Abstract
ASPP2 is a key protein in regulating apoptosis both in p53-dependent and-independent pathways. The C-terminal part of ASPP2 contains four ankyrin repeats and an SH3 domain (Ank-SH3) that mediate the interactions of ASPP2 with apoptosis related proteins such as p53, Bcl-2 and the p65 subunit of NFκB. p53 core domain (p53CD) binds the n-src loop and the RT loop of ASPP2 SH3. ASPP2 contains a disordered proline rich domain (ASPP2 Pro) that forms an intramolecular autoinhibitory interaction with the Ank-SH3 domains. Here we show how this intramolecular interaction affects the intermolecular interactions of ASPP2 with p53, Bcl-2 and NFkB. We used biophysical methods to obtain better understanding of the relationship between ASPP2 and its partners for getting a comprehensive view on ASPP2 pathways. Fluorescence anisotropy competition experiments revealed that both ASPP2 Pro and p53CD competed for binding the n-src loop of the ASPP2 SH3, indicating regulation of p53CD binding to this loop by ASPP2 Pro. Peptides derived from the ASPP2-binding interface of Bcl-2 did not compete with p53CD or NFkB peptides for binding the ASPP2 n-src loop. However, p53CD displaced the NFκB peptide (residues 303–332) from its complex with ASPP2 Ank-SH3, indicating that NFκB 303–332 and p53CD bind a partly overlapping site in ASPP2 SH3, mostly in the RT loop. These results are in agreement with previous docking studies, which showed that ASPP2 Ank-SH3 binds Bcl-2 and NFκB mostly via distinct sites from p53. However they show some overlap between the binding sites of p53CD and NFkB in ASPP2 Ank-SH3. Our results provide experimental evidence that the intramolecular interaction in ASPP2 regulates its binding to p53CD and that ASPP2 Ank-SH3 binds Bcl-2 and NFκB via distinct sites.
Introduction
p53 is one of the major tumor suppressor proteins in the cell. It is a transcription factor that induces growth arrest or apoptosis in response to cellular stress [1], [2]. The p53 response depends on the amount and type of cellular stress: In cells under low stress, p53 functions as a protector and its activation leads to cell cycle arrest and DNA repair. When the stress is high, p53 induces senescence or apoptosis that kills the cell in order to save the organism [2]. Following its induction, p53 binds specific promoters in the DNA and activates the transcription of a wide array of target genes, aimed at eliminating the danger of potential cancer [3]–[5]. p53 contains several structural and functional domains: an N-terminal transactivation domain followed by a proline rich domain, a DNA-binding/core domain and an oligomerization domain in its C-terminus [6].
ASPP2 is one of the three members of the ASPP (Apoptosis Stimulating Proteins of p53) family, which also includes ASPP1 and iASPP. ASPP1 and ASPP2 activate the apoptotic p53 response, but not the cell-cycle arrest response, while iASPP inhibits p53-mediated apoptosis [7], [8]. ASPP2 gene methylation causes low levels of ASPP2 expression in human cancers, which is correlated with poor clinical outcome [7], [9], [10]. Bbp (bcl-2 binding protein) is an ASPP2 variant lacking the 123 N-terminal residues. Both ASPP2 and Bbp are encoded by the TP53BP2 gene [8], [11]. ASPP2 contains several structural and functional domains: Its N-terminus (residues 1–83) has the structure of a beta-Grasp ubiquitin-like fold [12]. It is followed by a predicted alpha-helical domain located between residues 123–323 [11], and an intrinsically disordered proline-rich domain (ASPP2 Pro) between residues 674–902 [13]. The C-terminal part of ASPP2 contains four ankyrin repeats and an SH3 domain (ASPP2 Ank-SH3), as observed in its crystal structure in complex with p53CD (Figure 1A) [8], [11], [14]. p53CD loop2 (residues 164–194) and loop3 (residues 237–250) bind ASPP2 in the loop of the fourth ankyrin repeat (residues 1020–1026), the n-src (residues 1089–1096) loop and the RT loop (residues 1067–1080) in the SH3 domain (Figure 1A and B and C) [14], [15]. Besides p53, the Ank-SH3 domains of ASPP2 mediate its interactions with numerous partner proteins such as Bcl-2 and the p65 subunit of NFκB, most of which are also involved in apoptosis or its regulation [11], [16], [17]. NFκB is a transcription factor that is activated following a wide array of signals and induces genes that can protect the cell or contribute to apoptosis [18], [19]. The antiapoptotic Bcl-2 protein belongs to the Bcl-2 family that contains proapoptotic and antiapoptotic members, which form homo-/heterodimers that maintain the balance between apoptosis and cell survival [20]. Structural models for the interactions of ASPP2 Ank-SH3 with Bcl-2 and NFκB suggest that Bcl-2 103–120 and NFκB 303–313 bind two different non-overlapping sites in the first ankyrin repeat of ASPP2 between residues 931–961. Bcl-2 7–24 also binds next to the RT loop of the SH3 domain (Figure 1C) [21], [22]. We have previously demonstrated an intramolecular interaction between ASPP2 Pro and ASPP2 Ank-SH3: ASPP2 Pro (residues 693–918) binds the first ankyrin repeat (residues 931–961) and the n-src loop of the SH3 domain (residues 1083–1096) (Figure 1D) [13]. This intramolecular interaction regulates the intermolecular protein-protein interactions of ASPP2 by an autoinhibitory mechanism, as shown for a peptide derived from NFκB in vitro and for the protein Yap in vivo [13], [23]. The sites in ASPP2 that bind Bcl-2 and NFκB were also identified by us [13], [21], [22], indicating that Bcl-2, NFκB and p53 all bind the same interface of ASPP2 Ank-SH3 but their binding sites do not overlap.
