Host Defence Peptide LL-37 Induces IL-6 Expression in Human Bronchial Epithelial Cells by Activation of the NF-κB Signaling Pathway

Abstract

LL-37, the only member of the cathelicidin family of cationic host defence peptides in humans, has been shown to mediate multiple immunomodulatory effects and as such is thought to be an important component of innate immune responses. A growing body of evidence indicates that LL-37 affects lung mucosal responses to pathogens through altered regulation of cell migration, proliferation, wound healing and cell apoptosis. These functions are consistent with LL-37 playing a role in regulating lung epithelial inflammatory responses; however, that role has not been clearly defined. In this report we have demonstrated that host defence peptide LL-37 induced cytokine (IL-6) and chemokine (CXCL-1/GRO-α and CXCL-8/IL-8) release from human bronchial epithelial cells. It was demonstrated that LL-37-mediated IL-6 release was time and dose dependent and that LL-37 up-regulated this pleiotropic cytokine at the transcriptional level. Using specific inhibitors it was shown that NF-κB signaling led to the LL-37-stimulated production of IL-6. LL-37 stimulation of airway epithelial cells activated NF-κB signaling, as demonstrated by the phosphorylation and degradation of Iκ-Bα, and consequent nuclear translocation of p65 and p50 NF-κB subunits. Furthermore this host defence peptide augmented flagellin-mediated cytokine production, indicating that LL-37 likely modulates Toll-like receptor 5-mediated responses.

Introduction

Cationic host defence peptides, including cathelicidins, are a widely expressed peptide group characterized by a multitude of functions including anti-cancer, antimicrobial, wound healing and innate immunity-modulating activities [1, 2, 3, 4]. The sole human cathelicidin, LL-37, is expressed in a variety of cell types and tissues in the human body. It is abundant in neutrophils and has been shown to be expressed in macrophages, monocytic cells, B cells, subsets of T cells, skin mast cells, as well as numerous epithelial sites under homeostatic and inflammatory conditions [5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15]. In the lung, expression of LL-37 has been demonstrated in respiratory epithelial cells of proximal and distal airways, as well as the cells of submucosal glands [9, 10, 16]. Several studies have reported an increase of LL-37 in bronchio-alveolar lavage fluid from patients suffering from a number of pathological lung conditions such as cystic fibrosis, sarcoidosis and chronic obstructive pulmonary disease (COPD) [9, 10, 16, 17], as well as in infants with infections [18]. The widespread distribution of this peptide and its induction during inflammation indicates that it plays a highly relevant role in lung immune defence mechanisms, although this role is not yet fully understood.

As various in vitro and in vivo studies show, LL-37 is a potent inducer of numerous immunomodulatory activities. It can mediate chemotaxis of a variety of cell types [19, 20, 21], modulate apoptosis in neutrophils and epithelial cells [22, 23, 24], affect mast cell function [25, 26], modulate endotoxin signaling and responses [22, 27, 28, 29], promote wound healing, angiogenesis and vasodilation [30, 31, 32, 33, 34, 35, 36], influence dendritic cell (DC) activation and function [37, 38] and induce chemokine/cytokine production in many cell types [30, 39, 40, 41, 42, 43, 44, 45].

In the lung, overexpression studies associate a prominent increase in peptide concentration during inflammation with improved clearance of pulmonary pathogens, which is consistent with the hypothesis that LL-37 is a significant effector molecule of lung immune responses [46, 47]. In in vitro studies, LL-37 has been shown to induce IL-8 production from bronchial epithelial cells in a dose- and time-dependent manner and to promote mitogen-activated protein kinase (MAPK) activation (ERK-1/2, p38, JNK) [39, 41, 48]. Furthermore, LL-37 is able to induce proliferation, migration and wound healing in bronchial epithelial cells in a serum-dependent manner at relatively low concentrations [31].

LL-37 engages intricate mechanisms of action and signaling regulation to exert a wide range of functions in a variety of cell types. To date, three receptors have been proposed to mediate the effects of LL-37 on various cells, namely epidermal growth factor receptor (EGFR), a G-protein-coupled formyl peptide receptor-like-1 (FPRL-1) and a purinergic P2X₇ receptor [21, 41, 49]. The role of EGFR in peptide-mediated lung mucosal responses was shown to be particularly relevant in the regulation of ERK-1/2 activation and IL-8 production [41], as well as wound closure and proliferation in lung epithelial cells [30, 31]. Various signaling pathways have been demonstrated to be activated and regulated by LL-37 in leucocytes. These include the phosphoinositide 3-kinases (PI3K), MAPK, protein kinase C and NF-κB pathways in the regulation of angiogenesis [34], MAPK pathways in the induction of chemokines [39], Toll-like receptor (TLR) 4 to NF-κB signaling in the modification of endotoxin responses [27], NF-κB and PI3K/cAMP-responsive element binding protein (CREB) signaling in synergistic induction of cytokines/chemokines [42] and PI3K pathways in the regulation of neutrophil apoptosis inhibition [22, 24]. However, our knowledge of LL-37-modulated signaling pathway regulation in airway epithelia is somewhat limited.

In this study we have investigated effects of host defence peptide LL-37 on human airway epithelial cells. We observed LL-37-stimulated cytokine and chemokine release from human airway epithelial cells. In particular, LL-37-mediated transcription and secretion of IL-6 was dose and time dependent. Furthermore, we demonstrated that LL-37 activated the NF-κB signaling pathway, through evaluation of Iκ-Bα phosphorylation/degradation and NF-κB p50/p65 nuclear subunit translocation. This NF-κB signaling activation was shown to regulate IL-6 release from airway epithelial cells. In addition, simultaneous airway epithelial cell stimulation with LL-37 and flagellin induced augmented cytokine/chemokine signatures, indicating that this host defence peptide can modulate TLR5 signaling responses in these cells. This demonstrated that the interaction of LL-37 and NF-κB signaling mediates epithelial cell immune responses.

