptor Amino acid additions Induced cartilage generation through activating cGMP/PKGII pathways 77,131
FGFR1-binding peptide (R1-P1); GPPDWHWKAMTH Phage display N/A Prevente cartilage degeneration and improved proteoglycan synthesis in vivo 78
IL-1Ra-like peptide (DAP1-2); ADPQNRLELNQYNQWRDEQYVK Rational design: 22 amino acids involved in binding between IL-1Ra and IL-1R1 selected N/A Reduced IL-1β after inflammatory stimulation in vitro and attenuated NF-κB signaling in vivo. 132,133
Pain relief peptides Icatibant, DArg-Arg-Pro-Hyp-Gly-Thi-Ser-DTic-Oic-Arg Rational design: analog of bradykinin Amino acid substitution to non-canonical amino acids Alleviated hyperalgesia in vivo after cytokine-induced arthritis, and restored weight bearing 82,83
CGRP 8-37; VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF Rational design: analog of CGRP Amino acid substitutions and side chain modifications Locally blocked endogenous CGR reversed joint nociceptor responses in vivo 134

Anti-inflammatory peptides. Given OA’s strong inflammatory component, many therapeutic peptides have been designed to suppress proinflammatory signaling and halt disease progression. A promising candidate is glucagon-like peptide-1 (GLP-1), a clinically approved drug for diabetes and obesity that acts via the GLP-1 receptor (GLP-1R). Discovery of GLP-1R expression on chondrocytes revealed that GLP-1 protects against IL-1–induced inflammation by inhibiting the PI3K/Akt and NF-κB pathways67,68. Beyond chondrocytes, GLP-1 suppresses inflammatory signaling in synovium, bone, and adipose tissue, underscoring its potential as a broad anti-inflammatory OA therapy69,70. Current clinical trials primarily assess GLP-1’s indirect disease-modifying effects via weight loss, yet preclinical evidence indicates a direct joint-protective role, motivating further design of GLP-1–based peptides optimized for OA intervention.

Another notable anti-inflammatory agent is vasoactive intestinal peptide (VIP), a neuropeptide with broad immunomodulatory properties71. IA administration of VIP in preclinical OA models reduced synovitis and slowed disease progression by engaging G-protein–coupled receptors that suppress cytokine release and macrophage infiltration72–75. However, the specific molecular role of VIP in cartilage homeostasis and OA pathophysiology remains incompletely defined, warranting deeper mechanistic study.

Chondroprotective and regenerative peptides. C-type natriuretic peptide (CNP), a hormone that regulates vascularization, angiogenesis, and cartilage growth during development, has established clinical relevance through its approval for achondroplasia treatment76. In preclinical OA models, CNP treatment rescued cartilage by binding to natriuretic peptide receptor B (NPR2) on chondrocytes and activating the cGMP/PKGII pathway, which stimulates proteoglycan and collagen synthesis77. Another chondroprotective candidate is R1-P1, a fibroblast growth factor receptor 1 (FGFR1)–binding peptide identified through phage display. FGFR1 activation drives cartilage degradation and suppresses ECM synthesis; accordingly, R1-P1 administration in rat OA models and human articular cartilage explants attenuated OA progression78.

Analgesic peptides. While anti-inflammatory and regenerative peptides may indirectly reduce pain by limiting inflammation and restoring tissue homeostasis, many DMOADs have failed preclinical and clinical development because they do not provide lasting patient-relevant outcomes such as pain relief79. This has spurred the development of analgesic peptides. Icatibant is a B2 receptor antagonist inspired by the natural nonapeptide of bradykinin80,81. In a rat cytokine-induced OA model, icatibant alleviates knee hyperalgesia and restores weight-bearing capacity82,83, though further validation in widely used injury-induced OA models is needed. Another approach involves calcitonin gene-related peptide (CGRP) receptor antagonists, derived from residues 8–37 of CGRP, a key mediator of mechanosensitivity and peripheral sensitization in OA joints. CGRP antagonists have demonstrated potential for pain reduction in preclinical synovial models84,85.

Challenges and future direction

Increasing peptide stability against enzymatic degradation

A major limitation of peptide-based therapeutics is their inherently poor pharmacokinetics: low bioavailability, rapid degradation, and short systemic half-lives4. These challenges are further amplified in OA due to elevated protease activity and joint washout through SF clearance. To address these limitations, various strategies have been developed to enhance peptide stability against enzymatic degradation, including sequence optimization, bioconjugation, and structural stabilization (Fig. 6). Despite their importance, the pharmacokinetics of targeting peptides within joints remain poorly characterized, explaining the limited efforts to enhance their stability, whereas systemically delivered therapeutic peptides have been extensively optimized.

Fig. 6. Schematic illustration of strategies to improve peptide pharmacokinetics.

Fig. 6

a Sequence optimization: optimization of peptide sequences by replacing residues at enzymatic cleavage sites enhances resistance to both serum enzymes (e.g., neutral endopeptidase (NEP) and dipeptidyl peptidase (DPP)) and tissue-specific enzymes such as matrix metalloproteinases (MMPs) and aggrecanases, thereby increasing stability. b Bioconjugation: attachment of antibodies, proteins, or non-protein partners such as immunoglobulins, transferrin, PEG, glycine, or fatty acids increases peptide size directly or indirectly via serum and synovial fluid protein binding. The larger size and steric shielding reduce renal clearance, protect against reticuloendothelial system (RES) uptake, and limit enzymatic degradation. c Structural stabilization: introduction or substitution of cysteine residues forms intramolecular disulfide bridges, generating a cyclic and rigid conformation that restricts access to cleavage sites, thereby enhancing stability.