The TP53 gene encoding p53 is frequently mutated in human cancers and most of these reported mutations are in the DNA-binding core domain of the protein (p53CD) [24], [25]. Some of these mutations lower the thermodynamic stability of p53, resulting in its unfolding and inactivation [26]. A nine-residue peptide derived from ASPP2 n-src loop (residues 1089–1097), also termed CDB3, restored the specific DNA binding activity of the highly destabilized p53CD mutant I195T to the levels similar to the wild-type level [27]. This peptide slowed down the unfolding of p53CD at 37°C in a concentration-dependent manner by maintaining the mutant protein in a folded conformation and preventing its aggregation, therefore allowing it enough time to reach the nucleus and bind its sequence-specific target DNA or the p53 binding proteins that stabilize it [27]. This ASPP2 n-src loop peptide rescued the structural effects of mutation in p53 R249S mutant back towards the wild-type-like structure [28] and activated other mutants p53 in cells [29].
Here we show, using fluorescence anisotropy competition experiments, that the intramolecular interaction in ASPP2 regulates the binding of ASPP2 Ank-SH3 to p53CD. The ASPP2 SH3 domain bound ASPP2 Pro and p53CD via the same site. p53CD binding to the ASPP2 SH3 n-src peptide (ASPP2 1089–1097) was inhibited by the ASPP2 Pro peptide (residues 722–737). p53CD displaced the ASPP2 Pro peptide from its complex with ASPP2 Ank-SH3. ASPP2-binding peptides derived from Bcl-2 and NFκB did not compete with each other or with p53CD for its binding to the ASPP2 n-src peptide. However, p53CD displaced the NFκB peptide from its complex with ASPP2 Ank-SH3. These results strongly support our previous docking studies [21], [22]. They provide experimental evidence that the intramolecular domain-domain interaction in ASPP2 regulates its binding to p53CD and that ASPP2 Ank-SH3 binds Bcl-2 and NFκB via distinct sites.
Materials and Methods
Expression and purification of p53CD
The pRSET A (Invitrogen) vector containing p53 94–312 (kind gift from Prof. A. R. Fersht, MRC-LMB Cambridge), was transformed into E. coli strain C41 (DE3) (Lucigen). Cells were grown at 37°C in 2×YT medium to an optical density (600 nm) of ∼0.6 and induced with 1 mM isopropyl-β-D-1-thiogalactoside (IPTG) and 100 µM ZnSO4 were added upon induction. Cells were harvested after 20 h of incubation at 20°C and were lysed by Microfluidizer (Microfluidics) in 20 mM phosphate buffer pH 7.2, 25 mM NaCl, 10 mM β mercaptoethanol (βME), 0.2 mM PMSF and 1∶200 protease inhibitor P-8849 (Sigma). Soluble lysate was loaded onto a HiTrap SP 5 ml cation exchange column (Pharmacia) and eluted with NaCl gradient (0–1 M) using an FPLC system (ÄKTA explorer, Amersham Biosciences). The eluted protein was diluted to a final salt concentration <50 mM and purified on a HiTrap heparin 5 ml column (Pharmacia) in 20 µM phosphate buffer pH 7.2, 25 mM NaCl, 10 µM βME with NaCl gradient (0–1 M) for elution. The eluted protein was further purified by gel filtration on a Superdex 75 column (100×1.6 cm; Amersham Biosciences). The protein was stored in 20 mM phosphate buffer pH 7.2, 300 mM NaCl, 10 mM βME.