Materials and Methods

Cell Culture

The SV40-transformed, immortalized human bronchial epithelial (HBE) cell line 16HBE14o^– was a gift from Dr. D. Gruenert (University of California, San Francisco, Calif., USA) [50]. 16HBE14o^– cells were cultured in minimum essential medium (MEM) with Earle's salts (Life Technologies Invitrogen), supplemented with 10% heat-inactivated fetal bovine serum (FBS; Life Technologies Invitrogen) and 2 mM L-glutamine (Life Technologies Invitrogen). 16HBE14o^– cells were routinely cultured to 85–90% confluence in 100% humidity and 5% CO₂ at 37°C and were used between passages 5 and 15.

Clonetics primary normal HBE (NHBE) cells were purchased from Cambrex BioScience (Walkersville, Md., USA) and cultured and maintained in bronchial epithelial growth medium (BEGM; Cambrex BioScience), according to the manufacturer's instructions. BEGM is a basal medium (Cambrex BioScience) supplemented with bronchial epithelial cell SingleQuots growth factors and supplements (Cambrex BioScience), and is used as a serum substitute optimized for growth and appropriate differentiation of these primary cells. SingleQuots includes human EGF, triiodothyronine, bovine pituitary extract, epinephrine, transferrin, insulin, hydrocortisone, gentamicin/amphotericin and retinoic acid. In accordance with the manufacturer's instructions, cells were cultured in complete BEGM to 85–90% confluence in 100% humidity and 5% CO₂ at 37°C, and were used between passages 3 and 10.

Peptides, Inhibitors, Antibodies and Other Reagents

LL-37 (sequence [LL-37, 37 aa]) was synthesized by N-(9-fluorenyl)methoxy carbonyl (F-moc) chemistry at the Nucleic Acid/Protein Synthesis Unit at the University of British Columbia. Human recombinant interleukin-1β (IL-1β) was purchased from Research Diagnostics (Flanders, N.J., USA). The NF-κB inhibitor parthenolide, EGFR inhibitor AG1478, MEK inhibitor PD98059, p38 inhibitor SB203580, JNK inhibitor SP600125, PI3K inhibitor LY294002 and G-protein-coupled receptor inhibitor pertussis toxin (PTX) were purchased from Calbiochem (San Diego, Calif., USA). The NF-κB inhibitor Bay 11-7085 was purchased from Biomol International (Plymouth Meeting, Pa., USA). The DeadEnd Fluorometric TUNEL System was purchased from Promega (Madison, Wisc., USA). Mouse monoclonal antibody anti-phospho-Iκ-Bα and anti-GAPDH, rabbit anti-total-Iκ-Bα, anti-p50, anti-p65 and HRP-conjugated goat anti-rabbit antibodies were purchased from Cell Signaling Technology (Danvers, Mass., USA). The anti-mouse IgG antibody was purchased from Amersham (Piscataway, N.J., USA), while the mouse anti-H2AX histone antibody was purchased from R&D Systems (Minneapolis, Minn., USA). Lipopolysaccharide (LPS) from Pseudomonas aeruginosa PA01strain H103 was purified free of proteins and lipids using the Darveau-Hancock method as described previously [51]. Salmonella typhimurium flagellin was purchased from Cedarlane Laboratories (Burlington, Ont., Canada).

Detection of Cytokines and Chemokines

16HBE14o^– cells were seeded in 24-well plates (Sarstedt, Montreal, Qué., Canada) in 10% FBS/2 mM L-glutamine MEM at a concentration of 1.5 × 10⁵ cells/ml (1 ml per well), and cultured at 37°C and 5% CO₂ for 2 days to achieve confluence. Unless otherwise indicated, cells were treated in MEM supplemented with 2% FBS and 2 mM L-glutamine. When confluent, cells were washed with 1 ml per well of serum-free MEM, and then 1 ml of 2% FBS/2 mM L-glutamine MEM was added to each well. If chemical inhibitors were used, they were first dissolved in 2% FBS MEM, and then added to the cells after the washing step. Cells were rested for 1 h, and were subsequently treated with peptide or other stimuli. After the desired incubation time, supernatants were collected and stored at −20°C in aliquots.

Primary NHBE cells were seeded at 5 × 10⁴ cells/ml (1 ml per well) in 24-well plates (Sarstedt) in complete BEGM, and were cultured at 37°C and 5% CO₂. When confluent, cells were washed with 1 ml per well of Hepes-buffered salt solution (Cambrex BioScience), and then 1 ml of complete BEGM (without EGF) was added to each well. Cells were rested for 1 h and were subsequently treated with the peptide or other stimuli. After the desired incubation time, supernatants were collected and stored at −20°C in aliquots.

The concentrations of IL-8, IL-6, GRO-α, RANTES, TNF-α, IL-1β, IP-10, MIP-1α and IL-10 in cell culture supernatants were measured using an enzyme-linked immunosorbent assay (ELISA) as per the manufacturer's suggestion (GRO-α, IP-10 and RANTES ELISA from R&D; TNF-α, IL-1β, IL-10 and IL-6 ELISA from eBioscience, San Diego, Calif., USA, and IL-8 and MIP-1α ELISA from BioSource International, Camarillo, Calif., USA).

