Skip to main content
The Journal of Biological Chemistry logoLink to The Journal of Biological Chemistry
. 2014 Sep 23;289(45):31361–31372. doi: 10.1074/jbc.M114.597153

Regulation of S-Adenosylhomocysteine Hydrolase by Lysine Acetylation*

Yun Wang , Jennifer M Kavran §, Zan Chen , Kannan R Karukurichi , Daniel J Leahy ‡,§, Philip A Cole ‡,1
PMCID: PMC4223336  PMID: 25248746

Background: S-Adenosylhomocysteine hydrolase (SAHH) regulates methyltransferase reactions and is acetylated on two lysines.

Results: We prepared acetylated semisynthetic SAHH and determined the impact of acetylation on structure and activity.

Conclusion: Lys acetylation of SAHH changes hydrogen bonding patterns in its NAD+ binding regions and reduces its catalytic activity.

Significance: Acetylation of SAHH may serve to regulate global alterations in cellular methylation.

Keywords: Enzyme, Peptides, Post-translational Modification (PTM), Protein Structure, X-ray Crystallography

Abstract

S-Adenosylhomocysteine hydrolase (SAHH) is an NAD+-dependent tetrameric enzyme that catalyzes the breakdown of S-adenosylhomocysteine to adenosine and homocysteine and is important in cell growth and the regulation of gene expression. Loss of SAHH function can result in global inhibition of cellular methyltransferase enzymes because of high levels of S-adenosylhomocysteine. Prior proteomics studies have identified two SAHH acetylation sites at Lys401 and Lys408 but the impact of these post-translational modifications has not yet been determined. Here we use expressed protein ligation to produce semisynthetic SAHH acetylated at Lys401 and Lys408 and show that modification of either position negatively impacts the catalytic activity of SAHH. X-ray crystal structures of 408-acetylated SAHH and dually acetylated SAHH have been determined and reveal perturbations in the C-terminal hydrogen bonding patterns, a region of the protein important for NAD+ binding. These crystal structures along with mutagenesis data suggest that such hydrogen bond perturbations are responsible for SAHH catalytic inhibition by acetylation. These results suggest how increased acetylation of SAHH may globally influence cellular methylation patterns.

Introduction

S-Adenosylhomocysteine hydrolase (SAHH)2 is the cellular enzyme responsible for catalyzing the hydrolytic breakdown of S-adenosylhomocysteine (AdoHcy) to adenosine and l-homocysteine (Hcy) in mammals (see Fig. 1) (1). AdoHcy is the product of S-adenosyl-l-methionine (AdoMet)-dependent biological methyltransferases including those that act on proteins and DNA. It has been established previously that genetic knockdown of SAHH or its chemical inhibition by 3-deazaneplanocin A leads to accumulation of AdoHcy and generalized product inhibition of AdoMet-dependent methyltransferases (2, 3). One of the enzymes that seems particularly sensitive to AdoHcy feedback inhibition is EZH2, the histone lysine methyltransferase component of the Polycomb repressor complex 2 responsible for Lys27 methylation of histone H3, a signature mark of heterochromatic gene silencing (24). Recent studies indicate that SAHH inhibition by 3-deazaneplanocin A can reactivate developmental genes in acute myeloid leukemia cells, halting cellular proliferation (3, 4).

FIGURE 1.

FIGURE 1.

The catalytic cycle of SAHH occurs in both forward and reverse directions. The forward reaction involves NAD+-mediated oxidation of the 3′-hydroxy group to the ketone followed by β-elimination of homocysteine, generating an exo-methylene intermediate; stereospecific Michael addition of water to the exo-methylene intermediate followed by NADH-mediated reduction of the 3-ketone produce adenosine and regenerates NAD+ (adapted from Ref. 24).

SAHH dysfunction is linked to numerous pathologies such as neurological and vascular disorders, myopathy, fatty liver, cancer, renal insufficiency, and diabetic nephropathy (513). Deletion of SAHH in mice is embryonically lethal (14). Human SAHH deficiency is a rare genetic disorder and is characterized by up to 140-fold elevated plasma AdoHcy levels with a significant decrease in the SAM/AdoHcy ratio, typically leading to severe pathological consequences and death in childhood (6, 1517).

SAHH is a highly conserved, NAD+-dependent, homotetrameric enzyme that shows >70% amino acid sequence identity from yeast to human (18). The functional tetramer of SAHH is composed of four identical ∼48-kDa subunits each of which contains an N-terminal substrate binding domain, a catalytic domain, and a C-terminal tail. Unlike typical NAD+-dependent dehydrogenases, where each cofactor is bound by one monomer, NAD+ binding to SAHH requires contributions from neighboring subunits via their C-terminal tails (1922). The catalytic mechanism of SAHH involves NAD+-mediated oxidation of the 3′-hydroxy group to the ketone followed by β-elimination of homocysteine, generating an exo-methylene intermediate (Fig. 1). Stereospecific Michael addition of water to the exo-methylene intermediate followed by NADH-mediated reduction of the 3-ketone furnishes adenosine and regenerates NAD+ (Fig. 1), which is tightly bound and serves a catalytic role in the overall reversible reaction (1, 23, 24).

Whereas SAHH is recognized as a key enzyme in controlling gene expression and a potential drug target for the design of antiviral (25, 26), antiparasitic (27), and antiarthritic agents (28), the cellular regulation of SAHH is poorly understood. Several years ago, mammalian SAHH was reported in a proteomics study to be acetylated on two C-terminal Lys resides, 401 and 408 (29), the latter of which is highly conserved. However, the consequences of these acetylations were not explored. Classical site-directed mutagenesis is commonly used to analyze the role of post-translational modifications including acetyl-Lys, but can be misleading because of imprecise mimicry with the standard amino acid substitutes for unacetylated Lys (Arg) and acetyl-Lys (Gln) (3032). Here we use expressed protein ligation, a technique for protein semisynthesis, to generate site-specifically acetylated SAHH and determine the effects of acetylation on enzymatic kinetics. Both acetylation of Lys401 and Lys408 inhibit the activity of SAHH. We also show using x-ray crystallography that both Lys401 and Lys408 acetylation of SAHH perturb local hydrogen bonding interactions, and we propose that these perturbations may influence catalysis. The significance of acetylation-induced changes in SAHH structure and function are discussed in the context of a potential global impact on cellular methylation status.

EXPERIMENTAL PROCEDURES

Reagents

Mercaptoethylsulfonate was purchased from Sigma. All Fmoc-derivatives were from EMD (Billerica, MA). Other reagents were at the highest grade obtainable from commercial sources.

Peptide Synthesis and Purification

The C-terminal fragment of SAHH (amino acid 396–432 with 396 replaced by Cys, CAHLGKLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY) with or without acetyl groups at Lys401 and Lys408 were synthesized using the standard Fmoc solid phase synthesis strategy on a PS3 peptide synthesizer from Protein Technologies (Tucson, AZ) on 0.1–0.2 mmol scale. Fmoc-protected amino acids were mixed with 4 eq of the coupling reagent 1-(bis(dimethylamino)methylene)-1H-1,2,3-triazolo[4,5-b]pyridinium 3-oxid hexafluorophosphate and double coupled to Wang resin (Novabiochem) containing the protected C-terminal amino acid. The Fmoc protecting group was removed by addition of 20% piperidine in dimethylformamide. A total of four peptides were produced including unacetylated, two singly acetylated, and the bi-acetylated forms. After completion, peptides were cleaved from the resin using reagent K (TFA/thioanisole/water/phenol/ethane dithiol (82.5:5:5:5:2.5, v/v)) for 3–4 h at room temperature. After precipitation with ice-cold diethyl ether, peptides were purified by reversed phase HPLC using a preparative C18 column and a gradient of increasing acetonitrile versus water, each containing 0.05% trifluoroacetic acid. Pure fractions were pooled, concentrated by rotor vapor, lyophilized, and stored at −20 °C.

