Skip to main content
Acta Crystallographica Section F: Structural Biology Communications logoLink to Acta Crystallographica Section F: Structural Biology Communications
. 2014 Sep 25;70(Pt 10):1414–1417. doi: 10.1107/S2053230X14019165

Purification, crystallization and preliminary X-ray crystallographic studies of Drep2 CIDE domain

Seung Mi Lee a, Hyun Ho Park a,*
PMCID: PMC4188092  PMID: 25286952

The CIDE domain of Drep2 was purified and crystallized in space group P212121, with unit-cell parameters a = 50.28, b = 88.70, c = 113.37 Å. The crystals diffracted to a resolution of 2.3 Å.

Keywords: apoptosis, DNA fragmentation factor, CIDE domain, Drep2, Drosophila melanogaster

Abstract

Drep2 is a novel nuclease from the fruit fly that might have a similar function in apoptosis to DFF40 and DFF45, which are primary players in apoptotic DNA fragmentation. Drep2 contains a conserved CIDE domain of ∼90 amino-acid residues that is involved in protein–protein interaction. In this study, the Drep2 CIDE domain was purified and crystallized by the hanging-drop vapour-diffusion method. X-ray diffraction data were then collected to a resolution of 2.3 Å. The crystals were found to belong to the orthorhombic space group P212121, with unit-cell parameters a = 50.28, b = 88.70, c = 113.37 Å.

1. Introduction  

Chromatin condensation and cleavage are hallmarks of apoptotic cells (Nagata, 2000; Liu et al., 1997; Enari et al., 1998; Park et al., 2007). It is well known that DNA undergoes fragmentation and is cleaved into regular fragments with unit lengths of ∼180 bp during apoptosis (Enari et al., 1998; Liu et al., 1997; Park, 2012). Apoptotic DNA fragmentation is primarily executed by DNA fragmentation factor DFF40 (CAD is the mouse orthologue), which is a novel nuclease that is inhibited by DFF45 (ICAD is the mouse orthologue) via tight interactions. Interestingly, DFF45 seems to function as a chaperone for DFF40 during its synthesis (Park, 2009). The N-termini of DFF40 and DFF45 contain a conserved CIDE domain, which is a protein-interaction module composed of about 90 amino-acid residues (Lugovskoy et al., 1999; Wu et al., 2008). CIDE-A, CIDE-B and CIDE-3 (also called FSP27 in the mouse) have been identified as CIDE-domain-containing proteins. Although all CIDE-domain-containing proteins are known to function in apoptosis, the function of CIDE-containing proteins has recently been broadened by the revelation of new roles in energy metabolism (Yonezawa et al., 2011).

A search for CIDE-domain-containing proteins in Drosophila melanogaster revealed four proteins: Drep1, Drep2, Drep3 and Drep4 (Inohara & Nuñez, 1999). Although the functions of Drep proteins in the fruit fly have not been clearly identified, several studies have shown that Drep1 and Drep4 might be DFF45 and DFF40 orthologues, respectively (Lee & Park, 2014; Sakahira et al., 1999). Recently, nuclease activity of Drep2 and Drep2-inhibitory activity of Drep3 have been reported (Park & Park, 2012). Unlike other CIDE domains, the Drep2 CIDE domain forms a large homo-oligomer in solution (Lee & Park, 2013) and it has been reported that Drep2 can interact with both Drep1 and Drep3 via the CIDE domain (Lee & Park, 2013). Structural studies of protein-interaction domains are particularly important in understanding the molecular pathways mediated by protein interactions (Park, 2011; Bae & Park, 2011). Although the interactions mediated by the CIDE domain are important in understanding the regulatory mechanism of apoptotic DNA fragmentation, structural information regarding the CIDE domains and their complexes is limited. To date, two CIDE-domain structures have been determined by NMR, including a complex structure between the DFF40 and DFF45 CIDE domains, which shows an α/β roll with two α-helices and five β-strands (Lugovskoy et al., 1999; Otomo et al., 2000). Despite the availability of the NMR structures, further structural studies of the CIDE domain are important to aid understanding of apoptotic DNA fragmentation. Structural investigations of the Drep2 CIDE domain will be particularly interesting because the Drep2 CIDE domain can form a homo-oligomer, which has never been reported for other CIDE domains. In the current study, we overexpressed, purified and crystallized the Drep2 CIDE domain as a first step towards elucidating its molecular structure and regulatory mechanism. X-ray diffraction data were collected to a resolution of 2.3 Å and the crystals were found to belong to the orthorhombic space group P212121, with unit-cell parameters a = 50.28, b = 88.70, c = 113.37 Å. Details regarding the structure of this domain will hopefully enable us to understand the regulatory mechanism of apoptotic DNA fragmentation and the homo-oligomerization mechanism of the CIDE domain.

