Skip to main content
Scientific Reports logoLink to Scientific Reports
. 2020 Jul 28;10:12619. doi: 10.1038/s41598-020-69485-y

In silico identification and functional validation of linear cationic α-helical antimicrobial peptides in the ascidian Ciona intestinalis

Yukio Ohtsuka 1,, Hidetoshi Inagaki 1,
PMCID: PMC7387483  PMID: 32724213

Abstract

We developed a computing method to identify linear cationic α-helical antimicrobial peptides (LCAMPs) in the genome of Ciona intestinalis based on its structural and physicochemical features. Using this method, 22 candidates of Ciona LCAMPs, including well-known antimicrobial peptides, were identified from 21,975 non-redundant amino acid sequences in Ciona genome database, Ghost database. We also experimentally confirmed the antimicrobial activities of five LCAMP candidates, and three of them were found to be active in the presence of 500 mM NaCl, nearly equivalent to the salt concentration of seawater. Membrane topology prediction suggested that salt resistance of Ciona LCAMPs might be influenced by hydrophobic interactions between the peptide and membrane. Further, we applied our method to Xenopus tropicalis genome and found 11 LCAMP candidates. Thus, our method may serve as an effective and powerful tool for searching LCAMPs that are difficult to find using conventional homology-based methods.

Subject terms: Peptides, Bioinformatics

Introduction

Antimicrobial peptides are crucial and widespread effector molecules of the innate immune system and are a part of the first line of host defense against invading pathogens1,2. To date, thousands of antimicrobial peptides have been identified from bacteria to mammals and have been classified into several groups on basis of the structure and sequence features35. Of these, linear cationic α-helical antimicrobial peptides (LCAMPs), the genes of which encode short amphipathic peptides without cysteine residues, are the most abundant and widespread in organisms. LCAMPs are known for their broad-spectrum activities including the ability to rapidly kill or neutralize bacteria, fungi, viruses, parasites, and even cancer cells6,7. Therefore, they are considered promising lead candidates for the development of new peptide antibiotics8. There is a need for novel antibiotics due to the growing problem of microbial resistance to conventional antibiotics. LCAMPs might reduce the risk of emergence of antibiotic-resistant bacteria. In vitro development-resistance studies showed that pexiganan, an LCAMP, possesses a low potential for induction of bacterial resistance9.

Marine organisms are considered the richest source of novel antimicrobial peptides. They live in close proximity with pathogenic microbes. The estimated density of bacteria in seawater is approximately 106 bacteria/mL10. In order to survive in this environment, they need to have a robust and effective immune system. Marine organisms are also exposed to extreme conditions, such as low temperature, high salinity and elevated pressure. The diversity of the marine environment has provided novel and unique sources of potential antimicrobial peptides11. In fact, marine antimicrobial peptides were found to be structurally different from their analogs in terrestrial species12. However, relatively limited numbers of antimicrobial peptides have been isolated from marine organisms, because antimicrobial peptides are a rapidly evolving group and display low sequence homology between orthologous antimicrobial peptides. Leoni et al. successfully identified a novel LCAMP family in marine mussels by bioinformatics analyses of available genomic and transcriptomic data13. To effectively and accurately identify novel antimicrobial peptides, there is a need to develop additional bioinformatics tools to survey protein sequence databases without use of sequence homology.

The ascidian Ciona intestinalis type A (hereinafter referred to as C. intestinalis) is a well-characterized marine invertebrate. Its genome has been sequenced14 and a large quantity of information about its transcriptome has been collected by EST and RNA-seq analyses15,16. It has been concluded that among invertebrates, ascidians are the closest phylogenetic relatives to vertebrates. Moreover, genome-wide sequence analysis revealed that they have a set of genes for innate immune system, such as complement factors and Toll-like receptors, but lack an adaptive immune system that is present in higher vertebrates17,18. These findings suggest that innate immune system for host defense is highly evolved in ascidians.

Previously, two salt-resistant LCAMPs, Ci-MAM-A and Ci-PAP-A, were identified from C. intestinalis hemocyte EST database by searching signal peptide and cationic helical region19,20. In this study, to identify further novel LCAMPs in C. intestinalis, we developed an in silico screening method based on further criteria such as the size, amphipathicity and aggregation propensity. Consequently, we computationally predicted 22 potential LCAMP candidates in Ciona genome and experimentally confirmed five novel salt-resistant LCAMPs with broad-spectrum antimicrobial activity. This strategy was also successfully applied to Xenopus tropicalis genome, suggesting that our method could be applicable to the in silico screening of any genome.