Purified peptides were run on an analytical C18 reversed-phase HPLC column (Agilent Eclipse XDB-C18) to confirm purity. Peptide powder was dissolved in HPLC aqueous buffer A (water containing 0.05% trifluoroacetic acid). The elution was monitored at 214 nm and carried out at a flow rate of 1 ml/min over a multistage gradient: 5–60% buffer B (acetonitrile containing 0.05% TFA) for 0–65 min, 60–100% B for 65–70 min, 100% B for 70–80 min, 5–100% B for 80–84 min, and 5% B for 84–94 min. Synthetic peptides were shown to be >95% pure by analytical HPLC and the correct structures were confirmed by MALDI-TOF mass spectrometry (Applied Biosystems, Voyager DE-STR).

DNA Plasmid Construction

The full-length human SAHH open reading frame (Invitrogen, IOH14308) was subcloned into pTXB1 vector (New England Biolabs) using NdeI and SapI restriction sites. The pTXB1 vector encodes the GyrA intein from Mycobacterium xenopi followed by the chitin binding domain tag for affinity chromatography. DNA sequencing identified a mutation at Asp86 in the commercial cDNA, which was replaced with an Asn at this position using QuikChange mutagenesis (Agilent) by standard protocols to make it identical to human S-adenosylhomocysteine hydrolase sequence (AAA51681) in GenBankTM. The mutant proteins corresponding to N27K, D293A, and D422K were also prepared using QuikChange mutagenesis.

Preparation of Semisynthetic SAHH Proteins

The truncated SAHH-intein-CBD fusion protein was produced in Escherichai coli BL21(DE3) liquid cultures grown at 37 °C in LB media in shaker flasks on a liter scale, followed by induction at A600 = 0.5 with 0.5 mm isopropyl thiogalactoside at 16 °C for 16–20 h before pelleting the cells by centrifugation (5000 × g). Cells were resuspended in lysis buffer containing 25 mm HEPES, 500 mm NaCl, 1 mm EDTA, 1 mm Tris(2-carboxyethyl)phosphine, 10% glycerol, pH 7.5) and then lysed by passage through a chilled French press cell. The cell lysate maintained at 4 °C was centrifuged for 30 min (27,000 × g) to remove cell debris and insoluble materials and then the supernatant was loaded onto a column containing chitin beads (5 ml/liter of E. coli culture) and incubated at 4 °C for 30 min. After the SAHH-intein-CBD fusion protein was bound to chitin beads, the column was drained by gravity and washed with 20 column volumes of wash buffer I (50 mm HEPES, 500 mm NaCl, 0.1 mm EDTA, pH 7.5) followed by wash buffer II (50 mm HEPES, 150 mm NaCl, 0.1 mm EDTA, pH 7.5). The column was then quickly equilibrated with 200 mm 2-mercaptoethanesulfonate and protease inhibitor (Roche Complete mini) in cleavage buffer (0.2 m potassium phosphate, 0.1 mm EDTA, pH 7.5). After the addition of 5 ml (per liter E. coli culture) of cleavage buffer, the column was purged with N2 gas and sealed. Upon apparent completion of the cleavage reaction as gauged by Coomassie-stained 10% SDS-PAGE (∼40 h at room temperature), the eluent was collected in 2-ml fractions and the column was further eluted with 1–2 more column volumes of cleavage buffer. Fractions that contained significant SAHH levels were concentrated 5–10-fold and subjected to buffer exchange (0.2 m potassium phosphate, 0.1 mm EDTA, pH 6.5) using an Amicon protein concentrator (10-kDa cutoff) to minimize thioester hydrolysis.

The appropriate 37-mer SAHH N-Cys C-terminal peptide containing either Lys or acetyl-Lys at positions 401, 408, or both locations was dissolved in water and then diluted in ligation buffer (0.2 m potassium phosphate, 0.1 mm EDTA, 200 mm mercaptoethylsulfonate, 1 mm NAD+, protease inhibitor, pH 7.0) to make a peptide solution with a final concentration ∼500 μm. The peptide solution was cleared by centrifugation at 20,627 × g in a microcentrifuge for 10 min to remove any precipitation. The concentrated, truncated SAHH C-terminal thioester protein (amino acid 1–395) prepared as described above was added to the N-Cys peptide solution to achieve a final SAHH protein concentration of about 50 μm, ∼1:10 protein:peptide ratio. The tube containing the ligation reaction was sealed after blanketing with N2 gas. Ligation progress was routinely monitored every 12–16 h by Coomassie-stained 10% SDS-PAGE until ∼90% completion (about 36 h at room temperature). If observed, precipitation during the ligation reaction was removed by centrifugation every 12–16 h.

Upon completion of the ligation reaction, the ligation mixture was loaded onto a Superdex 200 size exclusion chromatography column for further purification using purification buffer (20 mm K2HPO4, 100 mm NaCl, 1 mm EDTA, 1 mm DTT, pH 7.2). The FPLC flow rate was 0.4 ml/min and 1.5-ml fractions were collected. Gel filtration standard (Bio-Rad) was run under the same conditions. Fractions that were >95% pure by stained 10% SDS-PAGE were pooled and concentrated using an Amicon protein concentrator (10 kDa cutoff) to >1 mg/liter and dialyzed into final dialysis buffer (10 mm K2HPO4, 1 mm EDTA, pH 7.2) for 48–72 h with two or more buffer exchanges in a dialysis cassette (Slide-A-Lyzer) with a 20-kDa molecular mass cutoff. Semisynthetic SAHH was aliquoted and flash frozen using liquid N2 and stored at −80 °C. Typical yields were >2 mg of semisynthetic SAHH/liter of E. coli culture.

Mass Spectrometric Analysis of Semisynthetic SAHH

Semisynthetic SAHH forms were dialyzed against mass spectrometry buffer (20 mm NH4HCO3, pH 8.0) using a Slide-A-Lyzer mini dialysis unit (20 kDa mass cutoff). Protein was then spotted on a sample plate using the sandwich method with sinapinic acid (10 mg/ml in 40% acetonitrile, 0.1% TFA) as matrix. MALDI-TOF (Applied Biosystems, Voyager DE-STR) spectra were collected with calibration using bovine serum albumin as standard.

Preparation of Full-length, Recombinant SAHH

Full-length (amino acids 1–432) WT recombinant SAHH (r-SAHH) and N27K and D293A mutants were expressed in an intein containing vector using the conditions for the truncated protein as described above. Protein purification of the SAHH-intein-CBD fusion protein immobilized on chitin resin was similar to the truncated protein above except in place of mercaptoethylsulfonate containing buffer, 50 mm DTT cleavage buffer (50 mm HEPES, 150 mm NaCl, 0.1 mm EDTA, pH 7.5) was used. Incubation with DTT cleavage buffer for 16 h at room temperature led to the production of purified WT and mutant r-SAHH (>90% pure by Coomassie-stained 10% SDS-PAGE), flash frozen, and stored at −80 °C until reconstitution at >1 mg/ml.

Reconstitution of SAHH/NAD+

Reconstitution of the NAD+ form of SAHH was carried out as described previously (33). Briefly, SAHH was treated with 80% (v/v) ammonium sulfate in reconstitution buffer (25 mm K2HPO4, 5 mm DTT, 1 mm EDTA) to precipitate the purified SAHH over three successive cycles (pH 2.9, 2.9, and then pH 7.2). The precipitated protein was collected by centrifugation and dissolved in reconstitution buffer at pH 7.2. NAD+ (1 mm) was incubated with 0.1 mm SAHH overnight at 4 °C. The reconstituted NAD+ form of SAHH was further purified by a Superdex 200 column (Amersham Biosciences Sciences, 10/300GL) as described above.

SAHH Enzymatic Assays

Measurement of SAHH activity in the forward (hydrolytic) direction was performed using an indirect, continuous assay by quantifying the production of homocysteine free thiol using Ellman's reagent (5,5′-dithiobis(nitrobenzoic acid) ) (3335) in the presence of adenosine deaminase to prevent reaction reversal. To 200 μl of the enzyme solution containing 0.15–0.3 μm SAHH and 0.8 units of adenosine deaminase (Roche Applied Science) in assay buffer (50 mm potassium phosphate buffer, pH 7.2, 1 mm EDTA, 1 mm NAD+) was added 50 μl of varying concentrations of AdoHcy (15.6–1000 μm) with 250 μm 5,5′-dithiobis(nitrobenzoic acid) in the assay buffer. The reaction mixture was mixed rapidly and monitored at 412 nm continuously at 37 °C using a UV spectrophotometer (Beckman DU640) containing a Peltier temperature controller. The initial rate was obtained by calculating the slope after the reaction reached 37 °C and entered a linear region after a short lag phase (<2 min). An extinction coefficient of 13,600 m−1 cm−1 for 5-thio-2-nitrobenzoate, the product of the 5,5′-dithiobis(nitrobenzoic acid) reaction, was used to calculate the amount of homocysteine formed (3335).