Expression and Purification of ASPP2 Ank-SH3
pRSET HLT ASPP2 893–1128 vector (a kind gift from Prof. A. R. Fersht, MRC-LMB Cambridge) was expressed, and the protein was purified as described [13].
Peptide Synthesis and Purification
Peptides were synthesized on a Liberty Microwave-Assisted Peptide Synthesizer (CEM), using standard Fmoc chemistry as described [30]. Peptides were fluorescein-labeled at the N terminus as described [30]. For peptides sequences see Table 1.
Table 1. The ASPP2 Ank-SH3 binding peptides used in this study.
Peptide | Sequence |
ASPP2 722–737 | *WRKKLSNAPRPLKKRSS |
ASPP2 1089–1097 | REDEDEIEW |
NFκB 303–332 | KRTYETFKSIMKKSPFSGPTDPRPPPRRIA |
Bcl-2 7–24 | YDNREIVMKYIHYKLSQR |
Bcl-2 103–120 | RRYRRDFAEMSSQLHLTP |
Trp was added at the N terminus of the peptide for UV spectroscopy.
Fluorescence Anisotropy
Measurements were performed at 10°C by using a PerkinElmer Life Sciences LS-50b spectrofluorometer equipped with a Hamilton microlab M dispenser. Titration of ASPP2 Ank-SH3 into the fluorescein-labeled (Fl) peptides was performed in 20 mM Hepes at pH 7.0 at ionic strength (IS) of 50 mM, 100 mM or 150 mM NaCl and 5 mM βME. Titration of p53CD, ASPP2 722–737 into the Fl-ASPP2 1089–1097 were performed in 50 mM Hepes at pH 7.0 10 mM NaCl and 10 mM βME as described [27] or in 20 mM Hepes at pH 7.0 at IS of 50 mM by NaCl, and 5 mM βME for NFκB 303–332. Fluorescence was measured with excitation at 480 nm and emission at 530 nm. The labeled peptide was placed in the cuvette in a volume of 1 ml, at a concentration of 100 nM, and 100–200 µl of titrant were placed in the dispenser. Additions of 5–10 µl of protein or unlabeled peptide were titrated at 60–90 sec intervals, the solution was stirred for 10 seconds, and the fluorescence and anisotropy were measured. Dissociation constants (Kd) were calculated as described in ref. [13] by fitting the anisotropy titration curves (corrected for the dilution effect) using Kaleidagraph (Synergy Software, Reading, PA) to the following equation describing a 1∶1 binding model.
Where r is the measured fluorescence anisotropy value, Δr is the amplitude of the fluorescence anisotropy change from the initial value (peptide only) to the final value (peptide in complex), r 0 is the starting anisotropy value corresponding to the free peptide, [P] is the protein concentration, K d is the dissociation constant.
In the competition experiments, the conditions were as follows: 100–200 µl of competitor peptide or protein were added to a 1200 µl mixture of 83 nM Fl-ASPP2 722–737 and 8.3 µM ASPP2 Ank-SH3 at 20 mM Hepes pH 7.0, IS = 50 mM, 5 mM βME; 200 µl of 130 µM of competitor peptide were added to a 1150-µl mixture of 87 nM Fl peptide ASPP2 1089–1097 and 6.5 µM p53CD at 50 mM Hepes pH 7.0, IS = 20 mM, 10 mM βME; 200 µl of 130 µM of Bcl-2 103–120 or Bcl-2 7–24 were added to a 1100 µl mixture of 87 nM Fl-NFκB 303–332 and 2.25 µM ASPP2 Ank-SH3 or to 1150 µl mixture of 87 nM Fl-ASPP2 722–737 and 4.5 µM ASPP2 Ank-SH3 at 20 mM Hepes pH 7.0, IS = 50 mM, 5 mM βME. The K d of the competitor was calculated as described [27].