Sequence optimization involves substituting residues at enzymatic cleavage sites, including those beyond the canonical amino acids (Fig. 6a). Unnatural amino acids expand this design space through stereochemical variants (e.g., D-isomers), backbone-modified chemistries (peptoids; β-, γ-, or ε-amino acids), and side-chain–engineered residues86. The cleavage sites of native GLP-1 by neutral endopeptidase (NEP) and dipeptidyl peptidase IV (DPP-IV) are well defined, and clinically approved analogues incorporate substitutions that extend half-life87. Inclusion of unnatural amino acids further broadens this modification landscape—such as Ala8 → 2-aminoisobutyric acid (Aib) in GLP-1 analogues, which prevents DPP-IV degradation87, or incorporation of D-isomers in icatibant88, which enhances receptor binding and proteolytic stability.

Bioconjugation can simultaneously mitigate enzymatic degradation, reduce renal clearance, and shield against reticuloendothelial uptake by linking peptides to larger partners at cleavage-prone sites (Fig. 6b). Conjugation to antibodies or proteins (e.g., immunoglobulins, transferrin) or non-protein partners (e.g., PEG, glycans, fatty acids) is commonly used to extend the systemic half-life of therapeutic peptides89. For instance, clinically approved GLP-1 analogs are conjugated to immunoglobulins, PEG, or fatty acids, which extend their serum half-life up to 15 h90,91. However, for intra-articular delivery, larger peptides may face steric hindrance within the dense joint extracellular matrix, limiting their transport.

Structural stabilization offers another route to enhance proteolytic resistance (Fig. 6c). Many peptides are intrinsically unstructured, making them susceptible to cleavage. CDPs, stabilized through intramolecular disulfide bridges, maintain a rigid conformation and stable surface charge—features that enhance both proteolytic resistance and cartilage targeting efficiency30.

Incorporating in silico method for peptide discovery and optimization

In silico methods are gaining traction and potentially could be utilized to design and/or screen targeting and therapeutic peptides. Machine learning models such as AlphaFold2 and RoseTTAFold can predict protein structures with remarkable accuracy, and the continual expansion of computational power has positioned in silico approaches as an integral component in modern drug development. Additionally, molecular dynamics (MD) simulations also offer a powerful means to explore peptide conformational landscapes, with techniques such as replica exchange MD, metadynamics, and umbrella sampling.

In silico methods can be applied to both rational peptide design and large-scale screening. Zhang et al. used structure-guided modeling of ADAMTS4 with its endogenous inhibitor TIMP3 to identify a key inhibitory loop, which was optimized to yield a ninefold improvement in ADAMTS4 inhibition validated in vitro92. Similarly, large-scale in silico screening can markedly accelerate peptide discovery. For example, CDP variants previously explored for cartilage targeting were adapted for bispecific T-cell engagers. In this study, a library of 4,298 CDP peptide scaffolds was modeled using Rosetta. Low-energy computational docking and mammalian display screening filtered them down to 4 distinct scaffolds for in vitro validation. The top-performing scaffold was incorporated into a CD3-binding bispecific T-cell engager that successfully prolonged survival in a tumor-bearing mouse model93. Such approaches can also model peptide-enzyme interactions to minimize protease cleavage or screen peptide libraries against OA-associated proteases to improve stability and specificity.

Study model weaknesses: In vitro model

Conventional evaluation of OA therapeutics, including peptide-based candidates, primarily relies on in vitro systems such as 2D/3D cell cultures or tissue explants. These approaches offer simplicity, accessibility, and compatibility with early-stage screening, enabling controlled experimentation in otherwise challenging environments19,94,95. However, they fall short of recapitulating joint-level physiology, lacking key features such as inter-tissue crosstalk, synovial fluid dynamics, and physiologic mechanical loading. As a result, many therapeutic candidates advance prematurely to in vivo studies, highlighting the limitations of current in vitro models. Co-culture systems have improved physiological relevance by incorporating synovial cells or tissues, yet features such as spatial organization and biomechanical loading remain underrepresented. The growing emphasis on the 3 R principles (replacement, reduction, and refinement) further underscores the need to develop advanced, human-relevant in vitro systems96.

The humanized joint-on-chip (JOC) platform provides a next-generation alternative, modularly reconstructing joint tissues within a microfluidic system97. Each unit mimics native architecture and dynamics through integrated 3D cultures and controlled flow. Current JOC systems recapitulate diverse OA phenotypes, including injury, inflammation, and pain, by applying biomechanical loading and cytokine/chemokine cues98–102. Although primary human chondrocytes, synovial fibroblasts, and immune cells from OA patients have been used, limited availability and donor variability remain challenges99,103. A solution to these issues is to utilize induced pluripotent stem cells (iPSCs) as the source of the cells. Integration of induced iPSC-derived organoids within JOC systems could combine biological fidelity with precise environmental control, advancing physiologically relevant modeling of human OA.

A representative in vitro model based on humanized JOC offers a promising platform for advancing peptide-based targeted drug delivery systems and therapeutic peptide development. While complete replacement of animal models remains a long-term goal, the humanized JOC can help bridge this gap. Its multi-tissue composition and inclusion of joint-relevant dynamics and loading can enable evaluation of targeted delivery features not captured previously by conventional in vitro systems. However, the lack of standardization, variability in experimental protocols, technical complexity, and high costs pose significant challenges that must be addressed before humanized JOC systems can be widely adopted.

Unexplored target in the joint

Most peptide research has focused on cartilage and synovium, yet OA is a whole-joint disease involving multiple tissues. There remains limited exploration of peptides targeting other joint tissues, which could open new avenues for OA therapeutics. SB plays a key role in mechanical support, nutrient exchange, and signaling. While peptide-based SB targeting has been explored for OP treatment and imaging, its application to OA remains nascent. Harnessing the vascularized nature of SB could enable peptide-assisted systemic delivery to osteoblasts, osteoclasts, and MSCs.