Measurement of SAHH activity in the reverse (AdoHcy synthesis) direction was performed using a direct, discontinuous assay by quantifying AdoHcy formation from adenosine and homocysteine by reversed phase HPLC (36). SAHH (∼0.1 μm) was incubated with 1 mm adenosine and 5 mm homocysteine in 200 μl of assay buffer at 37 °C for 0, 10, 20, 40, and 60 min and the reaction was quenched by addition of 10 μl of 6 n trifluoroacetic acid. Quenched reaction mixtures were filtered through an Amicon microconcentrator (3 kDa cutoff) to remove the protein precipitate. The resulting mixtures were diluted 1:1 in HPLC aqueous buffer A (water containing 0.05% trifluoroacetic acid) and analyzed by HPLC using a C18 reversed-phase column (Agilent Eclipse XDB-C18). The elution was carried out at a flow rate of 1 ml/min over a multistage gradient: 0.5–7% buffer B (acetonitrile containing 0.05% trifluoroacetic acid) for 0–45 min, 7–100% B for 45–50 min, and 100% B for 50–60 min. The peaks corresponding to AdoHcy and adenosine were monitored at 254 nm. The concentration of AdoHcy was determined by calculating the percentage of AdoHcy in the reaction mixture at specific time points with less than 20% substrate conversion. The kcat values were obtained from the slopes from plots of [AdoHcy]/[E] versus time using linear regression curves. All reaction rates were measured in duplicate on two separate occasions and replicate measurements typically agreed within 20%.

Western Blot

Western blots were performed using dry transfers to PVDF via an Iblot dry blotting system (Invitrogen) and blocked with 5% bovine serum albumin in Tris-buffered saline in Tween 20 for 1 h at room temperature. Primary anti-acetyl-lysine antibody (ab21623, Abcam) was applied using a 1:2000 dilution and incubated overnight at 4 °C. Secondary anti-rabbit IgG horseradish peroxidase-linked antibody (GE Healthcare, NA934V) was used at 1:10,000 dilution. Enhanced chemiluminescence Western blotting detection reagents (Amersham Biosciences) were employed in combination with a Western blot imager (Syngene PXI 6).

Protein Crystallization

Reconstituted acetylated semisynthetic SAHH was concentrated to 10–15 mg/ml and dialyzed against crystallization buffer (10 mm Tris, 1 mm EDTA, pH 7.2). Crystals of acetylated semisynthetic SAHH were grown by the hanging-drop method by mixing 2 μl of SAHH with 1 μl of a well solution containing 200 mm sodium formate, 5–20% PEG 3350, and 100 mm BisTris, pH 6.0–6.5. SAHH AcK408 crystals were grown without seeding. Bi-acetylated SAHH was crystallized by microseeding with seeds prepared from SAHH AcK408 crystals. All crystals appeared in less than a week and grew to dimensions of 150 × 150 × 50 μm3.

X-ray Crystallographic Data Collection and Structure Determination

Both bi-acetylated and AcK408 crystals were cryoprotected in a stepwise fashion. The crystals were first stabilized by dropwise addition of 20% PEG 3350, 200 mm sodium formate, 100 mm BisTris, pH 6, and 1 mm NAD+ and then cryoprotected by dropwise addition of the same buffer supplemented with 12% glycerol. Stabilized crystals were harvested and flash frozen in liquid nitrogen. Data were collected at beamline 7.2 at the Stanford Synchrotron Radiation Light Source and processed with HKL2000 (37). Molecular replacement was performed with PHASER (38) using the structure of human SAHH as a search model (39) and diffraction data extending to 2.8 Å. Two independent subunits of SAHH were found in the crystallographic asymmetric unit with a final translational z-score of 66.4. Model building and structure refinement were performed iteratively using COOT (40) and PHENIX (41), respectively.

RESULTS

SAHH Semisynthesis

To generate unacetylated and 401- and 408-acetylated forms of SAHH, we elected to use expressed protein ligation, a protein semisynthesis method that involves replacing the natural C terminus of a protein of interest with a synthetic peptide (Fig. 2) (42). One requirement of expressed protein ligation is the need for a cysteine at the ligation junction (42). As there was not a natural Cys conveniently located, we examined several sites for Cys replacement. We found that replacement of Glu396 with Cys was relatively well tolerated for expression and catalytic properties as reflected in the parameters of semisynthetic SAHH compared with WT recombinant SAHH (see below, Table 1).

FIGURE 2.

FIGURE 2.

SAHH semisynthesis. A, the expressed protein ligation strategy for SAHH semisynthesis links the recombinant N-terminal truncated segment (t-SAHH) to the C-terminal N-Cys-containing synthetic peptide containing acetyl-lysine(s). B, amino acid sequences of SAHH C-terminal 37-mer peptides carrying acetyl-lysine (highlighted in bold) at different sites. MESNA, 2-mercaptoethanesulfonate.

TABLE 1.

Steady-state kinetic parameters for semisynthetic SAHHs (s-SAHH) and unacetylated, wild-type recombinant SAHH (r-SAHH) and r-SAHH mutants

Standard error values are indicated with ± and obtained from nonlinear curve fitting parameters.

Enzyme Forward reaction
Forward reaction, kcat/Km Reverse reaction, kcat
kcat AdoHcy, Km
s1 μm 1m/s s1
r-SAHH 0.79 ± 0.04 13.9 ± 3.2 0.057 2.0 ± 0.10
N27K r-SAHH 0.40 ± 0.01 23.1 ± 2.6 0.017 NPa
D293A r-SAHH 0.56 ± 0.03 33.4 ± 5.3 0.017 NP
s-SAHH 1.04 ± 0.04 12.9 ± 1.7 0.081 3.1 ± 0.09
AcK401-s-SAHH 0.34 ± 0.01 12.3 ± 1.6 0.028 1.2 ± 0.02
AcK408-s-SAHH 0.30 ± 0.02 8.8 ± 2.2 0.034 1.0 ± 0.02
biAcK401/408-s-SAHH 0.36 ± 0.01 23.6 ± 1.8 0.015 1.2 ± 0.01

a NP, not performed.

To perform expressed protein ligation, cDNA for the C terminally deleted form of SAHH (amino acids 1–395, t-SAHH) was subcloned in-frame to a gyrase intein-chitin binding domain containing vector, allowing for thioester generation at the C terminus of the recombinant protein fragment of SAHH. Separately, solid phase synthesis was performed to prepare highly purified N-Cys containing 37-mer synthetic peptides corresponding to the SAHH C-terminal residues amino acids 396–432 with or without side chain acetyl groups on Lys401 or Lys408 (see Fig. 3). Ligation of the recombinant SAHH thioester fragment of amino acids 1–395 (t-SAHH) to the N-Cys peptides proceeded smoothly in the presence of 1 mm NAD+ cofactor, which enhanced the yield of the desired semisynthetic proteins, presumably by stabilizing the SAHH-folded protein structure. The four semisynthetic SAHH proteins, s-SAHH (unacetylated), AcK401-s-SAHH (acetylated at Lys401), AcK408-s-SAHH (acetylated at 408), and bi-AcK401/408-s-SAHH (acetylated at both Lys401 and Lys408) were further purified by size exclusion chromatography (Fig. 4), demonstrating that each was tetrameric. In contrast, truncated SAHH (t-SAHH) was monomeric. Coomassie-stained SDS-PAGE and mass spectrometry showed that each of the semisynthetic SAHH proteins was >90% pure (Fig. 5). In addition, the presence of the acetyl-Lys modifications in AcK401-s-SAHH, AcK408-s-SAHH, and bi-AcK401/408-s-SAHH but not s-SAHH was confirmed by Western blot with anti-acetyl-Lys antibody (see Fig. 5B).

FIGURE 3.

FIGURE 3.