RNA Isolation and Real-Time PCR

16HBE14o^– cells were seeded in 15 × 30 mm plates (Sarstedt) at 2.8 × 10⁵ cells/ml, and cultured to sub-confluence at 37°C and 5% CO₂ in 10% FBS/2 mM L-glutamine MEM for 2 days. On the day of treatment, sub-confluent cells were washed with 1 ml/plate of serum-free MEM, and 1 ml of 2% FBS/2 mM L-glutamine-supplemented MEM was added. After the medium change, cells were rested for 1 h and subsequently treated with various stimuli over a time course of 1, 2 and 4 h. Total RNA was isolated using the RNeasy Mini kit (Qiagen, Gaithersburg, Md., USA), as per the manufacturer's instructions, and was DNAse treated using the RNase-free DNase kit (Qiagen). Once RNA integrity was confirmed by 1% agarose electrophoresis and spectrophotometry, 1 μg of total RNA was converted to cDNA as per the manufacturer's instructions using the SuperScript III Platinum CellsDirect Two-step qRT-PCR kit with SYBR Green (Invitrogen), with a nontemplate negative control for each of the treatments. Quantitative real-time PCR was done using the ABI Prism 7000 system, including a dissociation curve program, at 50°C for 2 min, 95°C for 2 min, then 50 cycles at 95°C for 15 s and 60°C for 30 s. GAPDH was used as the housekeeping gene control. PCR was conducted in a 12.5-μl reaction volume containing 2.5 μl of 1/10-diluted cDNA template and 10 μl of a master mix (0.25 μl of ROX, 6.25 μl of UDG, 0.5 μl of 10 μM primer mix and 3 μl of nuclease-free H₂O per reaction). A melting curve was performed to ensure that any product detected was specific to the desired amplicon. Fold changes were calculated after normalization to endogenous GAPDH using the comparative Ct method [52]. PCR primers used in this study were: IL-6 (forward) 5’-AATTCGGTACATCCTCGACGG-3’, IL-6 (reverse) 5’-GGTTGTTTTCTGCCAGTGCC-3’, GAPDH (forward) 5’-GAAACTGTGGCG TGATGG-3’ and GAPDH (reverse) 5’-TCTAGAGGCATGCTGACTTC-3’.

Western Immunoblotting

16HBE14o^– cells were seeded in 15 × 30 mm plates (Sarstedt) at 2.8 × 10⁵ cells/ml and cultured to sub-confluence in MEM (with 10% FBS/2 mM L-glutamine) at 37°C and 5% CO₂ for 2 days. On the day of treatment, medium was removed from the plates, and cells were washed with 1 ml of serum-free MEM per plate. Cells were incubated with 1 ml of serum-free MEM (containing 2 mM L-glutamine) for 4 h, followed by a medium change of 1 ml of 2% FBS/2 mM L-glutamine MEM and immediate treatment of cells. Prior to lysis, cells were washed with ice-cold PBS, containing 1 mM sodium vanadate. Samples were solubilized on ice with NP-40 lysis buffer (1% NP-40, 20 mM Tris-HCl, pH 8, 137 mM NaCl, 10% glycerol, 2 mM EDTA) supplemented with protease and phosphatase inhibitor cocktails (Sigma-Aldrich), scraped and subsequently centrifuged. The protein concentration of cell lysates was quantified using the BCA Protein Assay Kit (Pierce, Rockford, Ill., USA). Lysates were denatured at 95°C for 10 min and were resolved on 12% SDS-PAGE, followed by subsequent transfer at 100 V for 1 h to immunoblot PVDF membranes (Bio-Rad, Hercules, Calif., USA).

Membranes were probed with specific antibodies in TBST (20 mM Tris, pH 7.4, 150 mM NaCl and 0.1% Tween-20) containing 5% skimmed milk powder (TBST/milk) or 5% BSA (TBST/BSA), at dilutions and incubation times specified by the manufacturer. Incubation with an appropriate secondary antibody (HRP-conjugated goat anti-mouse or anti-rabbit antibody) was performed following the primary antibody incubation. Finally, the membranes were developed using the ECL chemiluminescence peroxidase substrate (Sigma-Aldrich), according to the manufacturer's instructions.

Nuclear Protein Isolation

For nuclear extraction experiments, 16HBE14o^– cells were seeded, cultured and treated as described above. After appropriate incubation, cells were rinsed with PBS and incubated with 0.5 ml Versene (Life Technologies Invitrogen) per plate for 5–10 min at 37°C to promote cell detachment from the plate. Cells were centrifuged at 3,000 g for 3 min at 4°C and were subsequently washed with ice-cold PBS and re-centrifuged. Nuclear and cytoplasmic extracts were isolated using the NE-PER Nuclear and Cytoplasmic Extraction Reagents Kit (Pierce) according to the manufacturer's instructions. The extracts were stored in aliquots at −80°C until further use. Protein concentrations of the samples were determined by the BCA assay (Pierce). Nuclear extracts (15 μg) were denatured for 5 min at 95°C, resolved by 7.5% SDS-PAGE and transferred at 100 V for 1 h to Immunoblot PVDF membranes (Bio-Rad).

TUNEL Assay

16HBE14o^– cells were seeded in 8-Chamber Slide Culture Chambers (VWR International, Mississauga, Ont., USA) at 2 × 10⁴ cells/chamber in 10% FBS/2 mM L-glutamine MEM and were cultured for 2 days. On the day of the assay, complete media were replaced with 2% FBS media and cells were rested for 1 h. Cells were treated with 30 or 50 μg/ml of LL-37, hydrogen peroxide at 300 μM or left untreated for 6 h. After treatment incubations, cells were stained and processed using the DeadEnd Fluorometric TUNEL System (Promega), according to manufacturer's instructions (adherent cell instructions). Coverslips were mounted onto slides using Vectashield containing DAPI (Vector Laboratories) and viewed using a Nikon Eclipse TE2000-S fluorescence microscope.