Results
p53CD and ASPP2 Pro share the same binding site in ASPP2 SH3
A major p53-interacting site in ASPP2 SH3 is situated in the n-src loop between residues 1089–1097 [14], [27] (Figure 1A, B). We have previously shown by peptide array screening that the n-src peptide also binds ASPP2 Pro [13]. Following this observation we tested whether the ASPP2 intramolecular interaction regulates the binding of ASPP2 Ank-SH3 to p53CD by performing a series of fluorescence anisotropy competition experiments. The ASPP2 Pro peptide (residues 722–737) was titrated into the fluorescein-labeled (Fl) ASPP2 n-src peptide (residues 1089–1097). The peptides bound each other with K d = 0.50±0.03 µM (Figure 2A). p53CD bound Fl-ASPP2 n-src peptide with K d = 0.63±0.02 µM (Figure 2B) in agreement with previously reported studies [27], [29]. In the competition assay, non-labeled ASPP2 Pro peptide (722–737) was added to the fully formed complex between p53CD and the Fl-n-src peptide. The non-labeled ASPP2 Pro peptide (722–737) displaced p53CD from its complex with Fl-n-src peptide (Figure 2B), indicating an overlapping binding site. The anisotropy decreased only mildly because the ASPP2 pro peptide bound the Fl-n-src peptide instead of p53CD. In the opposite experiment p53CD was added to a pre-formed complex between the ASPP2 Pro peptide and the Fl-ASPP2 n-src peptide (Figure 2A). In this case the final anisotropy level increased, because the heavier p53CD molecule (MW∼24 kDa) bound the Fl-n-src peptide instead of the lighter ASPP2 Pro peptide (1.7 kDa). In this competition assay p53CD and the Pro peptide did not bind each other but rather both bound the fluorescein labeled n-src peptide and displaced each other from the complex.
To test whether p53CD binding interferes with the domain-domain interaction in ASPP2, ASPP2 Ank-SH3 was titrated into Fl-ASPP2 Pro peptide (Figure 3A) and ability of p53CD to displace it from the complex was tested (Figure 3B). p53CD displaced ASPP2 Pro peptide from its complex with ASPP2 Ank-SH3, in agreement with our results above. In this competition assay p53CD bound ASPP2 Ank-SH3 and displaced the fluorescein labeled Pro peptide, resulting in K d = 0.47 µM for the p53CD – ASPP2 Ank-SH3 at IS = 50 mM.
Bcl2 and NFκB derived peptides did not compete with p53CD for binding the ASPP2 SH3 n-src loop
It is known from our previous theoretical studies that ASPP2 Ank-SH3 binds p53CD, Bcl2 and NFκB 1–313 via the same face of the molecule but with minimal overlap between the binding sites (Figure 1C) [31]. To test this experimentally we used fluorescence anisotropy competition experiments. p53CD was titrated into Fl-ASPP2 n-Src loop (residues 1089–1097) (Figure 4A) and unlabeled peptides, derived from the ASPP2-binding sites in Bcl-2 or NFκB, were added to the fully formed complex (Figure 4B). The peptides Bcl-2 7–24, Bcl-2 103–120 [22], NFκB 21–50 and NFκB 303–332 [13], [21] (Table 1) did not compete with p53CD on binding the ASPP2 peptide, indicating that the binding sites are indeed different and providing an experimental evidence for our prediction.
Fl-NFκB 303–332 was previously shown to bind ASPP2 Ank-SH3 and compete with the Pro peptide ASPP2 722–737 [13]. We thus assumed that NFκB 303–332 also binds the SH3 domain of ASPP2, similar to p53CD and the ASPP2 Pro peptide. To test this we titrated p53CD into the fully formed complex between ASPP2 Ank-SH3 and Fl- NFκB 303–332 (Figure 5A). p53CD displaced the NFκB peptide from the complex (Figure 5B), indicating that p53CD and NFκB 303–332 share a partly overlapping binding site in the ASPP2 SH3 domain. K d for the p53CD – ASPP2 Ank-SH3 interaction in this experiment (IS = 150 mM) was found to be 2.45 µM, in agreement with the previously reported ITC results performed at similar condition [32].
Bcl2 derived peptides and the ASPP2 Pro peptide do not share the same binding site in ASPP2 Ank-SH3
We have previously shown that p53CD, the NFκB peptide 303–332 and ASPP2 Pro 722–737 [13] bind the same site in ASPP2 Ank-SH3 domains. To test if Bcl-2 7–24 and Bcl-2 103–120 also share the same binding site we titrated Bcl-2 peptides into the complex between ASPP2 Ank-SH3 and Fl-ASPP2 722–737 (Figure 6A). Both Bcl-2 peptides did not displace Fl-ASPP2 722–737 (Figure 6B) from the complex, in agreement with our previous results showing that the Bcl-2 binding sites are not in the n-src loop of ASPP2 (Figure 1B and C).