SAHH C-terminal 37-mer peptides with Lys or acetyl-Lys were synthesized using the Fmoc solid phase peptide strategy and purified by HPLC. Their masses were confirmed by MALDI-TOF. A, MALDI-TOF spectra of synthesized C-terminal 37-mer peptides. Unacetylated C-terminal synthetic peptide, m/z = 4254 (calculated m/z: 4255.2); AcK401 C-terminal synthetic peptide, m/z = 4297 (calculated m/z: 4297.2); AcK408 C-terminal synthetic peptide, m/z = 4295 (calculated m/z: 4297.2); and bi-AcK401/408 C-terminal synthetic peptide, m/z = 4337 (calculated m/z: 4339.2). B, analytical reversed phase HPLC chromatograms of C-terminal synthetic peptides confirm >95% purity.

FIGURE 4.

FIGURE 4.

Size exclusion chromatograms of semisynthetic and truncated SAHHs. Unacetylated and acetylated semisynthetic s-SAHH traces are superimposed with the indicated colors, along with truncated SAHH and protein standards. The semisynthetic SAHH proteins showed peak elution at fraction 8, indicated with an asterisk, with an elution volume of ∼12.5 ml, corresponding to a tetramer (calculated mass of about 190 kDa). The t-SAHH peak, indicated with an arrow, eluted at fraction 11 with a elution volume of 15.8 ml, that corresponded to a monomer (calculated mass = 43.3 kDa); the shoulder on the left of this peak corresponds to the mass of partially formed dimer.

FIGURE 5.

FIGURE 5.

SDS-PAGE, Western blots, and mass spectra of purified semisynthetic SAHHs. A, Coomassie-stained 12% SDS-PAGE of purified semisynthetic SAHHs. B, Western blots of semisynthetic SAHHs using anti-acetyl-lysine antibody (ab21623, Abcam). C, MALDI-TOF spectra of purified ligated semisynthetic SAHHs. s-SAHH, m/z = 47,585 Da (calculated m/z: 47,561 Da); AcK401-s-SAHH, m/z = 47,617 Da (calculated m/z: 47,603 Da); AcK408-s-SAHH, m/z = 47617 Da (calculated m/z: 47603 Da;, bi-AcK401/8-s-SAHH, m/z = 47637 Da (calculated m/z: 47645 Da). The S.E. on these mass measurements are estimated to be ±30 Da.

Enzymatic Analysis of Semisynthetic SAHH Proteins

The catalytic activity of SAHH was measured in both the forward (hydrolase) and reverse (AdoHcy synthesis) directions. To determine SAHH activity in the thermodynamically disfavored forward direction, it is necessary to add adenosine deaminase to breakdown adenosine as it is formed to prevent the back reaction (18, 3336). Measurement of SAHH activity in the forward direction was performed by monitoring homocysteine production quantified via its free thiol by reaction with Ellman's reagent in a continuous assay. Measurement of the reverse reaction was performed using a direct, discontinuous assay that permits simultaneous quantification of AdoHcy and adenosine. Although more robust than the measurement of free thiol that can air-oxidize, this HPLC assay is less sensitive and in our hands was only amenable to kcat measurement with saturating substrate concentration because measurements at low substrate concentration show poor signal-to-noise. These experiments showed that the kinetic parameters of unacetylated semisynthetic SAHH (s-SAHH), which contains a E396C replacement, were very similar to fully recombinant WT SAHH (r-SAHH), with kcat (0.79 s−1 versus 1.04 s−1, r-SAHH versus s-SAHH) and AdoHcy Km (13.9 versus 12.9 μm, r-SAHH versus SAHH) values that are within 30% (see Table 1).

Interestingly, the presence of acetylation at either Lys401 (AcK401-s-SAHH, kcat of 0.34 s−1) or Lys408 (AcK408-s-SAHH, kcat of 0.30 s−1) in SAHH conferred 3-fold reduction in kcat relative to unacetylated s-SAHH, with less than a 30% change in AdoHcy Km among these enzyme forms (Table 1, Fig. 6). Doubly acetylated SAHH (bi-AcK401/408-s-SAHH) showed a similar 3-fold kcat reduction and a 2-fold increase in SAH Km. The kcat effects were corroborated by analyzing the reverse reactions (Table 1, Fig. 6). Thus, the catalytic efficiency (kcat/Km) of SAHH was reduced by acetylation at either lysine position and the largest effect, 5-fold reduction, was observed in the dually acetylated enzyme.

FIGURE 6.

FIGURE 6.

Measurements of catalytic activity of semisynthetic SAHHs. A, representative steady-state kinetic plots for semi-synthetic SAHH forward reactions: (blue s-SAHH ●), AcK401-s-SAHH (green ▾), AcK408-s-SAHH (red ▴), bi-AcK401/408-s-SAHH (black ♦); B, representative time course plots for semisynthetic SAHH reverse reactions at saturating substrate concentrations: s-SAHH (blue ●), AcK401-s-SAHH (red ▾), AcK408-s-SAHH (green ▴), bi-AcK401/408-s-SAHH (black ♦); C, representative HPLC traces for semisynthetic SAHHs reverse reactions at saturating substrate concentrations. From top to bottom: enzyme reaction mixture at t = 0 min, s-SAHH reaction mixture at t = 20 min, and AcK401-s-SAHH reaction mixture at t = 20 min. X, Y, and Z represent peaks for NAD+, adenosine, and AdoHcy from left to right, respectively.

Structure of Acetylated SAHH

We determined the crystal structures of semisynthetic SAHH bound to NAD+ with either one acetylation (AcK408) or two acetylations (AcK401/408) by molecular replacement and refine these structures using diffraction data extending to 2.6 and 2.3 Å, respectively (Table 2, Fig. 7). Additional electron density was observed in the adenosine binding pocket and was assigned as adenosine, which likely copurified with SAHH. The electron density for the backbone atoms of the modified residues was clear, but the electron density for the side chains was weak (Fig. 8, A and B) indicating that the side chains are poorly ordered. As the structure of the SAHH AcK408 is nearly identical to SAHH AcK401/408, we will focus our discussion on the bi-acetylated structure.

TABLE 2.

Data collection and refinement statistics

Data collection
    PDB 4PFJ 4PGF
    Protein AcK408 AcK401/408
    Space group I222 I222
    a, b, c (Å) 97.597, 102.740, 175.018 98.366 102.727 176.160
    α = β = γ 90 º 90 º
    Resolution (Å) 50-2.6 (2.69-2.60) 50-2.3 (2.38-2.3)
    Rmerg a,b (%) 12.8 (100.0) 16.9 (100.0)
    I 11.2 (0.72) 10.2 (1.24)
    Completenessb (%) 100.0 (100.0) 99.9 (99.7)
    Redundancy 7.1 (7.0) 6.5 (5.9)
    Unique reflections 27,640 (2717) 39,810 (3912)

Refinement
    Rcrystb,c (%) 18.91 20.09
    Rfreeb,c (%) 24.78 24.69
    No. of atoms
        Protein 13,290 13,313
        Water 25 326
        Other 204 204
    B-factors (Å2)
        Wilson 46.4 28.6
        Mean 74.6 48.4
        Protein 74.9 48.8
        Water 52.3 37.8
        Others 66.7 42.1
    Root mean ssquare deviations
        Bond length (Å) 0.005 0.004
        Bond angle (°) 0.855 0.768
    Ramachandran plot (%)
        Most favorable 96.0 97.1
        Allowed 4.0 2.9
        Disallowed 0 0

a Rmerge is ΣhΣj|Ij − 〈I〉|/ΣhΣj, Ij, where Ij is the intensity of an individual reflection, and 〈I〉 is the mean intensity for multiply recorded reflections.

b The values in parentheses are for the highest resolution shell.

c Rcryst is ΣhFoFc‖/ΣhFo, where Fo is an observed amplitude and Fc a calculated amplitude; Rfree is the same statistic calculated over a subset of the data that has not been used for refinement.

FIGURE 7.

FIGURE 7.