Statistical Analysis

Student's t test was performed to determine the statistical significance of results, with p ≤ 0.05 being considered statistically significant, with the exception of figure 4c, where ANOVA was done (GraphPad Prism 4). Values shown are expressed as means ± SD as indicated in the Results section and figure legends.

Fig. 4.

LL-37-induced IL-6 release in 16HBE14o^– cells is robustly regulated by NF-κB signaling. Confluent 16HBE14o^– monolayers were treated with Bay 11-7085 (Iκ-Bα phosphorylation inhibitor) at 10 μM (a), or parthenolide (NF-κB inhibitor) at 10 μM for 1 h (b), prior to stimulation with LL-37 at 30 and 50 μg/ml, or IL-1β at 10 ng/ml for 6 h. c Confluent 16HBE14o^– monolayers were pretreated with AG1478 1 μM (EGFR inhibitor), PD98059 12.5 μM (MEK/ERK inhibitor), SB203580 12.5 μM (p38 inhibitor), SP600125 5 μM (JNK inhibitor) or pertussis toxin (PTX) 100 ng/ml for 1 h prior to stimulation with 30 μg/ml LL-37 for 6 h. Supernatants were assayed for IL-6 release by ELISA. Results are expressed as averages ± SEM of three independent experiments (* p < 0.05 vs. the respective treatment without the inhibitor). c ANOVA (* p < 0.05 vs. the respective treatment without the inhibitor).

Results

LL-37-Stimulated Release of IL-6, GRO-α and IL-8 from Bronchial Epithelial Cells

Several studies have addressed the LL-37-mediated effect on cytokine/chemokine release and its regulation in leucocytes and keratinocytes [22, 30, 39, 40, 41, 42, 45]. In airway epithelial cells, however, LL-37 has been shown only to induce IL-8, via EGFR and MAPK regulation [39, 41]. Various cytokines and chemokines, including IL-8, are important effector molecules of lung innate immunity which affect inflammation, and infection development and resolution through a cornucopia of functions [2]. These small molecules act to balance and regulate infiltration of specific effector cell populations to the affected site, regulate induction of local chemical defence molecules, and govern tissue remodeling and wound healing. Therefore, we aimed to examine if LL-37 would act to induce other cytokines/chemokines in addition to IL-8 in airway epithelial cells.

To determine which cytokines and/or chemokines were induced, 16HBE14o^– cells were stimulated with LL-37 at 50 μg/ml, 100 ng/ml of LPS or 10 ng/ml of IL-1β for 6 h. Cytokines/chemokines released into the cell culture supernatants were measured by ELISA. LL-37 induced a significant amount of the cytokine IL-6 (p < 0.05), without inducing detectable IL-1β, TNF-α or IL-10 from 16HBE14o^– cells (fig. 1a). With respect to chemokine release, LL-37 significantly induced the release of CCL-5/RANTES, CXCL-8/IL-8 and CXCL-1/GRO-α, while no significant induction of CCL3/MIP-1α or CXCL-10/IP-10 was observed (fig. 1b). Similar to the 16HBE14o^– cell results, primary NHBE cells had increased IL-6, IL-8 and Gro-α protein release (p < 0.05), but without significant RANTES induction (fig. 2, and data not shown). LL-37-induced cytokine/chemokine release was a specific peptide-mediated response and not just a reflection of a general inflammatory response, e.g. due to either contaminating endotoxin or a secondary effect of autocrine stimulation with IL-1β/TNF-α, since the pattern of stimulation differed from that with these agents (fig. 1a). Similar results were observed in both primary cells and a bronchial cell line, thereby corroborating the physiological relevance of these results.

Fig. 1.

LL-37-induced cytokine (a)/chemokine (b) release from 16HBE14o^– cells. Confluent 16HBE14o^– cell monolayers were exposed for 6 h to 50 μg/ml LL-37 and 100 ng/ml LPS (a) or 50 μg/ml LL-37 and 10 ng/ml of IL-1β (b). Cytokine/chemokine release in cell culture supernatants was determined via ELISA. Results are expressed as mean values of cytokine/chemokine produced (Y scale-log scale) ± SD of three independent experiments (* p < 0.05 vs. untreated controls).

Fig. 2.

LL-37 induces IL-6 release from the 16HBE14o^– bronchial epithelial cell line and primary NHBE cells in a dose- and time-dependent manner. Confluent 16HBE14o^– monolayers were treated with LL-37 at 5, 10, 25 and 50 μg/ml concentrations, or IL-1β at 10 ng/ml for 6 h (a), or 50 μg/ml of LL-37 for 2, 4, 6, 10 and 24 h (b). Confluent primary NHBE monolayers were treated with 1, 2.5, 5, 10, 25 and 50 μg/ml of LL-37 or IL-1β for 6 h (c), or 5 and 10 μg/ml of LL-37 for 6 or 24 h (d). IL-6 release in culture supernatants was determined by ELISA. Results are expressed as means ± SD of three independent experiments (* p < 0.05 vs. untreated controls).

LL-37-Stimulated IL-6 Cytokine Release from Bronchial Epithelial Cells in a Dose- and Time-Dependent Manner

To gain further insights into the effects of LL-37 on cytokine/chemokine production, we exposed airway epithelial cells to a range of LL-37 concentrations over various time frames, and focused on the regulation of IL-6 as it appeared the most interesting due to the pleiotropic nature of this cytokine.