SF maintains joint homeostasis by providing lubrication and nutrient transport. It contains potential targets such as HA, serum proteins, proteases, and polysaccharides. Electrostatic interactions with HA have been utilized to entrap drug conjugates in SF, suggesting similar potential for enhancing peptide residence time104,105. HABPs, previously used for cartilage and bone targeting, may be adapted for this purpose. However, overly strong interactions may compromise delivery efficiency by restricting tissue diffusion or masking functional ligands18,106.

Other joint tissues, such as the ligament, meniscus, and infrapatellar fat pad (IFP), also merit exploration. The ligament and meniscus are dense, collagen I–rich connective tissues with low cellularity107,108. A decorin-derived peptide, LRELHLNNN, exhibits strong binding to fibrous tissues through collagen I interactions and may serve as a targeting motif for these structures109. IFP, a vascularized and innervated adipose tissue, contributes to OA inflammation through adipocyte-immune signaling and serves as a reservoir for reparative MSCs110. Adipocyte-targeting peptides such as CKGGRAKDC, which bind prohibitin on vascular adipocytes and can deliver pro-apoptotic cargo to white adipose tissue, exemplify potential for IFP-directed OA therapy111. Despite such promise, strategies targeting these tissues remain scarce, partly due to their limited involvement or ambiguous roles in OA pathogenesis.

Conclusion

Peptides represent a versatile and modular platform for OA therapy, functioning both as targeting ligands and as therapeutic agents with anti-inflammatory, regenerative, or analgesic effects. Their clinical translation, however, is constrained by poor stability and rapid clearance within the joint. Significant efforts have been made to address these stability challenges, aiming to enhance peptide durability for targeted delivery to the joint. Looking forward, advances in in silico design, humanized joint-on-chip systems, and the exploration of underutilized joint targets will accelerate discovery and optimization. Together, these developments highlight a future where peptide-based approaches enable precise, stable, and multi-tissue OA therapies with true disease-modifying potential.

Acknowledgements

This work was supported by the National Institutes of Health (NIH) R01AR075121 and National Science Foundation (NSF) CAREER (2141841). All figures were prepared using BioRender.com.

Author contributions

B.H. and A.B. conceived the idea. B.H., H.Z., and A.S. conducted the literature review and curated the data. B.H. prepared Figs. 1–3, 5 and Tables 1 and 3. H.Z. prepared Fig. 4 and Table 2. A.S. prepared Fig. 6 and Table 4. All authors contributed to conceptualization and participated in writing, reviewing, and editing the manuscript.

Data availability

No datasets were generated or analysed during the current study.

Competing interests

The authors declare no competing interests.