2. Materials and methods  

2.1. Macromolecule production  

Drep2 CIDE (amino-acid residues 1–84) was amplified by PCR using gene-specific primers containing NdeI and XhoI sites (Table 1). Full-length Drep2 from D. melanogaster (GenBank ID AF149795) was used as the DNA template. PCR fragments were subsequently digested and ligated into the pET-26b vector containing a C-terminal hexahistidine tag. The recombinant sequence was verified by DNA sequencing. Construction of the Drep2 CIDE domain adds an eight-residue tag that includes six C-terminal histidine residues (LEHHHHHH). The expression vector was transformed into Escherichia coli BL21 (DE3) competent cells. Individual colonies were then inoculated into 5 ml LB medium and incubated overnight at 37°C with shaking. Cultured cells were then transferred to 1 l LB medium and incubated for 4 h at 37°C with shaking, after which expression was induced with 0.5 mM isopropyl β-d-1-thiogalactopyranoside (IPTG) for 20 h at 20°C. Following induction, the bacteria were collected, resuspended and lysed by sonication in 50 ml lysis buffer (20 mM Tris–HCl pH 7.9, 500 mM NaCl, 10 mM imidazole). The bacterial lysate was subsequently centrifuged at 16 000 rev min−1 for 30 min at 4°C, after which the supernatant was applied onto a gravity-flow column (Bio-Rad) packed with 2 ml Ni–NTA affinity resin (Qiagen). The unbound bacterial proteins were subsequently removed from the column using 100 ml washing buffer (20 mM Tris–HCl pH 7.9, 500 mM NaCl, 60 mM imidazole). The target protein was subsequently eluted from the column using elution buffer (20 mM Tris–HCl pH 7.9, 500 mM NaCl, 250 mM imidazole) and 0.6 ml elution fractions were collected over a total of 6 ml. Fractions containing greater than 90% homogeneous proteins, based upon SDS–PAGE analysis, were pooled and loaded onto a Superdex 200 gel-filtration column 10/30 (GE Healthcare) pre-equilibrated with a solution consisting of 20 mM Tris–HCl pH 8.0, 500 mM NaCl. Purification procedures are given in Table 1.

Table 1. Macromolecule-production information.

Source organism D. melanogaster
DNA source GenBank AF149795
Forward primer 5-GGGCATATGATGGCCAGAGAGGAGTCTCG-3
Reverse primer 5-GGGCTCGAGCCAGCGCTCGCCCTGCCTTA-3
Cloning vector pET-26b
Expression vector pET-26b
Expression host E. coli
Complete amino-acid sequence of the construct produced MAREESRGKRPLKIWDSWRNVRKGVVVGTFEELLVRGKDKLGVPASEPVRVVLECDGTQIEDGEYFRTLANNTVLLLLRQGERWLEHHHHHHH

The NdeI site is underlined.

The XhoI site is underlined.

2.2. Crystallization  

The initial conditions for crystallization were screened at 20°C by the hanging-drop vapour-diffusion method using screening kits from Hampton Research (Crystal Screen, Crystal Screen 2, Index HT, SaltRX, Natrix, MembFac and Crystal Screen Cryo) and from the deCODE Biostructure Group (Wizard I, II, III and IV). 24-Well crystallization plates from Hampton Research were used and initial crystals were grown on a siliconized coverslip by equilibrating a mixture consisting of 1 µl protein solution (6–8 mg ml−1 protein in 20 mM Tris–HCl pH 8.0, 500 mM NaCl) and 1 µl reservoir solution against 0.5 ml reservoir solution. The condition 0.1 M bis-tris pH 5.5, 0.3 M formate dihydrate produced an initial crystal but it did not grow properly and diffracted to only 8–10 Å resolution. Optimization of the buffer and the precipitant and the use of an additive screen (Hampton Research) finally produced a long, stick-shaped crystal with 0.1 M bis-tris pH 5.0, 0.4 M formate dihydrate, and 0.2 M non­detergent sulfobetaine 221 (NDSB-221), a zwitterionic compound, as an additive. Crystals appeared in 3 d and grew to maximum dimensions of 0.05 × 0.05 × 0.3 mm. This crystal diffracted to 2.3 Å resolution. A summary of the crystallization is provided in Table 2.