As shown in figure 2, LL-37 induced IL-6 release from both 16HBE14o^– cells and primary NHBE cells in a dose- and time-dependent manner. A statistically significantly enhanced IL-6 production and release was seen with as little as 2.5–10 μg/ml of LL-37 (p < 0.05; fig. 2). In 16HBE14o^– cells, a more prominent increase was observed with 25 and 50 μg/ml of the peptide with 4- and 9-fold up-regulation of IL-6 production and release, respectively (fig. 2a). In these cells, LL-37 induced IL-6 release at the earliest time point evaluated, while the peak of accumulation was observed between 6 and 10 h (fig. 2b).

Comparable results were obtained with primary NHBE cells (fig. 2c, d), demonstrating the physiological relevance of these results. Primary NHBE cells were even more sensitive to LL-37 stimulation with significant IL-6 release upon stimulation with as low as 2.5 μg/ml of LL-37 (p < 0.05; fig. 2c). As described for the 16HBE14o^– cell line, LL-37-stimulated primary cells released IL-6 in a time-dependent manner (fig. 2d), with significant accumulation of the cytokine as early as 6 h after stimulation, and continuing up until 24 h after stimulation.

To evaluate the effect of LL-37 on IL-6 regulation at the transcriptional level, 16HBE14o^– cells were treated with 50 μg/ml of LL-37 or 10 ng/ml of IL-1β over a time course of 1, 2 and 4 h. Total RNA was extracted from treated samples, and the IL-6 transcriptional profile was subsequently assessed by quantitative PCR (fig. 3). LL-37 induced the up-regulation of IL-6 gene expression in a time-dependent manner in 16HBE14o^– cells. As shown in figure 3, 50 μg/ml of LL-37 (the dose that induced maximal protein release) increased IL-6 transcription 20 ± 4.9 times within 1 h of peptide addition. This up-regulation decreased to 5.5 ± 1.4 times at 2 h (p < 0.05), and ultimately approached near control levels 4 h after stimulation (p > 0.05). A similar pattern of transcriptional up-regulation was observed with 10 ng/ml of the positive control IL-1β, which induced peak transcription at 1 h (28 ± 5.6 fold, p < 0.05) and a subsequent decrease 2 and 4 h after stimulation to 2.37 ± 1.26 and 1.98 ± 0.78 fold, respectively (p > 0.05).

Fig. 3.

LL-37 enhances IL-6 gene expression in 16HBE14o^– cells. 16HBE14o^– cells were exposed to LL-37 at 50 μg/ml, or IL-1β at 10 ng/ml for 1, 2 and 4 h. Transcriptional regulation was assessed via quantitative RT-PCR. Fold changes (y-axis) were normalized to GAPDH and are relative to the gene expression in unstimulated cells (normalized to 1) using the comparative Ct method (refer to Materials and Methods for details). Results are expressed as means ± SD of three independent experiments (* p < 0.05 vs. the respective untreated control at a given time point).

NF-κB Signaling Is a Major Regulator of LL-37-Induced IL-6 in 16HBE14o^– Cells

As shown above, LL-37-mediated induction of IL-6 in bronchial epithelial cells stemmed from transcriptional up-regulation (fig. 3). Literature indicates that IL-6 transcription is mediated via activation of transcription factors NF-κB, CREB, activator protein-1 (AP-1) and nuclear factor IL-6 (NF-IL-6) [53, 54]. In particular, studies on bronchial epithelial cells show that IL-6 is NF-κB regulated [55, 56, 57], thus making this transcription factor an excellent signaling regulator candidate of LL-37-mediated IL-6 production. To examine if NF-κB activation was involved in IL-6 production in LL-37-exposed 16HBE14o^– cells, we utilized two chemical inhibitors of NF-κB activation, Bay11-7085 and parthenolide (fig. 4a, b). 16HBE14o^– cells were incubated with Bay11-7085 or parthenolide at 10 μM for 1 h prior to stimulation with LL-37 (30 or 50 μg/ml) or IL-1β (10 ng/ml) for 6 h. As expected, both inhibitors abrogated all IL-6 induced by both LL-37 concentrations tested, as well as the IL-1β treatment (fig. 4a, b). Furthermore, to examine other signaling regulation of LL-37-mediated IL-6 production, we used the following inhibitors: AG1478 (EGFR inhibitor), PD98059 (MEK/ERK inhibitor), SB203580 (p38 inhibitor), SP600125 (JNK inhibitor) and pertussis toxin (G-protein-coupled receptor inhibitor; fig. 4c). Similarly to NF-κB inhibitor experiments, 16HBE14o^– cells were pre-incubated with inhibitors for 1 h prior to stimulation with 30 μg/ml of LL-37 for 6 h. As shown in figure 4c, none of the tested inhibitors showed the level of inhibition observed with either of the NF-κB inhibitors.

To further corroborate that the NF-κB pathway was implicated in LL-37-mediated responses in bronchial epithelial cells, we investigated the activation of this pathway more directly. Specifically, 16HBE14o^– cells were treated with 50 μg/ml of LL-37, or 10 ng/ml of IL-1β (as a positive control), over a time course of 15, 30 and 60 min, while phosphorylation and degradation levels of Iκ-Bα were examined by Western blotting. LL-37 induced Iκ-Bα phosphorylation within 15 min of stimulation (fig. 5a), and this effect was confirmed by the LL-37-induced degradation of total Iκ-Bα (fig. 5b). In addition to examining Iκ-Bα regulation, a more direct approach was taken, and nuclear translocation of p50 and p65 NF-κB subunits was examined upon 16HBE14o^– cell stimulation with LL-37 at 30 and 50 μg/ml. Both peptide concentrations were able to induce nuclear translocation of both p50 and p65 NF-κB subunits, as did the flagellin-positive control at 1 μg/ml (fig. 6), thus providing more direct evidence of peptide-induced NF-κB activation. Therefore, in addition to demonstrating that LL-37 stimulation can lead to NF-κB pathway activation (fig. 6), it was established that this signaling pathway is a major regulator of LL-37-induced IL-6 production in bronchial epithelial cells (fig. 4).