Footnotes

Publisher’s note Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

References

  • 1.Tang, S. et al. Osteoarthritis. Nat. Rev. Dis. Prim.11, 10 (2025). [DOI] [PubMed] [Google Scholar]
  • 2.Rainbow, R., Ren, W. & Zeng, L. Inflammation and joint tissue interactions in OA: implications for potential therapeutic approaches. Arthritis2012, 741582 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Mehta, S., He, T. & Bajpayee, A. G. Recent advances in targeted drug delivery for treatment of osteoarthritis. Curr. Opin. Rheumatol.33, 94–109 (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Wang, L. et al. Therapeutic peptides: current applications and future directions. Signal Transduct. Target. Ther.7, 1–27 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Baby, H. M., Zhang, H., Selvadoss, A., Pathrikar, T. V. & Bajpayee, A. G. Rational design of extracellular vesicles for targeted drug delivery across physiological barriers. Nano Today66, 102920 (2026). [Google Scholar]
  • 6.Liao, H.-J., Chen, H.-T. & Chang, C.-H. Peptides for targeting chondrogenic induction and cartilage regeneration in osteoarthritis. CARTILAGE 19476035241276406 10.1177/19476035241276406 (2024). [DOI] [PMC free article] [PubMed]
  • 7.Shoulders, M. D. & Raines, R. T. Collagen structure and stability. Annu. Rev. Biochem.78, 929–958 (2009). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Wahyudi, H., Reynolds, A. A., Li, Y., Owen, S. C. & Yu, S. M. Targeting collagen for diagnostic imaging and therapeutic delivery. J. Controlled Release240, 323–331 (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 9.Rothenfluh, D. A., Bermudez, H., O’Neil, C. P. & Hubbell, J. A. Biofunctional polymer nanoparticles for intra-articular targeting and retention in cartilage. Nat. Mater.7, 248–254 (2008). [DOI] [PubMed] [Google Scholar]
  • 10.Xue, S. et al. Cartilage-targeting peptide-modified dual-drug delivery nanoplatform with NIR laser response for osteoarthritis therapy. Bioact. Mater.6, 2372–2389 (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 11.Lin, C.-Y. et al. Collagen-binding peptides for the enhanced imaging, lubrication and regeneration of osteoarthritic articular cartilage. Nat. Biomed. Eng.6, 1105–1117 (2022). [DOI] [PubMed] [Google Scholar]
  • 12.Vedadghavami, A., Zhang, C. & Bajpayee, A. G. Overcoming negatively charged tissue barriers: drug delivery using cationic peptides and proteins. Nano Today34, 100898 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 13.Bajpayee, A. G. & Grodzinsky, A. J. Cartilage-targeting drug delivery: Can electrostatic interactions help?. Nat. Rev. Rheumatol.13, 183–193 (2017). [DOI] [PubMed] [Google Scholar]
  • 14.Nagase, H. & Kashiwagi, M. Aggrecanases and cartilage matrix degradation. Arthritis Res. Ther.5, 94–103 (2003). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Bajpayee, A. G., Wong, C. R., Bawendi, M. G., Frank, E. H. & Grodzinsky, A. J. Avidin as a model for charge driven transport into cartilage and drug delivery for treating early stage post-traumatic osteoarthritis. Biomaterials35, 538–549 (2014). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Vedadghavami, A. et al. Cartilage penetrating cationic peptide carriers for applications in drug delivery to avascular negatively charged tissues. Acta Biomater.93, 258–269 (2019). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Hakim, B., Boyer, T. L., Chakraborty, S. & Bajpayee, A. G. Spatial charge-hydrophobicity configuration modulates cationic peptide transport in cartilage. Biophys. J.124, 3690–3705 (2025). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18.Vedadghavami, A. et al. Charge-based drug delivery to cartilage: Hydrophobic and not electrostatic interactions are the dominant cause of competitive binding of cationic carriers in synovial fluid. Acta Biomater.151, 278–289 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 19.Vedadghavami, A., Mehta, S. & Bajpayee, A. G. Characterization of intra-cartilage transport properties of cationic peptide carriers. J. Vis. Exp.2020, 1–22 (2020). [DOI] [PubMed] [Google Scholar]
  • 20.Boyer, T. L. et al. Cartilage targeting cationic peptide carriers display deep cartilage penetration and retention in a rabbit model of post-traumatic osteoarthritis. Osteoarthritis Cartilage10.1016/j.joca.2025.04.001 (2025). [DOI] [PMC free article] [PubMed]
  • 21.Vedadghavami, A., Hakim, B., He, T. & Bajpayee, A. G. Cationic peptide carriers enable long-term delivery of insulin-like growth factor-1 to suppress osteoarthritis-induced matrix degradation. Arthritis Res. Ther.24, 172 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Mehta, S. et al. Sustained intra-cartilage delivery of interleukin-1 receptor antagonist using cationic peptide and protein-based carriers. Osteoarthr. Cartil.31, 780–792 (2023). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Selvadoss, A., Baby, H. M., Zhang, H. & Bajpayee, A. G. Harnessing exosomes for advanced osteoarthritis therapy. Nanoscale16, 19174–19191 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 24.Zhang, C. et al. Charge-reversed exosomes for targeted gene delivery to cartilage for osteoarthritis treatment. Small Methods8, 2301443 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Pathrikar, T. V. et al. Cartilage-targeting exosomes for delivery of receptor antagonist of interleukin-1 in osteoarthritis treatment. Osteoarthritis Cartilage10.1016/j.joca.2025.02.785 (2025). [DOI] [PMC free article] [PubMed]
  • 26.Zhang, C. et al. Milk exosomes anchored with hydrophilic and zwitterionic motifs enhance mucus permeability for applications in oral gene delivery. Biomater. Sci.12, 634–649 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 27.Cotto, H. A. M. et al. Cationic-motif-modified exosomes for mRNA delivery to retinal photoreceptors. J. Mater. Chem. B10.1039/D4TB00849A (2024). [DOI] [PMC free article] [PubMed]