Structure of acetylated, semisynthetic SAHH. A, schematic representation of the superposition of wild-type SAHH (Ref. 39; Protein Data Bank code 1LI4) (yellow) onto SAHH AcK401/408 (white). For SAHH AcK401/408, NAD+ is shown in orange spheres, and adenosine in blue spheres. Cys396, the site of ligation, is marked by a cyan sphere. AcK401 and AcK408, the sites of modification, are marked by green spheres. B, close up of the bottom half of the bi-acetylated SAHH tetramer shown in the same orientation as in A. One monomer is now colored white and the other violet. The ligated, synthetic C-terminal tail for each monomer is shown in either dark gray and dark violet, respectively. The modified residues are shown in green sticks.

FIGURE 8.

FIGURE 8.

Experimental electron density and hydrogen bonding network of acetylated residues. Simulated annealing omit maps of bi-acetylated SAHH in which the atoms corresponding to the side chains of residues 401 and 408 were removed from the model. Shown is the electron density corresponding to the region near AcK401 (A) and AcK408 (B). The 2FoFc electron density is contoured at 1σ (blue), and the FoFc electron density is contoured at 2σ (green). The final model of SAHH AcK401/408 is shown in stick representation. Comparison of non-acetylated (Ref. 39, PDB 1LI4) (shown in yellow sticks) and bi-acetylated SAHH (shown in white sticks) structures is shown for the region surrounding Lys408 (C) and Lys401 (D). A dashed black line marks residues within hydrogen bonding distance. Water is represented by red spheres. The rotamer of the wild-type Asn27 has been modified from that deposited based on MolProbity (79) analysis. In the bi-acetylated structure, Asn27 occupies two positions, each with partial occupancy.

Acetylated SAHH crystallizes with two monomers in the asymmetric unit and the tetramer is generated by crystallographic symmetry. This tetramer superimposes with the wild-type, unmodified tetramer with a root mean square deviation of 0.45 Å over 1712 Cα atoms (Fig. 7A). No local perturbations in the backbone positions were observed at the sites either of semisynthetic ligation or acetylations (Figs. 7 and 8), but small structural changes were clearly observed for side chains near the sites of modifications. Acetylation of Lys408 disrupts a hydrogen bond with Asp422, and both side chains adopt different conformations than when non-acetylated (Fig. 8C). Acetylation of Lys401 results in a rearrangement of a hydrogen bonding network between Lys401, Asn27, and Asp293 (Fig. 8D). In SAHH AcK401/408, the ϵ–amino group of AcK408 makes hydrogen bonds to the backbone carbonyl of Asn27. In the non-acetylated structure, a water mediates this interaction. Additionally, Arg34 adopts a different rotamer when Lys401 is modified and, in one chain of the asymmetric unit, the guanidine group of Arg34 is within hydrogen bonding distance of the carbonyl.

To explore the possibility that SAHH hydrogen bonding networks involving Asn27, Asp293, and Asp422 contribute to the catalytic defects conferred by 401 and 408 Lys acetylation, we attempted to generate three SAHH recombinant mutant proteins: N27K, D293A, and D422K. Although D422K r-SAHH did not express sufficient soluble protein for reconstitution and purification, N27K and D293A r-SAHH were obtained. Both N27K and D293A r-SAHH showed 3-fold reductions in catalytic efficiency (kcat/Km) compared with WT r-SAHH (see Table 1). This reduction in activity is similar to that associated with the individual Lys401 acetylation event, consistent with the hypothesis that disruption of the hydrogen bonding pattern by Lys acetylation perturbs catalysis.

DISCUSSION

Protein lysine acetylation is now understood to be a very abundant post-translational modification in the cell, with thousands of proteins and specific sites being recently identified using mass spectrometry (29, 43, 44). A large number of these acetylation events have been linked to metabolic enzymes inside and outside of the mitochondria. The effects of the overwhelming majority of protein acetylation modifications have not yet been explored. In many studies, the effects of these acetyl modifications have been approximated by mutagenesis substitution involving Lys → Gln (4549). Although sometimes informative, such Lys → Gln replacements can be misleading because of the structural differences between Gln and acetyl-Lys. In a small number of cases the precise contributions of specific, stoichiometric protein acetylation events have been characterized in detail with the authentic post-translational modification. Prior examples include cyclophilin (50), histone modifications (5153), p53 (54), and acetyltransferase autoacetylation (5557). By using expressed protein ligation on SAHH, we establish here, for the first time to our knowledge, the high resolution structural and functional consequences of acetylation at two independent sites in the same protein.

Although the x-ray structure electron density for the side chains of the acetylated Lys residues was not strong, changes in the electron density for the rotameric conformations of several surrounding residues in acetylated SAHH were clear. Such altered rotameric conformations indicate changing hydrogen bonding patterns in acetylated SAHH. We propose that the reduction in hydrolase activity in acetylated SAHH may be mediated by propagation of these altered hydrogen bond networks to the dynamics of the protein-NAD+ interactions that in turn are transmitted to the catalytic site. A recent theoretical study of SAHH catalysis has highlighted the potential catalytic importance of Asp293 (58), involved in the network of hydrogen bonds to the C terminus as shown in Fig. 8. As the Asn27–Asp293 hydrogen bond appears altered by Lys401 acetylation, it is plausible that this change in interaction may result in reduction of hydrolase activity. In addition, the loss of the water molecule-mediated interaction of Asn27 by Lys401 acetylation may contribute to catalytic inhibition. The mutagenesis experiments involving Asn27 and Asp293 reported here confirm the contributions of these residues in catalysis.

The biological consequences of SAHH acetylation have yet to be determined. Identification of the SAHH acetyltransferase(s) and deacetylase(s) and the role of SAHH lysine acetylation potentially affecting the cellular stability and/or protein-protein interactions of SAHH are important topics for future research. However, we are intrigued by the possibility that increased acetylation of SAHH could lead to a global decline in SAM-mediated methyl transfer reactions in the cell. The product of methyltransferase reactions, AdoHcy, is a general competitive inhibitor of AdoMet binding to the active sites of these enzymes (2, 18, 25, 5963). A crippling of SAHH by acetylation, as identified in our enzymatic data, could lead to a build-up of AdoHcy that in turn would impede most cellular methyltransferases. In this way, SAHH regulation could serve as a key node that facilitates the known connection between increased cellular acetyl-CoA concentrations that are associated with a reduction in histone lysine methylation (6466). Although the competitive dynamic between lysine acetylation and lysine methylation is a recognized concept (6466), the potential of the catalytically impaired acetylated SAHH serving as a contributing factor to reduced protein lysine methylation should now be considered. Although the 3–5-fold enzymologic effects of post-translational modification of SAHH are moderate, similar sized effects on other enzymes have been associated with biological consequences (6769). Future cellular experiments will be needed to investigate the specific role of SAHH acetylation in contributing to this acetylation/methylation dynamic.

This study also highlights the utility of expressed protein ligation in the study of protein acetylation. Unnatural amino acid mutagenesis by nonsense suppression strategies (30, 70), Cys derivatization (31, 32, 71), enzyme-catalyzed acetylation (5658, 7274), and sortase-mediated semisynthesis (75) are viable strategies for site-specific introduction of acetyl-Lys or close mimics into proteins. Expressed protein ligation is especially attractive, however, when these modifications occur near the C terminus of proteins of interest (42, 55, 6769, 7678). This is particularly relevant when multiple acetylation sites are clustered as is the case with SAHH.

*

This work was supported, in whole or in part, by the National Institutes of Health and the Flight Attendant Medical Research Institute Foundation.

The atomic coordinates and structure factors (codes 4PFJ and 4PGF) have been deposited in the Protein Data Bank (http://wwpdb.org/).

2
The abbreviations used are:
SAHH
S-adenosylhomocysteine hydrolase
Fmoc
N-(9-fluorenyl)methoxycarbonyl
s-SAHH
semisynthetic SAHH
r-SAHH
recombinant SAHH
AdoHcy
S-adenosylhomocysteine
BisTris
2-[bis(2-hydroxyethyl)amino]-2-(hydroxymethyl)propane-1,3-diol
Ac
acetyl.