Fig. 5.

LL-37 induces Iκ-Bα phosphorylation (a) and total Iκ-Bα degradation (b) in 16HBE14o^– cells. 16HBE14o^– cells were treated with 50 μg/ml LL-37, 10 ng/ml IL-1β, or were left untreated (control, C), over a time course of 15, 30 and 60 min. Whole cell protein lysates were prepared and analysed by SDS-PAGE and immunoblotting. The housekeeping protein GAPDH was assessed as a loading control. Results are from one experiment for each panel, representative of three experiments.

Fig. 6.

LL-37 induces p50 and p65 NF-κB subunit translocation into the nucleus in 16HBE14o^– cells. 16HBE14o^– cells were treated with 30 or 50 μg/ml LL-37 alone, 1 μg/ml flagellin alone, or were left untreated (control), for 30 min. Nuclear extracts were isolated and analyzed by SDS-PAGE and immunoblotting. Immunoblots were probed for p50 and p65 NF-κB subunits, as well as H2AX histone antibody as a loading control for nuclear extracts. Results shown are from a representative experiment (out of three).

LL-37 Increased Flagellin-Induced IL-6 Release from Bronchial Epithelial Cells

LL-37 has been shown to modulate TLR responses in several cell systems. In monocytes/macrophages it has been demonstrated to delicately balance and selectively modify transcriptional responses to LPS/TLR4 signaling [27], while in DCs it interferes with TLR ligand-mediated activation through cytokine inhibition and alteration of surface marker and receptor expression [38]. While many studies indicate that bronchial epithelial cells respond poorly to LPS stimulation (also observed here, fig. 1a) due to low expression of the LPS receptor TLR4 and/or the lack of certain accessory molecules required for TLR4 pathway induction [58, 59, 60], TLR5 expression and the role of the TLR5 signaling pathway in pathogen recognition (via flagellin) in the lung has been well described [61, 62]. Therefore, the effect of LL-37 on flagellin-mediated cytokine release was examined.

To determine whether LL-37 would have any effect on flagellin-mediated cytokine release in airway epithelial cells, 16HBE14o^– cells were treated with a range of LL-37 doses and/or flagellin at 1 μg/ml for 6 h. Cell culture supernatants were tested for IL-6 release by ELISA. Over a range of concentrations, LL-37 significantly (p < 0.05) enhanced flagellin-induced IL-6 production and release (fig. 7a) in 16HBE14o^– cells. In order to distinguish between additive and synergistic induction of IL-6 mediated by LL-37 and flagellin, a comparative statistical analysis has been done on summed values of individual peptide and flagellin stimulations versus the values obtained from co-stimulated samples (data not shown). Only the 30 and 50 μg/ml LL-37 + flagellin co-stimulation treatments synergistically increased IL-6 release in 16HBE14o^– cells (p < 0.05, Student's t test), while the other peptide doses mediated an additive effect. Similar peptide and flagellin augmentation of IL-6 release (p < 0.05) was observed in primary NHBE cells (fig. 7b), even at very low LL-37 concentrations (<5 μg/ml). In primary HBE cells, only LL-37 at 3 μg/ml synergistically enhanced IL-6 production in flagellin co-stimulated treatment (p < 0.05). These results indicate that LL-37 can act as a co-stimulatory molecule to increase TLR5-mediated cytokine release in bronchial epithelial cells. The signaling regulation of this cooperative effect of LL-37 and flagellin on IL-6 induction was tested in primary NHBE cells with the use of chemical inhibitors. Primary NHBE cells were pretreated with 20 μM of LY294002, 15 μM of PD98059 or 15 μM of SB203580 for 1 h, and were subsequently treated with LL-37 alone at 3 μg/ml, flagellin alone at 500 ng/ml, or with both the peptide and flagellin simultaneously for 6 h. Cell culture supernatants were tested for IL-6 release by ELISA. As shown in figure 8, PI3K (fig. 8a) and p38 (fig. 8b) signaling pathways regulate IL-6 production mediated by co-stimulation of LL-37 and flagellin and each of the treatment alone, while no significant effect was observed with ERK1/2 inhibition.

Fig. 7.

LL-37 increased flagellin-induced IL-6 release in 16HBE14o^– and primary NHBE cells. a Confluent 16HBE14o^– cells were treated with LL-37 at 5, 15, 20, 30 and 50 μg/ml alone, flagellin at 1 μg/ml alone, or flagellin and LL-37 (at 5, 15, 20, 30 and 50 μg/ml) in combination, or were left untreated (control) for 6 h. b Confluent pNHBE cells were treated with 1 or 3 μg/ml of LL-37 alone, 500 ng/ml flagellin alone, flagellin and LL-37 combined (1 and 3 μg/ml), or were left untreated (control) for 6 h. IL-6 release in culture supernatants was determined via ELISA. Results are expressed as means ± SD of three independent experiments (* p < 0.05 vs. LL-37 alone).

Fig. 8.

LL-37 increased flagellin-induced IL-6 release in primary NHBE cells is regulated by PI3K and p38 signaling. Confluent primary NHBE cells were pretreated with PI3K inhibitor LY294002 at 20 μM (a) or ERK1/2 inhibitor PD98059 at 15 μM or p38 inhibitor SB203580 at 15 μM (b) and were treated for 1 h with 3 μg/ml of LL-37 alone, 500 ng/ml flagellin alone, flagellin and LL-37 combined (3 μg/ml), or were left untreated (control: no inhibitor) for 6 h. IL-6 release in culture supernatants was determined via ELISA. Results are expressed as means ± SD of three independent experiments (* p < 0.05 vs. flagellin alone, ** p < 0.05 vs. respective treatment without inhibitor).