Bcl-2 and NFκB peptides do not share the same binding site in ASPP2
According to our structural models, Bcl-2 103–120 and NFκB 303–313 bind two different non-overlapping sites in the first ankyrin repeat of ASPP2 between residues 931–961 (Figure 1C) [21], [22], [31]. Here we showed that NFκB 303–332 and p53CD share a partly overlapping binding site in the ASPP2 SH3 domain, which is not predicted to overlap the Bcl-2 7–24 binding sites in the SH3 domain (Figure 1C) [22]. To test this experimentally, we performed fluorescence anisotropy competition experiments between the ASPP2 Ank-SH3-binding peptides Bcl-2 7–24, Bcl-2 103–120 and NFκB 303–332. ASPP2 Ank-SH3 was titrated into Fl-NFκB 303–332 (Figure 7A), and the ability of the non-labeled peptides Bcl-2 103–120 and Bcl-2 7–24 to displace it was tested. The Bcl-2 peptides did not displace NFκB 303–332 from the complex with ASPP2 Ank-SH3 (Figure 7B). These results indicate that the Bcl-2 and NFκB peptides bind ASPP2 Ank-SH3 at different sites and validate the structural models [21], [22], [31].
Discussion
Here we used fluorescence anisotropy competition experiments to reveal the effect of the intramolecular interaction in ASPP2 on its binding to p53CD. The change in anisotropy in the competition experiments can result from two reasons: (i) interaction of the unlabelled competitor with the labeled peptide, releasing the partner protein. In such a case the anisotropy decreases because the new complex formed between two peptides is smaller than the peptide-protein complex. This was the case when p53CD was titrated into the complex between the Fl-n-src peptide and the ASPP2 Pro peptide; (ii) interaction of the unlabelled competitor with the protein, releasing the labeled peptide. Here the anisotropy decreases because the labeled peptide is released from its complex with the partner protein. This was the case when p53CD was titrated to the complex between Fl-ASPP2 Pro peptide and ASPP2 Ank-SH3.
p53CD and a peptide derived from ASPP2 Pro bind ASPP2 SH3 at the same site: Biological consequences
In this study we found that p53CD and the ASPP2 Pro 722–737 peptide compete for this same binding site in the ASPP2 SH3 domain. This suggests that the intramolecular interaction in ASPP2, between the Ank-SH3 and Pro domains, has a role in regulating the interactions of ASPP2 with p53. The ASPP2 n-src peptide (ASPP2 residues 1089–1097) was shown to sensitize colorectal carcinoma HCT116 cells, but not HCT116 p53−/− cells, to apoptosis induced by γ-irradiation [29]. It is possible that the peptide inhibits the intramolecular interaction in ASPP2 and thus activates the p53-ASPP2 interaction that induces apoptosis. The n-src peptide also restored the wild-type conformation to R175H and R273H mutant p53 in cells [29]. This effect may be due to the induction of the p53 interaction with ASPP2.
Bcl-2 peptides do not displace NFκB peptide and Pro peptide from ASPP2 Ank-SH3
We previously suggested, based on computational models, that ASPP2 Ank-SH3 binds NFκB and Bcl-2 in different non-overlapping sites (Figure 1C) [31]. In the computational model the Bcl2 BH4 derived peptide Bcl-2 7–24 binds next to the SH3 RT loop of ASPP2 while Bcl-2 103–120 binds the first ankyrin repeat of ASPP2 [22]. The NFκB 303–332 peptide is also predicted to bind ASPP2 Ank-SH3 via the same sites [21]. Here we showed by fluorescence anisotropy competition experiments that indeed NFκB 303–332 does not compete with Bcl-2 derived peptides for binding ASPP2 Ank-SH3. The results provide experimental evidence to the models [21], [22] according to which NFκB and Bcl-2 both bind the first ankyrin repeats of ASPP2 but binding is mediated via different residues. The binding sites may have a little overlap but the affinity of the NFκB 303–332 peptide to the ASPP2 Ank-SH3 domain may be high enough (Figure 6A) so that the low affinity Bcl-2 peptides cannot displace it. Indeed, ASPP2 Ank-SH3 binds Fl-Bcl-2 7–24 with K d = 4.7±0.2 µM [22] but its affinity to Fl-NFκB 303–332 is 0.13±0.01 µM under the same conditions.
The Bcl-2 peptides did not compete with the ASPP2 Pro peptide for binding ASPP2 Ank-SH3. According to our previously published computational model the, the n-src loop of the ASPP2 SH3 domain is not involved in Bcl-2 binding (Figure 1B, C).