REFERENCES

  • 1. De La Haba G., Cantoni G. L. (1959) The enzymatic synthesis of S-adenosyl-l-homocysteine from adenosine and homocysteine. J. Biol. Chem. 234, 603–608 [PubMed] [Google Scholar]
  • 2. Clarke S., Banfield K. (2001) in Homocysteine in Health and Disease (Carmel R., Jackobsen D. W., eds) Cambridge University Press, Cambridge, United Kingdom [Google Scholar]
  • 3. Miranda T. B., Cortez C. C., Yoo C. B., Liang G., Abe M., Kelly T. K., Marquez V. E., Jones P. A. (2009) DZNep is a global histone methylation inhibitor that reactivates developmental genes not silenced by DNA methylation. Mol. Cancer Ther. 8, 1579–1588 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4. Zhou J., Bi C., Cheong L. L., Mahara S., Liu S. C., Tay K. G., Koh T. L., Yu Q., Chng W. J. (2011) The histone methyltransferase inhibitor, DZNep, up-regulates TXNIP, increases ROS production, and targets leukemia cells in AML. Blood 118, 2830–2839 [DOI] [PubMed] [Google Scholar]
  • 5. Teng Y. W., Mehedint M. G., Garrow T. A., Zeisel S. H. (2011) Deletion of betaine-homocysteine S-methyltransferase in mice perturbs choline and 1-carbon metabolism, resulting in fatty liver and hepatocellular carcinomas. J. Biol. Chem. 286, 36258–36267 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6. Barić I. (2009) Inherited disorders in the conversion of methionine to homocysteine. J. Inherit. Metab. Dis 32, 459–471 [DOI] [PubMed] [Google Scholar]
  • 7. Bjursell M. K., Blom H. J., Cayuela J. A., Engvall M. L., Lesko N., Balasubramaniam S., Brandberg G., Halldin M., Falkenberg M., Jakobs C., Smith D., Struys E., von Döbeln U., Gustafsson C. M., Lundeberg J., Wedell A. (2011) Adenosine kinase deficiency disrupts the methionine cycle and causes hypermethioninemia, encephalopathy, and abnormal liver function. Am. J. Hum. Genet. 89, 507–515 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8. Dayal S., Bottiglieri T., Arning E., Maeda N., Malinow M. R., Sigmund C. D., Heistad D. D., Faraci F. M., Lentz S. R. (2001) Endothelial dysfunction and elevation of S-adenosylhomocysteine in cystathionine β-synthase-deficient mice. Circ. Res. 88, 1203–1209 [DOI] [PubMed] [Google Scholar]
  • 9. Loehrer F. M., Tschöpl M., Angst C. P., Litynski P., Jäger K., Fowler B., Haefeli W. E. (2001) Disturbed ratio of erythrocyte and plasma S-adenosylmethionine/S-adenosylhomocysteine in peripheral arterial occlusive disease. Atherosclerosis 154, 147–154 [DOI] [PubMed] [Google Scholar]
  • 10. Herrmann W., Schorr H., Obeid R., Makowski J., Fowler B., Kuhlmann M. K. (2005) Disturbed homocysteine and methionine cycle intermediates S-adenosylhomocysteine and S-adenosylmethionine are related to degree of renal insufficiency in type 2 diabetes. Clin. Chem. 51, 891–897 [DOI] [PubMed] [Google Scholar]
  • 11. Jabs K., Koury M. J., Dupont W. D., Wagner C. (2006) Relationship between plasma S-adenosylhomocysteine concentration and glomerular filtration rate in children. Metabolism 55, 252–257 [DOI] [PubMed] [Google Scholar]
  • 12. Poirier L. A., Brown A. T., Fink L. M., Wise C. K., Randolph C. J., Delongchamp R. R., Fonseca V. A. (2001) Blood S-adenosylmethionine concentrations and lymphocyte methylenetetrahydrofolate reductase activity in diabetes mellitus and diabetic nephropathy. Metabolism 50, 1014–1018 [DOI] [PubMed] [Google Scholar]
  • 13. Leal J. F., Ferrer I., Blanco-Aparicio C., Hernández-Losa J., Ramón Y Cajal S., Carnero A., Lleonart M. E. (2008) S-Adenosylhomocysteine hydrolase downregulation contributes to tumorigenesis. Carcinogenesis 29, 2089–2095 [DOI] [PubMed] [Google Scholar]
  • 14. Miller M. W., Duhl D. M., Winkes B. M., Arredondo-Vega F., Saxon P. J., Wolff G. L., Epstein C. J., Hershfield M. S., Barsh G. S. (1994) The mouse lethal nonagouti (a(x)) mutation deletes the S-adenosylhomocysteine hydrolase (Ahcy) gene. EMBO J. 13, 1806–1816 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15. Baric I., Fumic K., Glenn B., Cuk M., Schulze A., Finkelstein J. D., James S. J., Mejaski-Bosnjak V., Pazanin L., Pogribny I. P., Rados M., Sarnavka V., Scukanec-Spoljar M., Allen R. H., Stabler S., Uzelac L., Vugrek O., Wagner C., Zeisel S., Mudd S. H. (2004) S-Adenosylhomocysteine hydrolase deficiency in a human: a genetic disorder of methionine metabolism. Proc. Natl. Acad. Sci. U.S.A. 101, 4234–4239 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16. Barić I., Cuk M., Fumić K., Vugrek O., Allen R. H., Glenn B., Maradin M., Pazanin L., Pogribny I., Rados M., Sarnavka V., Schulze A., Stabler S., Wagner C., Zeisel S. H., Mudd S. H. (2005) S-Adenosylhomocysteine hydrolase deficiency: a second patient, the younger brother of the index patient, and outcomes during therapy. J. Inherit. Metab. Dis. 28, 885–902 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17. Buist N. R., Glenn B., Vugrek O., Wagner C., Stabler S., Allen R. H., Pogribny I., Schulze A., Zeisel S. H., Barić I., Mudd S. H. (2006) S-Adenosylhomocysteine hydrolase deficiency in a 26-year-old man. J. Inherit. Metab. Dis. 29, 538–545 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 18. Turner M. A., Yang X., Yin D., Kuczera K., Borchardt R. T., Howell P. L. (2000) Structure and function of S-adenosylhomocysteine hydrolase. Cell. Biochem. Biophys. 33, 101–125 [DOI] [PubMed] [Google Scholar]
  • 19. Lee K. M., Choi W. J., Lee Y., Lee H. J., Zhao L. X., Lee H. W., Park J. G., Kim H. O., Hwang K. Y., Heo Y. S., Choi S., Jeong L. S. (2011) X-ray crystal structure and binding mode analysis of human S-adenosylhomocysteine hydrolase complexed with novel mechanism-based inhibitors, haloneplanocin A analogues. J. Med. Chem. 54, 930–938 [DOI] [PubMed] [Google Scholar]
  • 20. Cai S., Fang J., Li Q. S., Borchardt R. T., Kuczera K., Middaugh C. R., Schowen R. L. (2010) Comparative kinetics of cofactor association and dissociation for the human and trypanosomal S-adenosylhomocysteine hydrolases: 3. role of lysyl and tyrosyl residues of the C-terminal extension. Biochemistry 49, 8434–8441 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 21. Turner M. A., Yuan C. S., Borchardt R. T., Hershfield M. S., Smith G. D., Howell P. L. (1998) Structure determination of selenomethionyl S-adenosylhomocysteine hydrolase using data at a single wavelength. Nat. Struct. Biol. 5, 369–376 [DOI] [PubMed] [Google Scholar]
  • 22. Ault-Riché D. B., Yuan C. S., Borchardt R. T. (1994) A single mutation at lysine 426 of human placental S-adenosylhomocysteine hydrolase inactivates the enzyme. J. Biol. Chem. 269, 31472–31478 [PubMed] [Google Scholar]
  • 23. Hoffman D. R., Marion D. W., Cornatzer W. E., Duerre J. A. (1980) S-Adenosylmethionine and S-adenosylhomocystein metabolism in isolated rat liver: effects of l-methionine, l-homocysteine, and adenosine. J. Biol. Chem. 255, 10822–10827 [PubMed] [Google Scholar]
  • 24. Palmer J. L., Abeles R. H. (1979) The mechanism of action of S-adenosylhomocysteinase. J. Biol. Chem. 254, 1217–1226 [PubMed] [Google Scholar]
  • 25. Liu S., Wolfe M. S., Borchardt R. T. (1992) Rational approaches to the design of antiviral agents based on S-adenosyl-l-homocysteine hydrolase as a molecular target. Antiviral Res. 19, 247–265 [DOI] [PubMed] [Google Scholar]