Previous reports showed that LL-37 at concentrations >30 μg/ml in airway epithelial cell lines (no FBS), and >10 μg/ml in primary NHBE cells (10% FBS) induces concentration-dependent apoptosis after ˜24 h of stimulation [22, 23]. As a control experiment we treated 16HBE14o^– cells in media containing 2% FBS with 30 μg/ml of LL-37, 0.5% Triton X-100 (as a necrosis inducer) and 300 μM hydrogen peroxide (as an apoptosis inducer) to show that the observed effect was due to specific peptide action. Unlike the positive control, hydrogen peroxide, LL-37 caused minor apoptosis as judged by TUNEL staining, even at 50 μg/ml (fig. 9b–e) 6 h after treatment. As shown in figure 9a, only LL-37 was able to induce a significant level of IL-6 release from airway epithelial cells.

Fig. 9.

IL-6 induction in 16HBE14o^– cells and toxicity. a Confluent 16HBE14o^– cells were treated with 30 μg/ml of LL-37, 0.5% of Triton X-100 (necrosis inducer) and 300 μM hydrogen peroxide (apoptosis inducer) for 6 h. IL-6 release in culture supernatants was determined by ELISA. Results are expressed as means ± SD of three independent experiments. b Sub-confluent 16HBE14o^– cells were left untreated (b), were treated with 300 μM H₂O₂ (apoptosis inducer; c), or 30 (d) or 50 μg/ml of LL-37 (e) for 6 h. After treatment incubation, a TUNEL assay was performed. A single field of view out of three from a representative experiment (out of three) is shown for each treatment, with DAPI-stained cells (left) and TUNEL-positive cells (right).

Discussion

Substantial increases in the local concentration of host defence peptide LL-37, the only human cathelicidin, have been described during inflammation or infection of various sites including psoriatic lesions [11, 63], subcutaneous wounds [64], nasal secretions of patients with chronic rhinitis [65], cystic fibrosis, pulmonary sarcoidosis and COPD [16, 17, 18, 66]. Host defence peptide LL-37 appears to be a potent modulator of immune response mediating multiple immunomodulatory effects. For example, it is capable of acting as an anti-inflammatory agent and neutralizing TLR-ligand-induced production of pro-inflammatory cytokines (TNF-α, IL6 and IL-1β) by monocytes/macrophages and DCs [27, 38]. In addition, LL-37 can directly affect pro-inflammatory responses by stimulating numerous cell types to produce chemokines, through which differential recruitment of various effector cells could affect the course and outcome of inflammation and infection [30, 39, 43, 67, 68]. Furthermore, LL-37 can synergize with other inflammatory mediators, such as GM-CSF and IL-1β, to mediate the induction of various chemokines [27, 39, 42]. LL-37 may also be involved in the regulation of homeostasis and integrity of various epithelial sites through modulation of cell proliferation and induction of wound healing [30, 31, 32, 33, 69]. To date the interaction of LL-37 with epithelial cells has been studied to a limited extent and only the up-regulation of IL-8 has been demonstrated and studied mechanistically [41], revealing significant differences to monocyte responses.

In this report we have shown that LL-37 is also able to induce IL-6 release, but not IL-1β or TNF-α, in 16HBE14o^– and primary NHBE epithelial cells in a dose- and time-dependent manner (fig. 1, 2). Furthermore, LL-37-mediated stimulation occurred at the level of IL-6 gene expression in a time-dependent manner in 16HBE14o^– cells. It was particularly interesting to observe the induction of IL-6, but not IL-1β and TNF-α, since this cytokine group is commonly induced as part of a general pro-inflammatory response mediated, at least in part, through the same signalling pathways, including the NF-κB activation pathway. The demonstrated absence of potential IL-1β/TNF-α autocrine stimulation and absence of induction of any cytokines by LPS (ruling this out as a contaminant) indicate that this IL-6 response is specific to LL-37 stimulation, and not a secondary effect.

IL-6 is a particularly interesting cytokine with respect to lung immunity. An increase in IL-6 secretion and expression has been described in several lung conditions, such as cystic fibrosis, COPD and the acute respiratory distress syndrome [65, 70, 71]. In the lung, IL-6 can act as a pro-inflammatory or anti-inflammatory agent, depending on the stimulus and inflammation context. For example while the potent pro-inflammatory response to bacterial TLR agonists often involves the up-regulation of IL-6, IL-1β and TNF-α, results from a model of systemic endotoxaemia in an IL-6 knock-out mouse and in an endotoxic lung model indicate that IL-6 plays a crucial anti-inflammatory role [72]. Thus LL-37-mediated IL-6 could act as a mediator that contributes to the maintenance of a delicate inflammatory balance in the lung. Several studies have described IL-6-mediated protection against lung injury and induction of angiogenesis [73, 74].

In airway epithelial cells, TLR agonists such as bacterial flagellin, IL-1β and TNF-α. but not bacterial LPS, have been shown to mediate NF-κB activation [56, 61, 75]. This NF-κB activation in the lung mucosa has been described to regulate a multitude of responses including cytokine regulation (e.g. IL-6, IL-8, IL-1β and TNF-α), chemokine regulation (e.g. IL-8, GRO-α and RANTES), adhesion molecule expression and other processes central to inflammatory responses [75].