  • 28.Zhang, C., Vedadghavami, A., He, T., Charles, J. F. & Bajpayee, A. G. Cationic carrier mediated delivery of anionic contrast agents in low doses enable enhanced computed tomography imaging of cartilage for early osteoarthritis diagnosis. ACS Nano17, 6649–6663 (2023). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Lin, J. et al. Poly-l-lysine as an efficient cartilage penetrating and residing drug carrier with high intraarticular injection safety for treating osteoarthritis. Chem. Eng. J.430, 133018 (2022). [Google Scholar]
  • 30.Cook Sangar, M. L. et al. A potent peptide-steroid conjugate accumulates in cartilage and reverses arthritis without evidence of systemic corticosteroid exposure. Sci. Transl. Med.12, eaay1041 (2020). [DOI] [PubMed] [Google Scholar]
  • 31.Krishnan, Y. et al. Green fluorescent proteins engineered for cartilage-targeted drug delivery: insights for transport into highly charged avascular tissues. Biomaterials183, 218–233 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.He, T. et al. Multi-arm Avidin nano-construct for intra-cartilage delivery of small molecule drugs. J. Controlled Release318, 109–123 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.He, T., Shaw, I., Vedadghavami, A. & Bajpayee, A. G. Single-dose intra-cartilage delivery of kartogenin using a cationic multi-arm avidin nanocarrier suppresses cytokine-induced osteoarthritis-related catabolism. Cartilage13, 2 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Mummert, M. E., Mohamadzadeh, M., Mummert, D. I., Mizumoto, N. & Takashima, A. Development of a peptide inhibitor of hyaluronan-mediated leukocyte trafficking. J. Exp. Med.192, 769–780 (2000). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Yang, B., Yang, B. L., Savani, R. C. & Turley, E. A. Identification of a common hyaluronan binding motif in the hyaluronan binding proteins RHAMM, CD44 and link protein. EMBO J.13, 286–296 (1994). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Faust, H. J. et al. A hyaluronic acid binding peptide-polymer system for treating osteoarthritis. Biomaterials183, 93–101 (2018). [DOI] [PubMed] [Google Scholar]
  • 37.Unterman, S. A. et al. Hyaluronic acid-binding scaffold for articular cartilage repair. Tissue Eng. Part A18, 2497–2506 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Pi, Y. et al. Targeted delivery of non-viral vectors to cartilage in vivo using a chondrocyte-homing peptide identified by phage display. Biomaterials32, 6324–6332 (2011). [DOI] [PubMed] [Google Scholar]
  • 39.Liang, Y. et al. Chondrocyte-targeted MicroRNA delivery by engineered exosomes toward a cell-free osteoarthritis therapy. ACS Appl. Mater. Interfaces12, 36938–36947 (2020). [DOI] [PubMed] [Google Scholar]
  • 40.Zhang, H. et al. Surface functionalization of exosomes for chondrocyte-targeted siRNA delivery and cartilage regeneration. J. Controlled Release369, 493–505 (2024). [DOI] [PubMed] [Google Scholar]
  • 41.Mathiessen, A. & Conaghan, P. G. Synovitis in osteoarthritis: current understanding with therapeutic implications. Arthritis Res. Ther.19, 18 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42.Sanchez-Lopez, E., Coras, R., Torres, A., Lane, N. E. & Guma, M. Synovial inflammation in osteoarthritis progression. Nat. Rev. Rheumatol.18, 258–275 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Bhattaram, P. & Chandrasekharan, U. The joint synovium: a critical determinant of articular cartilage fate in inflammatory joint diseases. Semin. Cell Dev. Biol.62, 86–93 (2017). [DOI] [PubMed] [Google Scholar]
  • 44.Wang, X. et al. Synovitis mediates the association between bone marrow lesions and knee pain in osteoarthritis: data from the Foundation for the National Institute of Health (FNIH) Osteoarthritis Biomarkers Consortium. Osteoarthr. Cartil.30, 1270–1277 (2022). [DOI] [PubMed] [Google Scholar]
  • 45.Mi, Z. et al. Identification of a synovial fibroblast-specific protein transduction domain for delivery of apoptotic agents to hyperplastic synovium. Mol. Ther.8, 295–305 (2003). [DOI] [PubMed] [Google Scholar]
  • 46.You, C. et al. Synovial fibroblast-targeting liposomes encapsulating an NF-κB-blocking peptide ameliorates zymosan-induced synovial inflammation. J. Cell. Mol. Med.22, 2449–2457 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Mancipe Castro, L. M., Sequeira, A., García, A. J. & Guldberg, R. E. Articular cartilage- and synoviocyte-binding poly(ethylene glycol) nanocomposite microgels as intra-articular drug delivery vehicles for the treatment of osteoarthritis. ACS Biomater. Sci. Eng.6, 5084–5095 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Wu, X. et al. Peptide targeting improves the delivery and therapeutic index of glucocorticoids to treat rheumatoid arthritis. J. Control. Release. J. Control. Release Soc.368, 329–343 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49.Lee, L. et al. Identification of synovium-specific homing peptides by in vivo phage display selection. Arthritis Rheum.46, 2109–2120 (2002). [DOI] [PubMed] [Google Scholar]
  • 50.Colombo, F. et al. Targeting CD34+ cells of the inflamed synovial endothelium by guided nanoparticles for the treatment of rheumatoid arthritis. J. Autoimmun.103, 102288 (2019). [DOI] [PubMed] [Google Scholar]
  • 51.Wythe, S. E. et al. Targeted delivery of cytokine therapy to rheumatoid tissue by a synovial targeting peptide. Ann. Rheum. Dis.72, 129–135 (2013). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 52.Gerlag, D. M. et al. Suppression of murine collagen-induced arthritis by targeted apoptosis of synovial neovasculature. Arthritis Res. Ther.3, 357 (2001). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53.Findlay, D. M. & Kuliwaba, J. S. Bone–cartilage crosstalk: a conversation for understanding osteoarthritis. Bone Res4, 16028 (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54.Zhu, C., Wu, W. & Qu, X. Mesenchymal stem cells in osteoarthritis therapy: a review. Am. J. Transl. Res.13, 448–461 (2021). [PMC free article] [PubMed] [Google Scholar]