  • 26. De Clercq E. (2002) Strategies in the design of antiviral drugs. Nat. Rev. Drug Discov 1, 13–25 [DOI] [PubMed] [Google Scholar]
  • 27. Bitonti A. J., Baumann R. J., Jarvi E. T., McCarthy J. R., McCann P. P. (1990) Antimalarial activity of a 4′,5′-unsaturated 5′-fluoroadenosine mechanism-based inhibitor of S-adenosyl-l-homocysteine hydrolase. Biochem. Pharmacol. 40, 601–606 [DOI] [PubMed] [Google Scholar]
  • 28. Wolos J. A., Frondorf K. A., Esser R. E. (1993) Immunosuppression mediated by an inhibitor of S-adenosyl-l-homocysteine hydrolase. Prevention and treatment of collagen-induced arthritis. J. Immunol. 151, 526–534 [PubMed] [Google Scholar]
  • 29. Choudhary C., Kumar C., Gnad F., Nielsen M. L., Rehman M., Walther T. C., Olsen J. V., Mann M. (2009) Lysine acetylation targets cellular complexes and co-regulates major cellular functions. Science 325, 834–840 [DOI] [PubMed] [Google Scholar]
  • 30. Neumann H., Peak-Chew S.Y., Chin J.W. (2008) Genetically encoding Nϵ-acetyl-lysine in recombinant proteins. Nat. Chem. Biol. 4, 232–234 [DOI] [PubMed] [Google Scholar]
  • 31. Huang R., Holbert M. A., Tarrant M. K., Curtet S., Colquhoun D. R., Dancy B. M., Dancy B. C., Hwang Y., Tang Y., Meeth K., Marmorstein R., Cole R. N., Khochbin S., Cole P. A. (2010) Site-specific introduction of an acetyl-lysine mimic into peptides and proteins by cysteine alkylation. J. Am. Chem. Soc. 132, 9986–9987 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32. Li F., Allahverdi A., Yang R., Lua G. B., Zhang X., Cao Y., Korolev N., Nordenskiöld L., Liu C. F. (2011) A direct method for site-specific protein acetylation. Angew. Chem. Int. Ed. Engl. 50, 9611–9614 [DOI] [PubMed] [Google Scholar]
  • 33. Cai S., Li Q. S., Borchardt R. T., Kuczera K., Schowen R. L. (2007) The antiviral drug ribavirin is a selective inhibitor of S-adenosyl-l-homocysteine hydrolase from Trypanosoma cruzi. Bioorg. Med. Chem. 15, 7281–7287 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34. Yuan C. S., Ault-Riché D. B., Borchardt R. T. (1996) Chemical modification and site-directed mutagenesis of cysteine residues in human placental S-adenosylhomocysteine hydrolase. J. Biol. Chem. 271, 28009–28016 [DOI] [PubMed] [Google Scholar]
  • 35. Ellman G. L. (1959) Tissue sulfhydryl groups. Arch. Biochem. Biophys. 82, 70–77 [DOI] [PubMed] [Google Scholar]
  • 36. Yuan C. S., Yeh J., Liu S., Borchardt R. T. (1993) Mechanism of inactivation of S-adenosylhomocysteine hydrolase by (Z)-4′,5′-didehydro-5′-deoxy-5′-fluoroadenosine. J. Biol. Chem. 268, 17030–17037 [PubMed] [Google Scholar]
  • 37. Otwinowski Z., Minor W. (1997) Processing of x-ray diffraction data collected in oscillation mode. Methods Enzymol. 276, 307–326 [DOI] [PubMed] [Google Scholar]
  • 38. McCoy A. J., Grosse-Kunstleve R. W., Adams P. D., Winn M. D., Storoni L. C., Read R. J. (2007) Phaser crystallographic software. J. Appl. Crystallogr. 40, 658–674 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 39. Yang X., Hu Y., Yin D. H., Turner M.A., Wang M., Borchardt R.T., Howell P.L., Kuczera K., Schowen R.L. (2003) Catalytic strategy of S-adenosyl-l-homocysteine hydrolase: transition-state stabilization and the avoidance of abortive reactions. Biochemistry 42, 1900–1909 [DOI] [PubMed] [Google Scholar]
  • 40. Emsley P., Cowtan K. (2004) Coot: model building tools for molecular graphics. Acta Crystallogr. D Biol. Crystallogr. 60, 2126–2132 [DOI] [PubMed] [Google Scholar]
  • 41. Adams P. D., Afonine P.V., Bunkóczi G., Chen V. B., Davis I. W., Echols N., Headd J. J., Hung L. W., Kapral G. J., Grosse-Kunstleve R. W., McCoy A. J., Moriarty N. W., Oeffner R., Read R. J., Richardson D. C., Richardson J. S., Terwilliger T. C., Zwart P. H. (2010) Phenix: a comprehensive Python-based system for macromolecular structure solution. Acta Crystallogr. D Biol. Crystallogr. 66, 213–221 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 42. Muir T. W., Sondhi D., Cole P. A. (1998) Expressed protein ligation: a general method for protein engineering. Proc. Natl. Acad. Sci. U.S.A. 95, 6705–6710 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43. Chen Y., Zhao W., Yang J. S., Cheng Z., Luo H., Lu Z., Tan M., Gu W., Zhao Y. (2012) Quantitative acetylome analysis reveals the role of Sirt1 in regulating diverse substrates and cellular pathways. Mol. Cell. Proteomics 11, 1048–1062 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 44. Still A. J., Floyd B. J., Hebert A. S., Bingman C. A., Carson J. J., Gunderson D. R., Dolan B. K., Grimsrud P. A., Dittenhafer-Reed K. E., Stapleton D. S., Keller M. P., Westphall M. S., Denu J. M., Attie A. D., Coon J. J., Pagliarini D. J. (2013) Quantification of mitochondrial acetylation dynamics highlights prominent sites of metabolic regulation. J. Biol. Chem. 288, 26209–26219 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 45. Zheng H., Yang L., Peng L., Izumi V., Koomen J., Seto E., Chen J. (2013) hMOF acetylation of DBC1/CCAR2 prevents binding and inhibition of SirT1. Mol. Cell. Biol. 33, 4960–4970 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 46. Dai J., Hyland E. M., Yuan D. S., Huang H., Bader J. S., Boeke J. D. (2008) Probing nucleosome function: a highly versatile of synthetic H3 and H4 mutants. Cell 134, 1066–1078 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47. Nakanishi S., Sanderson B. W., Delventhal K. M., Bradford W. D., Staehling-Hampton K., Shilatifard A. (2008) A comprehensive library of histone mutants identifies nucleosomal residues required for H3K4 methylation. Nat. Struct. Mol. Biol. 15, 881–888 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48. Yu W., Dittenhafer-Reed K. E., Denu J. M. (2012) SIRT3 protein deacetylates isocitrate dehydrogenase 2 (IDH2) and regulates mitochondrial redox status. J. Biol. Chem. 287, 14078–14086 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 49. Yang X. J., Seto E. (2008) Lysine acetylation: codified crosstalk with other post-translational modifications. Mol. Cell 31, 449–461 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50. Lammers M., Neumann H., Chin J. W., James L. C. (2010) Acetylation regulates cyclophilin A catalysis, immunosuppression and HIV isomerization. Nat. Chem. Biol. 6, 331–337 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 51. Shogren-Knaak M., Ishii H., Sun J. M., Pazin M. J., Davie J. R., Peterson C. L. (2006) Histone H4-K16 acetylation controls chromatin structure and protein interactions. Science 311, 844–847 [DOI] [PubMed] [Google Scholar]