Table 2. Crystallization.

Method Hanging-drop vapour diffusion
Plate type 24-well plates from Hampton Research
Temperature (C) 20
Protein concentration (mgml1) 68
Buffer composition of protein solution 20mM TrisHCl pH 8.0, 500mM NaCl
Composition of reservoir solution 0.4M formate dihydrate, 0.2M NDSB-221, 0.1M bis-tris pH 5.0
Volume and ratio of drop 2l, 1:1
Volume of reservoir (l) 500

2.3. Data collection and processing  

For data collection, the crystals were flash-cooled in liquid nitrogen using 35% glycerol in the crystallization solution as a cryoprotectant. Diffraction data sets were collected on beamline 5C (SB II) of the Pohang Accelerator Laboratory (PAL), Republic of Korea. The data set was indexed and processed using HKL-2000 (Otwinowski & Minor, 1997). Diffraction data statistics are given in Table 3.

Table 3. Data collection and processing.

Values in parentheses are for the outer shell.

Diffraction source 5C (SBII) at PAL
Wavelength () 0.97951
Temperature (C) 163
Detector ADSC Quantum 315r
Crystal-to-detector distance (mm) 250
Rotation range per image () 1
Total rotation range () 180
Exposure time per image (s) 2
Space group P212121
a, b, c () 50.28, 88.70, 113.37
, , () 90, 90, 90
Mosaicity () 0.6
Resolution range () 502.3
Total No. of reflections 60122
No. of unique reflections 10489
Completeness (%) 95.4 (98.3)
Multiplicity 9.7 (5.9)
I/(I) 55.8 (3.8)
R merge 5.6 (28.4)

3. Results and discussion  

To understand CIDE-mediated protein interaction and its roles in apoptotic DNA fragmentation and energy metabolism, we expressed and purified the Drep2 CIDE domain using affinity chromatography followed by gel-filtration chromatography. The quick two-step chromatography produced highly pure Drep2 CIDE which showed no contaminating bands on SDS–PAGE (Fig. 1). Drep2 CIDE elutes at around 120 kDa from a Superdex 200 gel-filtration column calibrated with a gel-filtration standard (Bio-Rad) containing a mixture of thyroglobulin (670 000 Da), globulin (158 000 Da), ovalbumin (44 000 Da), myoglobulin (17 000 Da) and vitamin B12 (1350 Da) (Fig. 1). Assuming that the complex bands contain ∼20 µg protein and the detection limit of SDS–PAGE is 0.1 µg, the purity of the complex was >99%. Since the calculated molecular weight of monomeric Drep2 CIDE, including the additional residues at the C-terminus, was 10 864.4 Da, it is clear that Drep2 CIDE exists as a large oligomeric complex in solution (Fig. 1).

Figure 1.

Figure 1

Purification of Drep2 CIDE domain by gel-filtration chromatography. Superdex S-200 gel-filtration column analysis of Drep2 CIDE domain. An SDS–PAGE of the fractions from the peak of the Drep2 CIDE domain is shown.

An initial crystal was obtained from 0.1 M bis-tris pH 5.5, 0.3 M formate dihydrate, although it only diffracted poorly to 8–10 Å resolution. Better crystals were obtained using an additive screen (Hampton Research), and the use of 0.2 M NDSB-221 produced long, stick-shaped crystals (Fig. 2) that grew to dimensions of 0.05 × 0.05 × 0.3 mm in 3 d and diffracted to 2.3 Å resolution (Fig. 3). The crystals were found to belong to the orthorhombic space group P212121, with unit-cell parameters a = 50.28, b = 88.70, c = 113.37 Å. Diffraction data statistics are shown in Table 3.

Figure 2.

Figure 2

Crystal of Drep2 CIDE domain. The crystal grew in 3 d in the presence of 0.4 M formate dihydrate, 0.2 M NDSB-221, 0.1 M bis-tris pH 5.0. The approximate dimensions of the crystal were 0.05 × 0.05 × 0.3 mm.

Figure 3.