Here we identified the specific binding site of the Pro peptide to the n-src loop (Figure 2A). The full length ASPP2 Pro domain, residues 693–918, also binds the first ankyrin repeat of ASPP2 between residues 931–961 [13]. Its binding site overlaps both the binding sites to Bcl-2 and NFκB (Figure 1C and D) [31], as was shown before in peptide array screening [13]. This is possible since the proline rich domain is long and intrinsically disordered [13], and the ASPP2 Ank-SH3 binding sites to Bcl-2 and NFκB are spatially close [31].
NFκB peptides and p53CD bind overlapping sites in ASPP2 Ank-SH3
Based on our results we suggest that the p53CD binding sites in ASPP2 Ank-SH3 are different from the sites that bind NFκB and Bcl-2. p53CD loop3 (residues 241–249) binds the ASPP2 SH3 domain in the n-src loop and the RT loop (Figure 1A) [14]. The Bcl-2 BH4 peptide (residues 7–24) binds the RT loop of ASPP2 in different residues than the p53 loop3 [14], [22]. In fluorescence anisotropy competition assay the peptides derived from Bcl-2 and NFκB did not displace p53CD from its complex with Fl-ASPP2 n-src peptide. However, p53CD displaced Fl-NFκB 303–332 from its complex with ASPP2 Ank-SH3. These results suggest that NFκB 303–332 binds the ASPP2 SH3 domain mostly through the RT loop (Figure 1B). NFκB 303–332 did not bind the n-src loop peptide in fluorescence anisotropy experiments (data not shown). NFκB 303–332 also competed with the ASPP2 Pro 722–737 peptide that binds ASPP2 via the n-src loop. It is possible that the NFκB 303–332 peptide has an allosteric effect on the binding of the ASPP2 Pro peptide or that its binding to the n-src loop is induced in a cooperative way only after its binding to the RT loop. NFκB 303–332 is also predicted to be intrinsically disordered by different methods [33]–[35], and only NFκB 303–313 is predicted to bind the first ankyrin repeat of ASPP2 [21]. According to the peptide array studies, residues 314–350 in NFκB participate in ASPP2 Ank-SH3 binding [13]. It is thus possible that NFκB 314–332 peptide binds the SH3 domain of ASPP2. Indeed, the NFκB 303–332 peptide (Table 1) contains a proline rich sequence in its C-terminus that could be a ligand of the ASPP2 SH3 domain [36], [37].
ASPP2 and Bbp are both encoded by the TP53BP2 gene but ASPP2 contains 123 additional residues in its N-terminus [8], [11]. NFκB inhibits the pro-apoptotic function of Bbp and prevents cell death by the mitochondrial death pathway. Binding p53 may stabilize Bbp and increase its protein level [38]. It is possible that the pro-apoptotic function of Bbp/ASPP2 (both containing the Ank-SH3 domains) is reduced when NFκB competes with p53 on the interaction with the Ank-SH3 domains. By binding p53, ASPP2 mediates the transactivation action of p53 on pro apoptotic genes [8]. Inhibition of this interaction would thus inhibit the apoptotic function of p53.
Our experimental results presented here further support our previous model for the role of the domain-domain interaction in regulating the protein-protein interactions of ASPP2 (Figure 8) [13], [39]. We show that p53CD and the proline rich domain of ASPP2 compete for the same binding sites in ASPP2 Ank-SH3. This sheds light on how ASPP2 regulates p53-mediated apoptosis at the molecular level.
Acknowledgments
We thank Dr Tsafi Danieli and Dr Mario Lebendiker for their help with protein expression and purification.