  • 55.Shao, Z. et al. Polycaprolactone electrospun mesh conjugated with an MSC affinity peptide for MSC homing in vivo. Biomaterials33, 3375–3387 (2012). [DOI] [PubMed] [Google Scholar]
  • 56.Parmar, P. A. et al. Collagen-mimetic peptide-modifiable hydrogels for articular cartilage regeneration. Biomaterials54, 213–225 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57.Zhu, X., Chan, Y. T., Yung, P. S. H., Tuan, R. S. & Jiang, Y. Subchondral bone remodeling: a therapeutic target for osteoarthritis. Front. Cell Dev. Biol. 8, 607764 (2021). [DOI] [PMC free article] [PubMed]
  • 58.Sun, Y. et al. Osteoblast-targeting-peptide modified nanoparticle for siRNA/microRNA delivery. ACS Nano10, 5759–5768 (2016). [DOI] [PubMed] [Google Scholar]
  • 59.Xu, L. et al. Osteoclast-targeted delivery of anti-miRNA oligonucleotides by red blood cell extracellular vesicles. J. Controlled Release358, 259–272 (2023). [DOI] [PubMed] [Google Scholar]
  • 60.Mondal, S. et al. Hydroxyapatite: a journey from biomaterials to advanced functional materials. Adv. Colloid Interface Sci.321, 103013 (2023). [DOI] [PubMed] [Google Scholar]
  • 61.Alvisi, N. & de Vries, R. Biomedical applications of solid-binding peptides and proteins. Mater. Today Bio19, 100580 (2023). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62.Kasugai, S., Fujisawa, R., Waki, Y., Miyamoto, K.-I. & Ohya, K. Selective drug delivery system to bone: small peptide (Asp)6 conjugation. J. Bone Miner. Res.15, 936–943 (2000). [DOI] [PubMed] [Google Scholar]
  • 63.Culpepper, B. K., Bonvallet, P. P., Reddy, M. S., Ponnazhagan, S. & Bellis, S. L. Polyglutamate directed coupling of bioactive peptides for the delivery of osteoinductive signals on allograft bone. Biomaterials34, 1506–1513 (2013). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 64.Ren, M. et al. An oligopeptide/aptamer-conjugated dendrimer-based nanocarrier for dual-targeting delivery to bone. J. Mater. Chem. B9, 2831–2844 (2021). [DOI] [PubMed] [Google Scholar]
  • 65.Al Musaimi, O. Peptide therapeutics: unveiling the potential against cancer—a journey through 1989. Cancers16, 1032 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66.Al Musaimi, O., AlShaer, D., de la Torre, B. G. & Albericio, F. 2024 FDA TIDES (Peptides and Oligonucleotides) harvest. Pharmaceuticals18, 291 (2025). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67.Chen, J. et al. Glucagon-like peptide-1 receptor regulates endoplasmic reticulum stress-induced apoptosis and the associated inflammatory response in chondrocytes and the progression of osteoarthritis in rat. Cell Death Dis.9, 212 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 68.Mei, J., Sun, J., Wu, J. & Zheng, X. Liraglutide suppresses TNF-α-induced degradation of extracellular matrix in human chondrocytes: a therapeutic implication in osteoarthritis. Am. J. Transl. Res.11, 4800–4808 (2019). [PMC free article] [PubMed] [Google Scholar]
  • 69.Meurot, C. et al. Targeting the GLP-1/GLP-1R axis to treat osteoarthritis: a new opportunity?. J. Orthop. Transl.32, 121–129 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 70.Du, X. et al. The protective effects of lixisenatide against inflammatory response in human rheumatoid arthritis fibroblast-like synoviocytes. Int. Immunopharmacol.75, 105732 (2019). [DOI] [PubMed] [Google Scholar]
  • 71.Jiang, W., Wang, H., Li, Y. & Luo, W. Role of vasoactive intestinal peptide in osteoarthritis. J. Biomed. Sci.23, 63 (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 72.Delgado, M., Abad, C., Martinez, C., Leceta, J. & Gomariz, R. P. Vasoactive intestinal peptide prevents experimental arthritis by downregulating both autoimmune and inflammatory components of the disease. Nat. Med.7, 563–568 (2001). [DOI] [PubMed] [Google Scholar]
  • 73.Sutton, S. et al. The contribution of the synovium, synovial derived inflammatory cytokines and neuropeptides to the pathogenesis of osteoarthritis. Vet. J.179, 10–24 (2009). [DOI] [PubMed] [Google Scholar]
  • 74.Pérez-García, S. et al. Mapping the CRF–urocortins system in human osteoarthritic and rheumatoid synovial fibroblasts: effect of vasoactive intestinal peptide. J. Cell. Physiol.226, 3261–3269 (2011). [DOI] [PubMed] [Google Scholar]
  • 75.Pérez-García, S. et al. VIP and CRF reduce ADAMTS expression and function in osteoarthritis synovial fibroblasts. J. Cell. Mol. Med.20, 678–687 (2016). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 76.Lorget, F. et al. Evaluation of the therapeutic potential of a CNP analog in a Fgfr3 mouse model recapitulating achondroplasia. Am. J. Hum. Genet.91, 1108–1114 (2012). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 77.Peake, N. J. et al. Role of C-type natriuretic peptide signalling in maintaining cartilage and bone function. Osteoarthr. Cartil.22, 1800–1807 (2014). [DOI] [PubMed] [Google Scholar]
  • 78.Tan, Q. et al. A novel FGFR1-binding peptide attenuates the degeneration of articular cartilage in adult mice. Osteoarthr. Cartil.26, 1733–1743 (2018). [DOI] [PubMed] [Google Scholar]
  • 79.Karsdal, M. A. et al. Disease-modifying treatments for osteoarthritis (DMOADs) of the knee and hip: lessons learned from failures and opportunities for the future. Osteoarthr. Cartil.24, 2013–2021 (2016). [DOI] [PubMed] [Google Scholar]
  • 80.Meini, S. & Maggi, C. A. Knee osteoarthritis: a role for bradykinin?. Inflamm. Res.57, 351–361 (2008). [DOI] [PubMed] [Google Scholar]
  • 81.Longhurst, H. J. Management of acute attacks of hereditary angioedema: potential role of icatibant. Vasc. Health Risk Manag6, 795–802 (2010). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 82.Perkins, M. N., Kelly, D. & Davis, A. J. Bradykinin B1 and B2 receptor mechanisms and cytokine-induced hyperalgesia in the rat. Can. J. Physiol. Pharmacol.73, 832–836 (1995). [DOI] [PubMed] [Google Scholar]