Figure 3

A diffraction image from the Drep2 CIDE domain crystal with a 2.3 Å resolution limit.

Molecular replacement with Phaser (McCoy et al., 2007) and the CIDE domain of human CIDE-B (PDB entry 1d4b; 29% sequence identity to Drep2 CIDE; Lugovskoy et al., 1999) as a search model gave a clear solution including four chains in the asymmetric unit. This corresponds to a Matthews coefficient (V M) of 2.77 Å3 Da−1 and a solvent content of 55.6% (Matthews, 1968). Preliminary refinement with REFMAC5 (Murshudov et al., 2011) using the initial Phaser model gave an R work of 32.8% and an R free of 36.7%. Further structural refinement is in progress.

Acknowledgments

This work was supported by the 2012 Yeungnam University Research Grant.

References

  1. Bae, J. Y. & Park, H. H. (2011). J. Biol. Chem. 286, 39528–39536. [DOI] [PMC free article] [PubMed]
  2. Enari, M., Sakahira, H., Yokoyama, H., Okawa, K., Iwamatsu, A. & Nagata, S. (1998). Nature (London), 391, 43–50. [DOI] [PubMed]
  3. Inohara, N. & Nuñez, G. (1999). Cell Death Differ. 6, 823–824. [DOI] [PubMed]
  4. Lee, S. M. & Park, H. H. (2013). FEBS Lett. 587, 854–859. [DOI] [PubMed]
  5. Lee, S. M. & Park, H. H. (2014). Apoptosis, 19, 428–435. [DOI] [PubMed]
  6. Liu, X., Zou, H., Slaughter, C. & Wang, X. (1997). Cell, 89, 175–184. [DOI] [PubMed]
  7. Lugovskoy, A. A., Zhou, P., Chou, J. J., McCarty, J. S., Li, P. & Wagner, G. (1999). Cell, 99, 747–755. [DOI] [PubMed]
  8. Matthews, B. W. (1968). J. Mol. Biol. 33, 491–497. [DOI] [PubMed]
  9. McCoy, A. J., Grosse-Kunstleve, R. W., Adams, P. D., Winn, M. D., Storoni, L. C. & Read, R. J. (2007). J. Appl. Cryst. 40, 658–674. [DOI] [PMC free article] [PubMed]
  10. Murshudov, G. N., Skubák, P., Lebedev, A. A., Pannu, N. S., Steiner, R. A., Nicholls, R. A., Winn, M. D., Long, F. & Vagin, A. A. (2011). Acta Cryst. D67, 355–367. [DOI] [PMC free article] [PubMed]
  11. Nagata, S. (2000). Exp. Cell Res. 256, 12–18. [DOI] [PubMed]
  12. Otomo, T., Sakahira, H., Uegaki, K., Nagata, S. & Yamazaki, T. (2000). Nature Struct. Biol. 7, 658–662. [DOI] [PubMed]
  13. Otwinowski, Z. & Minor, W. (1997). Methods Enzymol. 276, 307–326. [DOI] [PubMed]
  14. Park, H. H. (2009). BMB Rep. 42, 713–718. [DOI] [PubMed]
  15. Park, H. H. (2011). Apoptosis, 16, 209–220. [DOI] [PubMed]
  16. Park, H. H. (2012). Int. J. Mol. Sci. 13, 4807–4818. [DOI] [PMC free article] [PubMed]
  17. Park, H. H., Lo, Y.-C., Lin, S.-C., Wang, L., Yang, J. K. & Wu, H. (2007). Annu. Rev. Immunol. 25, 561–586. [DOI] [PMC free article] [PubMed]
  18. Park, O. K. & Park, H. H. (2012). FEBS Lett. 586, 3085–3089. [DOI] [PubMed]
  19. Sakahira, H., Enari, M. & Nagata, S. (1999). J. Biol. Chem. 274, 15740–15744. [DOI] [PubMed]
  20. Wu, C., Zhang, Y., Sun, Z. & Li, P. (2008). BMC Evol. Biol. 8, 159. [DOI] [PMC free article] [PubMed]
  21. Yonezawa, T., Kurata, R., Kimura, M. & Inoko, H. (2011). Mol. Biosyst. 7, 91–100. [DOI] [PubMed]

Articles from Acta Crystallographica. Section F, Structural Biology Communications are provided here courtesy of International Union of Crystallography

RESOURCES