Previous studies demonstrated that IL-8 production in epithelial cells in response to LL-37 stimulation was dependent on ERK1/2 and p38 MAP kinase activation stimulated downstream of EGFR transactivation [39, 41], whereas IL-6 production, as shown here, was only partially dependent on this signaling (fig. 4c). In this report, we have demonstrated for the first time the obligate contribution of activated NF-κB signalling in LL-37-mediated IL-6 production in airway epithelial cells. Phosphorylation of Iκ-Bα is a signal that induces ubiquitin-mediated proteasome degradation of this regulator, and this degradation allows NF-κB subunits sequestered in the cytosol to migrate to the nucleus and activate the transcription of many genes, including IL-6 [76]. In addition to demonstrating LL-37-induced Iκ-Bα phosphorylation and total Iκ-Bα degradation (fig. 5), it was shown here that LL-37 stimulation of airway epithelial cells caused NF-κB p50 and p65 subunit nuclear translocation (fig. 6). Inhibitor studies supported the conclusion that this NF-κB signalling activation was required for LL-37-stimulated IL-6 release (fig. 4a, b).

In airway epithelial cells, the significance of NF-κB signalling in the production and regulation of IL-6 was previously demonstrated [55, 56, 77]. A detailed analysis of the regulatory region of the IL-6 gene shows putative binding sites for a variety of response regulators, including NF-κB, AP-1, CREB and NF-IL-6 [78, 79, 80], an observation consistent with the possibility that IL-6 transcriptional regulation requires a complex of transcriptional factors for optimal expression. Evidence supporting the putative involvement of multiple transcription factors in LL-37-mediated regulation of chemokine production comes from monocytic cell/PBMC studies where activation of Elk-1, NF-κB and CREB was demonstrated [39, 42], while activation of STAT transcription factor was shown in keratinocytes [33]. Thus, it appears that host defence peptide LL-37 induces its immunomodulatory effects through a complex mechanism. It is not possible to speculate which up-stream signaling pathways regulate this LL-37-mediated NF-κB activation in airway epithelial cells. Our own inhibitor studies indicated that EGFR, p38 and ERK1/2 signaling pathways each contribute only partially to IL-6 regulation (fig. 4c), in contrast to the much stronger effects observed on other LL-37-induced immunomodulatory effects and to the complete inhibition by NF-κB inhibitors of LL-37-mediated IL-6 production by epithelial cells (fig. 4a, b). The effect of a P2X₇ inhibitor KN-62 was also tested, however no significant effect on IL-6 production was observed (data not shown). These results thus imply an involvement of EGFR and/or MAPK pathways upstream of NF-κB activation, but favour the possibility that either they have an indirect effect or are one of several convergent pathways that impact on NF-κB activation.

It is worth mentioning that a role for NF-κB has already been described with respect to LL-37-mediated immunomodulation, although not in epithelial cells. For example, inhibitor studies showed NF-κB regulation in endothelial cell activation and angiogenesis [34]. In a monocytic cell line, LL-37 was shown to inhibit LPS-stimulated nuclear translocation of various NF-κB subunits, which was proposed to be one of the mechanisms by which LL-37 suppresses LPS-induced gene transcription and exerts an anti-endotoxin effect [27]. In contrast, LL-37 stimulation alone has been described to induce the transient phosphorylation of Iκ-Bα and nuclear translocation of p50 and p65 NF-κB subunits in primary PBMCs [42]. The LL-37-mediated activation of the NF-κB signalling pathway in airway epithelial cells is a novel effect of this host defence peptide. Indeed, NF-κB regulation proved to be the pivotal regulation mechanism with respect to selective peptide-mediated IL-6 production.

Flagellin-mediated activation of TLR5 signalling in lung epithelial cells has been demonstrated to induce transient cytosolic calcium increase, PI3K and MAPK signalling, and subsequent NF-κB activation leading to the production of molecules such as IL-6 and IL-8 [61, 62, 81]. It has been demonstrated that in DCs, LL-37 inhibited flagellin-mediated IL-6, TNF-α and IL-12 production, and that overall it acted to inhibit TLR ligand activation of these cells [38]. Similarly, studies in monocytic cells/macrophages further describe this inhibitory effect on other TLR ligand-mediated responses [27, 28]. In airway epithelial cells however, co-stimulation with flagellin and LL-37 over a range of doses augmented the cytokine/chemokine signature of these cells. As shown in figure 7, IL-6 was significantly augmented when both stimuli were applied together. Similarly, enhanced production was observed with IL-8 and GRO-α (data not shown). It thus appears that in the context of lung epithelial innate immunity, LL-37 acts cooperatively to enhance the immune response mediated by flagellin-TLR5 pathway responses. Thus LL-37 acts as a co-stimulatory agent to increase the sensitivity to flagellin-mediated inflammatory response in the lung and would therefore lead to a more stringent host defence response. Signaling pathway regulation underlying the co-stimulatory IL-6 induction in primary lung epithelial cells appears to involve the same/similar pathways as for flagellin-mediated induction (fig. 8). Previously, the role of p38 in flagellin-mediated signaling has been described in lung epithelial cells [62, 81], while the involvement of the PI3 pathway was described in colonic epithelial cells [82]. Given that LL-37-mediated IL-6 production was shown to be NF-κB regulated (fig. 4a, b), it is possible that LL-37/flagellin stimulation results in additive augmentation of NF-κB stimulation.

As indicated by an increasing number of studies, LL-37 is a potent modulator of immune responses of various effector cells. In this study we report another facet of LL-37 function in lung innate responses. In addition to the previously described IL-8 induction via EGFR and MAPK activation [39, 41], we report here that LL-37 can activate one of the pivotal regulatory pathways in innate immune responses – NF-κB, which controls peptide-mediated IL-6 induction in airway epithelial cells. Furthermore, we report an augmenting effect of LL-37 on responses to the TLR5 ligand flagellin on cytokine production in these cells.