  • 83.Tonussi, C. R. & Ferreira, S. H. Bradykinin-induced knee joint incapacitation involves bradykinin B2 receptor mediated hyperalgesia and bradykinin B1 receptor-mediated nociception. Eur. J. Pharmacol.326, 61–65 (1997). [DOI] [PubMed] [Google Scholar]
  • 84.Walsh, D. A., Mapp, P. I. & Kelly, S. Calcitonin gene-related peptide in the joint: contributions to pain and inflammation. Br. J. Clin. Pharmacol.80, 965–978 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 85.McMurdo, L., Lockhart, J. C. & Ferrell, W. R. Modulation of synovial blood flow by the calcitonin gene-related peptide (CGRP) receptor antagonist, CGRP(8–37). Br. J. Pharmacol.121, 1075–1080 (1997). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 86.Mojsoska, B. & Jenssen, H. Peptides and peptidomimetics for antimicrobial drug design. Pharmaceuticals8, 366–415 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 87.Zheng, Z. et al. Glucagon-like peptide-1 receptor: mechanisms and advances in therapy. Signal Transduct. Target. Ther.9, 234 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 88.Charignon, D., Späth, P., Martin, L. & Drouet, C. Icatibant, the bradykinin B2 receptor antagonist with target to the interconnected kinin systems. Expert Opin. Pharmacother. https://www.tandfonline.com/doi/abs/10.1517/14656566.2012.723692 (2012). [DOI] [PubMed]
  • 89.Strohl, W. R. Fusion proteins for half-life extension of biologics as a strategy to make biobetters. Biodrugs29, 215–239 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 90.Friedman, J. M. The discovery and development of GLP-1 based drugs that have revolutionized the treatment of obesity. Proc. Natl. Acad. Sci. USA121, e2415550121 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 91.Lee, S. & Lee, D. Y. Glucagon-like peptide-1 and glucagon-like peptide-1 receptor agonists in the treatment of type 2 diabetes. Ann. Pediatr. Endocrinol. Metab.22, 15–26 (2017). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 92.Zhang, W. et al. Structural modeling of osteoarthritis ADAMTS4 complex with its cognate inhibitory protein TIMP3 and rational derivation of cyclic peptide inhibitors from the complex interface to target ADAMTS4. Bioorg. Chem.76, 13–22 (2018). [DOI] [PubMed] [Google Scholar]
  • 93.Crook, Z. R. et al. Ex silico engineering of cystine-dense peptides yielding a potent bispecific T cell engager. Sci. Transl. Med.14, eabn0402 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 94.Dwivedi, G. et al. Effects of dexamethasone and IGF-1 on post-traumatic osteoarthritis-like catabolic changes in a human cartilage-bone-synovium microphysiological system in space and ground control tissues on earth. Front. Space Technol.5, 1358412 (2024). [Google Scholar]
  • 95.Bartolotti, I., Roseti, L., Petretta, M., Grigolo, B. & Desando, G. A roadmap of in vitro models in osteoarthritis: a focus on their biological relevance in regenerative medicine. J. Clin. Med.10, 1920 (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 96.Grimm, H. et al. Advancing the 3Rs: innovation, implementation, ethics and society. Front. Vet. Sci.10, 1185706 (2023). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 97.Ronaldson-Bouchard, K. & Vunjak-Novakovic, G. Organs on a chip: a fast-track for engineered human tissues in drug development. Cell Stem Cell22, 310–324 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 98.Occhetta, P. et al. Hyperphysiological compression of articular cartilage induces an osteoarthritic phenotype in a cartilage-on-a-chip model. Nat. Biomed. Eng.3, 545–557 (2019). [DOI] [PubMed] [Google Scholar]
  • 99.Paggi, C. A., Teixeira, L. M., Le Gac, S. & Karperien, M. Joint-on-chip platforms: entering a new era of in vitro models for arthritis. Nat. Rev. Rheumatol.18, 217–231 (2022). [DOI] [PubMed] [Google Scholar]
  • 100.Lin, H., Lozito, T. P., Alexander, P. G., Gottardi, R. & Tuan, R. S. Stem cell-based microphysiological osteochondral system to model tissue response to interleukin-1β. Mol. Pharm.11, 2203–2212 (2014). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 101.Lin, Z. et al. Osteochondral tissue chip derived from iPSCs: modeling OA pathologies and testing drugs. Front. Bioeng. Biotechnol.7, 411 (2019). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 102.Mondadori, C. et al. Recapitulating monocyte extravasation to the synovium in an organotypic microfluidic model of the articular joint. Biofabrication13, 045001 (2021). [DOI] [PubMed] [Google Scholar]
  • 103.Banh, L., Cheung, K. K., Chan, M. W. Y., Young, E. W. K. & Viswanathan, S. Advances in organ-on-a-chip systems for modelling joint tissue and osteoarthritic diseases. Osteoarthr. Cartil.30, 1050–1061 (2022). [DOI] [PubMed] [Google Scholar]
  • 104.Morgen, M. et al. Nanoparticles for improved local retention after intra-articular injection into the knee joint. Pharm. Res.30, 257–268 (2013). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 105.Kim, S. R. et al. Cationic PLGA/Eudragit RL nanoparticles for increasing retention time in synovial cavity after intra-articular injection in knee joint. Int. J. Nanomed.10, 5263–5271 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 106.Brown, S., Pistiner, J., Adjei, I. M. & Sharma, B. Nanoparticle properties for delivery to cartilage: the implications of disease state, synovial fluid, and off-target uptake. Mol. Pharm.16, 469–479 (2019). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 107.Eisner, L. E., Rosario, R., Andarawis-Puri, N. & Arruda, E. M. The role of the non-collagenous extracellular matrix in tendon and ligament mechanical behavior: a review. J. Biomech. Eng.144, 050801 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 108.Verdonk, P. C. M. et al. Characterisation of human knee meniscus cell phenotype. Osteoarthr. Cartil.13, 548–560 (2005). [DOI] [PubMed] [Google Scholar]