Funding Statement
AF was supported by a grant from the Israeli Ministry of Health and by a starting grant from the European Research Council under the European Community's Seventh Framework Programme (FP7/2007-2013)/ERC Grant agreement n° 203413. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
References
- 1. Suzuki K, Matsubara H (2011) Recent advances in p53 research and cancer treatment. J Biomed Biotechnol 2011: 978312. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 2. Vousden KH, Prives C (2009) Blinded by the Light: The Growing Complexity of p53. Cell 137: 413–431. [DOI] [PubMed] [Google Scholar]
- 3. Vogelstein B, Lane D, Levine AJ (2000) Surfing the p53 network. Nature 408: 307–310. [DOI] [PubMed] [Google Scholar]
- 4. Ryan KM, Phillips AC, Vousden KH (2001) Regulation and function of the p53 tumor suppressor protein. Curr Opin Cell Biol 13: 332–337. [DOI] [PubMed] [Google Scholar]
- 5. Michael D, Oren M (2002) The p53 and Mdm2 families in cancer. Curr Opin Genet Dev 12: 53–59. [DOI] [PubMed] [Google Scholar]
- 6. Joerger AC, Fersht AR (2007) Structure-function-rescue: the diverse nature of common p53 cancer mutants. Oncogene 26: 2226–2242. [DOI] [PubMed] [Google Scholar]
- 7. Bergamaschi D, Samuels Y, O'Neil NJ, Trigiante G, Crook T, et al. (2003) iASPP oncoprotein is a key inhibitor of p53 conserved from worm to human. Nat Genet 33: 162–167. [DOI] [PubMed] [Google Scholar]
- 8. Samuels-Lev Y, O'Connor DJ, Bergamaschi D, Trigiante G, Hsieh JK, et al. (2001) ASPP proteins specifically stimulate the apoptotic function of p53. Mol Cell 8: 781–794. [DOI] [PubMed] [Google Scholar]
- 9. Liu WK, Jiang XY, Ren JK, Zhang ZX (2010) Expression pattern of the ASPP family members in endometrial endometrioid adenocarcinoma. Onkologie 33: 500–503. [DOI] [PubMed] [Google Scholar]
- 10. Zhao J, Wu G, Bu F, Lu B, Liang A, et al. (2010) Epigenetic silence of ankyrin-repeat-containing, SH3-domain-containing, and proline-rich-region- containing protein 1 (ASPP1) and ASPP2 genes promotes tumor growth in hepatitis B virus-positive hepatocellular carcinoma. Hepatology 51: 142–153. [DOI] [PubMed] [Google Scholar]
- 11. Naumovski L, Cleary ML (1996) The p53-binding protein 53BP2 also interacts with Bc12 and impedes cell cycle progression at G2/M. Mol Cell Biol 16: 3884–3892. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12. Tidow H, Andreeva A, Rutherford TJ, Fersht AR (2007) Solution structure of ASPP2 N-terminal domain (N-ASPP2) reveals a ubiquitin-like fold. J Mol Biol 371: 948–958. [DOI] [PubMed] [Google Scholar]
- 13. Rotem S, Katz C, Benyamini H, Lebendiker M, Veprintsev D, et al. (2008) The structure and interactions of the proline-rich domain of ASPP2. J Biol Chem 283: 18990–18999. [DOI] [PubMed] [Google Scholar]
- 14. Gorina S, Pavletich NP (1996) Structure of the p53 tumor suppressor bound to the ankyrin and SH3 domains of 53BP2. Science 274: 1001–1005. [DOI] [PubMed] [Google Scholar]
- 15. Robinson RA, Lu X, Jones EY, Siebold C (2008) Biochemical and structural studies of ASPP proteins reveal differential binding to p53, p63, and p73. Structure 16: 259–268. [DOI] [PubMed] [Google Scholar]
- 16. Kampa KM, Bonin M, Lopez CD (2009) New insights into the expanding complexity of the tumor suppressor ASPP2. Cell Cycle 8: 2871–2876. [DOI] [PubMed] [Google Scholar]
- 17. Yang JP, Hori M, Takahashi N, Kawabe T, Kato H, et al. (1999) NF-kappaB subunit p65 binds to 53BP2 and inhibits cell death induced by 53BP2. Oncogene 18: 5177–5186. [DOI] [PubMed] [Google Scholar]
- 18. Perkins ND, Gilmore TD (2006) Good cop, bad cop: the different faces of NF-kappaB. Cell Death Differ 13: 759–772. [DOI] [PubMed] [Google Scholar]
- 19. Ryan KM, Ernst MK, Rice NR, Vousden KH (2000) Role of NF-kappaB in p53-mediated programmed cell death. Nature 404: 892–897. [DOI] [PubMed] [Google Scholar]
- 20. Adams JM, Cory S (2007) The Bcl-2 apoptotic switch in cancer development and therapy. Oncogene 26: 1324–1337. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21. Benyamini H, Leonov H, Rotem S, Katz C, Arkin IT, et al. (2009) A model for the interaction between NF-kappa-B and ASPP2 suggests an I-kappa-B-like binding mechanism. Proteins 77: 602–611. [DOI] [PubMed] [Google Scholar]