  • 52. Neumann H., Hancock S. M., Buning R., Routh A., Chapman L., Somers J., Owen-Hughes T., van Noort J., Rhodes D., Chin J. W. (2009) A method for genetically installing site-specific acetylation in recombinant histones defines the effects of H3 K56 acetylation. Mol. Cell 36, 153–163 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 53. Di Cerbo V., Mohn F., Ryan D. P., Montellier E., Kacem S., Tropberger P., Kallis E., Holzner M., Hoerner L., Feldmann A., Richter F. M., Bannister A. J., Mittler G., Michaelis J., Khochbin S., Feil R., Schuebeler D., Owen-Hughes T., Daujat S., Schneider R. (2014) Acetylation of histone H3 at lysine 64 regulates nucleosome dynamics and facilitates transcription. eLife 3, e01632. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 54. Arbely E., Natan E., Brandt T., Allen M. D., Veprintsev D. B., Robinson C. V., Chin J. W., Joerger A. C., Fersht A. R. (2011) Acetylation of lysine 120 of p53 endows DNA-binding specificity at effective physiological salt concentration. Proc. Natl. Acad. Sci. U.S.A. 108, 8251–8256 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 55. Karukurichi K. R., Wang L., Uzasci L., Manlandro C. M., Wang Q., Cole P. A. (2010) Analysis of p300/CBP histone acetyltransferase regulation using circular permutation and semisynthesis. J. Am. Chem. Soc. 132, 1222–1223 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 56. Albaugh B. N., Arnold K. M., Lee S., Denu J. M. (2011) Autoacetylation of the histone acetyltransferase Rtt109. J. Biol. Chem. 286, 24694–24701 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 57. Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding E. C., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng Y. G., Speicher D. W., Thibault P., Verreault A., Johnson F. B., Berger S. L., Sternglanz R., McMahon S. B., Côté J., Marmorstein R. (2012) MYST protein acetyltransferase activity requires active site lysine autoacetylation. EMBO J. 31, 58–70 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 58. Lee Y., Jeong L. S., Choi S., Hyeon C. (2011) Link between allosteric signal transduction and functional dynamics in a multisubunit enzyme: S-adenosylhomocysteine hydrolase. J. Am. Chem. Soc. 133, 19807–19815 [DOI] [PubMed] [Google Scholar]
  • 59. Chiang P. K., Cantoni G. L. (1979) Perturbation of biochemical transmethylations by 3-deazaadenosine in vivo. Biochem. Pharmacol. 28, 1897–1902 [DOI] [PubMed] [Google Scholar]
  • 60. Galloway S. E., Wertz G. W. (2008) S-Adenosylhomocysteine-induced hyperpolyadenylation of vesicular stomatitis virus mRNA requires the methyltransferase activity of L protein. J. Virol. 82, 12280–12290 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 61. Malanovic N., Streith I., Wolinski H., Rechberger G., Kohlwein S. D., Tehlivets O. (2008) S-Adenosyl-l-homocysteine hydrolase, key enzyme of methylation metabolism, regulates phosphatidylcholine synthesis and triacylglycerol homeostasis in yeast: implications for homocysteine as a risk factor of atherosclerosis. J. Biol. Chem. 283, 23989–23999 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 62. Perna A. F., Ingrosso D., Violetti E., Luciano M. G., Sepe I., Lanza D., Capasso R., Ascione E., Raiola I., Lombardi C., Stenvinkel P., Massy Z., De Santo N. G. (2009) Hyperhomocysteinemia in uremia: a red flag in a disrupted circuit. Semin. Dial. 22, 351–356 [DOI] [PubMed] [Google Scholar]
  • 63. Tehlivets O., Hasslacher M., Kohlwein S. D. (2004) S-Adenosyl-l-homocysteine hydrolase in yeast: key enzyme of methylation metabolism and coordinated regulation with phospholipid synthesis. FEBS Lett. 577, 501–506 [DOI] [PubMed] [Google Scholar]
  • 64. Katada S., Imhof A., Sassone-Corsi P. (2012) Connecting threads: epigenetics and metabolism. Cell 148, 24–28 [DOI] [PubMed] [Google Scholar]
  • 65. Nicolas E., Roumillac C., Trouche D. (2003) Balance between acetylation and methylation of histone H3 lysine 9 on the E2F-responsive dihydrofolate reductase promoter. Mol. Cell. Biol. 23, 1614–1622 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 66. Evertts A. G., Zee B. M., Dimaggio P. A., Gonzales-Cope M., Coller H. A., Garcia B. A. (2013) Quantitative dynamics of the link between cellular metabolism and histone acetylation. J. Biol. Chem. 288, 12142–12151 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 67. Flavell R. R., Muir T. W. (2009) Expressed protein ligation (EPL) in the study of signal transduction, ion conduction, and chromatin biology. Acc. Chem. Res. 42, 107–116 [DOI] [PubMed] [Google Scholar]
  • 68. Bolduc D., Rahdar M., Tu-Sekine B., Sivakumaren S. C., Raben D., Amzel L. M., Devreotes P., Gabelli S. B., Cole P. (2013) Phosphorylation-mediated PTEN conformational closure and deactivation revealed with protein semisynthesis. Elife 2, e00691. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 69. Thompson P. R., Wang D., Wang L., Fulco M., Pediconi N., Zhang D., An W., Ge Q., Roeder R. G., Wong J., Levrero M., Sartorelli V., Cotter R. J., Cole P. A. (2004) Regulation of p300 HAT domain via a novel activation loop. Nat. Struct. Mol. Biol. 11, 308–315 [DOI] [PubMed] [Google Scholar]
  • 70. Huang Y., Russell W. K., Wan W., Pai P.-J., Russell D. H., Liu W. (2010) A convenient method for genetic incorporation of multiple noncanonical amino acids into one protein in Escherichia coli. Mol. Biosyst. 6, 683–686 [DOI] [PubMed] [Google Scholar]
  • 71. Chalker J. M., Lercher L., Rose N. R., Schofield C. J., Davis B. G. (2012) Conversion of cysteine into dehydroalanine enables access to synthetic histones bearing diverse post-translational modifications. Angew. Chem. Int. Ed. Engl. 51, 1835–1839 [DOI] [PubMed] [Google Scholar]
  • 72. Saeed M., Schwarze F., Loidl A., Meraner J., Lechner M., Loidl P. (2012) In vitro phosphorylation and acetylation of the murine pocket protein Rb2/p130. PLoS One 7, e46174. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 73. Han J., Zhou H., Li Z., Xu R. M., Zhang Z. (2007) Acetylation of lysine 56 of histone H3 catalyzed by RTT109 and regulated by ASF1 is required for replisome integrity. J. Biol. Chem. 282, 28587–28596 [DOI] [PubMed] [Google Scholar]
  • 74. Tsubota T., Berndsen C. E., Erkmann J. A., Smith C. L., Yang L., Freitas M. A., Denu J. M., Kaufman P. D. (2007) Histone H3-K56 acetylation is catalyzed by histone chaperone-dependent complexes. Mol. Cell 25, 703–712 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 75. Piotukh K., Geltinger B., Heinrich N., Gerth F., Beyermann M., Freund C., Schwarzer D. (2011) Directed evolution of sortase A mutants with altered substrate selectivity profiles. J. Am. Chem. Soc. 133, 17536–17539 [DOI] [PubMed] [Google Scholar]
  • 76. Dhall A., Chatterjee C. (2011) Chemical approaches to understand the language of histone modifications. ACS Chem. Biol. 6, 987–999 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 77. Tarrant M. K., Rho H. S., Xie Z., Jiang Y. L., Gross C., Culhane J. C., Yan G., Qian J., Ichikawa Y., Matsuoka T., Zachara N., Etzkorn F. A., Hart G. W., Jeong J. S., Blackshaw S., Zhu H., Cole P. A. (2012) Regulation of CK2 by phosphorylation and O-GlcNAcylation revealed by semisynthesis. Nat. Chem. Biol. 8, 262–269 [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 78. Liu X., Wang L., Zhao K., Thompson P. R., Hwang Y., Marmorstein R., Cole P. A. (2008) The structural basis of protein acetylation by the p300/CBP transcriptional coactivator. Nature 451, 846–850 [DOI] [PubMed] [Google Scholar]
  • 79. Chen V. B., Arendall W. B., 3rd, Headd J. J., Keedy D. A., Immormino R. M., Kapral G. J., Murray L. W., Richardson J. S., Richardson D. C. (2010) Molprobity: all-atom structure validation for macromolecular crystallography. Acta Crystallogr. D Biol. Crystallogr. 66, 12–21 [DOI] [PMC free article] [PubMed] [Google Scholar]

Articles from The Journal of Biological Chemistry are provided here courtesy of American Society for Biochemistry and Molecular Biology

RESOURCES