  • 109.Federico, S. et al. Design of decorin-based peptides that bind to collagen I and their potential as adhesion moieties in biomaterials. Angew. Chem. Int. Ed. Engl.54, 10980–10984 (2015). [DOI] [PubMed] [Google Scholar]
  • 110.Zeng, N., Yan, Z.-P., Chen, X.-Y. & Ni, G.-X. Infrapatellar fat pad and knee osteoarthritis. Aging Dis.11, 1317–1328 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 111.Kolonin, M. G., Saha, P. K., Chan, L., Pasqualini, R. & Arap, W. Reversal of obesity by targeted ablation of adipose tissue. Nat. Med.10, 625–632 (2004). [DOI] [PubMed] [Google Scholar]
  • 112.Hu, H.-Y. et al. DOTAM derivatives as active cartilage-targeting drug carriers for the treatment of osteoarthritis. Bioconjug. Chem.26, 383–388 (2015). [DOI] [PubMed] [Google Scholar]
  • 113.Formica, F. A., Barreto, G. & Zenobi-Wong, M. Cartilage-targeting dexamethasone prodrugs increase the efficacy of dexamethasone. J. Controlled Release295, 118–129 (2019). [DOI] [PubMed] [Google Scholar]
  • 114.Feng, K. et al. Reversing the surface charge of MSC-derived small extracellular vesicles by εPL-PEG-DSPE for enhanced osteoarthritis treatment. J. Extracell. Vesicles10, e12160 (2021). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 115.Gonzales, G. et al. Branched poly-l-lysine for cartilage penetrating carriers. Bioeng. Transl. Med. e10612. [DOI] [PMC free article] [PubMed]
  • 116.Gonzales, G., Hoque, J., Kaeo, C., Zauscher, S. & Varghese, S. Grafting of cationic molecules to hyaluronic acid improves adsorption and cartilage lubrication. Biomater. Sci.12, 4747–4758 (2024). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 117.Tokunou, T. et al. Engineering insulin-like growth factor-1 for local delivery. FASEB J.22, 1886–1893 (2008). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 118.Shortt, C., Luyt, L. G., Turley, E. A., Cowman, M. K. & Kirsch, T. A hyaluronan-binding peptide (P15-1) reduces inflammatory and catabolic events in IL-1β-treated human articular chondrocytes. Sci. Rep.10, 1441 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 119.Yan, W. et al. Chondrocyte-targeted delivery system of sortase a-engineered extracellular vesicles silencing MMP13 for osteoarthritis therapy. Adv. Healthc. Mater.13, 2303510 (2024). [DOI] [PubMed] [Google Scholar]
  • 120.Zhang, T. et al. Novel synovial targeting peptide-sinomenine conjugates as a potential strategy for the treatment of rheumatoid arthritis. Int. J. Pharm.617, 121628 (2022). [DOI] [PubMed] [Google Scholar]
  • 121.Kim, J. et al. TAMRA-conjugated DRL tripeptide for the visualization of synovium. Dyes Pigments205, 110590 (2022). [Google Scholar]
  • 122.Qi, W. et al. Modulating synovial macrophage pyroptosis and mitophagy interactions to mitigate osteoarthritis progression using functionalized nanoparticles. Acta Biomater.181, 425–439 (2024). [DOI] [PubMed] [Google Scholar]
  • 123.Yang, X. et al. Targeting formyl peptide receptor 1 of activated macrophages to monitor inflammation of experimental osteoarthritis in rat. J. Orthop. Res.34, 1529–1538 (2016). [DOI] [PubMed] [Google Scholar]
  • 124.Boda, S. K., Wang, H., John, J. V., Reinhardt, R. A. & Xie, J. Dual delivery of alendronate and E7-BMP-2 peptide via calcium chelation to mineralized nanofiber fragments for alveolar bone regeneration. ACS Biomater. Sci. Eng.6, 2368–2375 (2020). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 125.Lin, C.-W. et al. Bone-targeting nanoparticles of a dendritic (Aspartic acid)3-functionalized PEG-PLGA biopolymer encapsulating simvastatin for the treatment of osteoporosis in rat models. Int. J. Mol. Sci.23, 10530 (2022). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 126.Zhang, G. et al. A delivery system targeting bone formation surfaces to facilitate RNAi-based anabolic therapy. Nat. Med.18, 307–314 (2012). [DOI] [PubMed] [Google Scholar]
  • 127.Vessillier, S. et al. Molecular engineering of short half-life small peptides (VIP, αMSH and γ₃MSH) fused to latency-associated peptide results in improved anti-inflammatory therapeutics. Ann. Rheum. Dis.71, 143–149 (2012). [DOI] [PubMed] [Google Scholar]
  • 128.Getting, S. J., Christian, H. C., Flower, R. J. & Perretti, M. Activation of melanocortin type 3 receptor as a molecular mechanism for adrenocorticotropic hormone efficacy in gouty arthritis. Arthritis Rheum.46, 2765–2775 (2002). [DOI] [PubMed] [Google Scholar]
  • 129.Capsoni, F. et al. Melanocyte-stimulating-hormone (α-MSH) modulates human chondrocyte activation induced by proinflammatory cytokines. BMC Musculoskelet. Disord.16, 154 (2015). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 130.Liang, Y. et al. Vasoactive intestinal peptide alleviates osteoarthritis effectively via inhibiting NF-κB signaling pathway. J. Biomed. Sci.25, 25 (2018). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 131.An, J.-S. et al. Inhibition of fibrotic changes in infrapatellar fat pad alleviates persistent pain and articular cartilage degeneration in monoiodoacetic acid-induced rat arthritis model. Osteoarthr. Cartil.29, 380–388 (2021). [DOI] [PubMed] [Google Scholar]
  • 132.Colares, M. C. et al. Platelet-rich plasma and IL-1β antagonist receptor peptide attenuate the inflammatory process of muscle injury in Wistar rats. Sci. Rep.15, 14219 (2025). [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 133.De-Pieri, E. et al. DAP1-2: a synthetic peptide targeting IL-1R1 receptor effectively suppresses IL-1β in vitro. Immunol. Res.72, 788–796 (2024). [DOI] [PubMed] [Google Scholar]
  • 134.Bullock, C. M. et al. Peripheral calcitonin gene-related peptide receptor activation and mechanical sensitization of the joint in rat models of osteoarthritis pain. Arthritis Rheumatol. Hoboken Nj66, 2188–2200 (2014). [DOI] [PMC free article] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Data Availability Statement

No datasets were generated or analysed during the current study.


Articles from npj Biomedical Innovations are provided here courtesy of Nature Publishing Group

RESOURCES