- 22. Katz C, Benyamini H, Rotem S, Lebendiker M, Danieli T, et al. (2008) Molecular basis of the interaction between the antiapoptotic Bcl-2 family proteins and the proapoptotic protein ASPP2. Proc Natl Acad Sci U S A 105: 12277–12282. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23. Espanel X, Sudol M (2001) Yes-associated protein and p53-binding protein-2 interact through their WW and SH3 domains. J Biol Chem 276: 14514–14523. [DOI] [PubMed] [Google Scholar]
- 24. Bouchet BP, de Fromentel CC, Puisieux A, Galmarini CM (2006) p53 as a target for anti-cancer drug development. Crit Rev Oncol Hematol 58: 190–207. [DOI] [PubMed] [Google Scholar]
- 25. Cho Y, Gorina S, Jeffrey PD, Pavletich NP (1994) Crystal structure of a p53 tumor suppressor-DNA complex: understanding tumorigenic mutations. Science 265: 346–355. [DOI] [PubMed] [Google Scholar]
- 26. Bullock AN, Henckel J, DeDecker BS, Johnson CM, Nikolova PV, et al. (1997) Thermodynamic stability of wild-type and mutant p53 core domain. Proc Natl Acad Sci U S A 94: 14338–14342. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27. Friedler A, Hansson LO, Veprintsev DB, Freund SM, Rippin TM, et al. (2002) A peptide that binds and stabilizes p53 core domain: chaperone strategy for rescue of oncogenic mutants. Proc Natl Acad Sci U S A 99: 937–942. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28. Friedler A, DeDecker BS, Freund SM, Blair C, Rudiger S, et al. (2004) Structural distortion of p53 by the mutation R249S and its rescue by a designed peptide: implications for “mutant conformation”. J Mol Biol 336: 187–196. [DOI] [PubMed] [Google Scholar]
- 29. Issaeva N, Friedler A, Bozko P, Wiman KG, Fersht AR, et al. (2003) Rescue of mutants of the tumor suppressor p53 in cancer cells by a designed peptide. Proc Natl Acad Sci U S A 100: 13303–13307. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30. Hayouka Z, Rosenbluh J, Levin A, Loya S, Lebendiker M, et al. (2007) Inhibiting HIV-1 integrase by shifting its oligomerization equilibrium. Proc Natl Acad Sci U S A 104: 8316–8321. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 31. Benyamini H, Friedler A (2011) The ASPP interaction network: electrostatic differentiation between pro- and anti-apoptotic proteins. J Mol Recognit 24: 266–274. [DOI] [PubMed] [Google Scholar]
- 32. Tidow H, Veprintsev DB, Freund SM, Fersht AR (2006) Effects of oncogenic mutations and DNA response elements on the binding of p53 to p53-binding protein 2 (53BP2). J Biol Chem 281: 32526–32533. [DOI] [PubMed] [Google Scholar]
- 33. Prilusky J, Felder CE, Zeev-Ben-Mordehai T, Rydberg EH, Man O, et al. (2005) FoldIndex: a simple tool to predict whether a given protein sequence is intrinsically unfolded. Bioinformatics 21: 3435–3438. [DOI] [PubMed] [Google Scholar]
- 34. Linding R, Russell RB, Neduva V, Gibson TJ (2003) GlobPlot: Exploring protein sequences for globularity and disorder. Nucleic Acids Res 31: 3701–3708. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35. Yang ZR, Thomson R, McNeil P, Esnouf RM (2005) RONN: the bio-basis function neural network technique applied to the detection of natively disordered regions in proteins. Bioinformatics 21: 3369–3376. [DOI] [PubMed] [Google Scholar]
- 36. Kay BK, Williamson MP, Sudol M (2000) The importance of being proline: the interaction of proline-rich motifs in signaling proteins with their cognate domains. FASEB J 14: 231–241. [PubMed] [Google Scholar]
- 37. Saksela K, Permi P (2012) SH3 domain ligand binding: What's the consensus and where's the specificity? FEBS Lett [DOI] [PubMed] [Google Scholar]
- 38. Takahashi N, Kobayashi S, Kajino S, Imai K, Tomoda K, et al. (2005) Inhibition of the 53BP2S-mediated apoptosis by nuclear factor kappaB and Bcl-2 family proteins. Genes Cells 10: 803–811. [DOI] [PubMed] [Google Scholar]
- 39. Rotem S, Katz C, Friedler A (2007) Insights into the structure and protein-protein interactions of the pro-apoptotic protein ASPP2. Biochem Soc Trans 35: 966–969. [DOI] [PubMed] [Google Scholar]