Results

Genome-wide search for discovery of novel Ciona LCAMPs

We developed a computing method for the detection of LCAMPs in the Ciona genome based on the structural and physicochemical features of known LCAMP precursors: short length, secretory peptide, and cationic amphipathic α-helix of mature peptide. The Ciona genomic database called Ghost database, includes 21,975 non-redundant complete amino acid sequences, from which 1,949 sequences with 50–100 residues in length were extracted.

Firstly, to find LCAMP precursors from 1,949 sequences, we predicted signal peptides using SignalP 4.1 server. In total, 252 sequences were predicted to be secretory peptides, and the sequences corresponding to the signal peptides were eliminated from them. Furthermore, the secretion of their peptides into extracellular space was confirmed using TMHMM server, and then, eight sequences were eliminated as transmembrane proteins. Next, sequences containing cysteine residues were eliminated from the 244 subsequences without signal peptides, and cationic amphipathic α-helical structure was predicted using HeliQuest server. HeliQuest screening was performed for 165 subsequences without cysteine residues and 80 putative cationic amphipathic helical segments were identified. The secondary structure of HeliQuest-identified cationic amphipathic segments was further confirmed. Using PROTEUS server, it was found that 44 segments had the potential to form α-helical structures. Subsequently, the aggregation propensity of cationic amphipathic α-helical segments was predicted using AGGRESCAN, in which normalized average of aggregation propensity (Na4vSS) of the proteins was evaluated. Forty-four cationic amphipathic α-helical segments had Na4vSS values within a broad range of − 65.6 to 14.8. A previous study reported that antimicrobial peptides have Na4vSS values within the range of − 40 to 6021. Therefore, we investigated whether cationic amphipathic α-helical segments with Na4vSS value less than − 30 have antimicrobial activity. Four selected segments, KH.C1.365, KH.L63.9, KH.S1007.2, and KH.S930.2 with Na4vSS values of − 32.9, − 65.6, − 48.1 and − 44.4, respectively, exhibited no or weak antimicrobial activities against Escherichia coli (Supplementary Fig. S1). Consequently, as potential candidates for Ciona LCAMPs, we identified 24 segments with Na4vSS value between − 30 and 30. Finally, the prediction of subcellular localization was performed to eliminate cellular components from LCAMP candidates. Using DeepLoc-1.0 server, 22 genes were identified as LCAMP candidates (Table 1).

Table 1.

The list of LCAMP candidates predicted from Ciona genome database.

Gene ID Cationic amphipathic helix sequence Anionic helix sequence Putative protein product
KH.C1.100 WSSLGRSLLRLTHALKPLA FAPEIEDELEASEMDRIMQQMADEKQ Ci-MAM-A
KH.C1.1006 WTVTRYWNQKLANLLAGK Uncharacterized protein
KH.C1.1192 DGWVRTGLAVARLVVGRRRRRWNEANGL RWNEANGLEKLSSDAEETLSAAEMEEVMQKIMDHQ Ci-MAM-Da
KH.C1.1268 DWVRTAIGVAGLVLGRRRRGGWNQANGLKKFSSDA LKKFSSDAEETLSAAEMEEVMQKIMDHQ Ci-MAM-Ea
KH.C1.453 ALRSAVRTVARVGRAVLPHV QQPTSQADMLEDALEAQAIEALMQE Ci-PAP-A
KH.C1.640 WLSRRRSSLFYWRRRRYDQ RRYDQQSAKDMNEEDEPAETEAISDMLAKEDMPE Uncharacterized protein
KH.C10.625 VFPSRRYGSLWSSFRRRIIRIHPQP Uncharacterized protein
KH.C14.152 FRGLVRAGGKLVKEVLPSI PWTKWNEQERMALADEIDAELMDLLDQ Ci-META4
KH.C14.235 FRGLVRAGGKLVKEVLPSI PWTKWNEQERMALADEIDAELMDLLEQ Ci-META4
KH.C4.429 RLPQTVKNSLKHDQVIWKLFVKGV Uncharacterized protein
KH.C5.577 EHVFFSRRRRWTRWNQKVVVEDI WNQKVVVEDILEAMEQSDMLH Uncharacterized protein
KH.C7.94 FSRRRFDFSRRRIYVARRRSLAFAHRRRFGDTA NNPIKTDSDETSYIHSDQADDELMQMAE Uncharacterized protein
KH.L136.4 WWLSGRRRVGRRRRRIIAY Uncharacterized protein
KH.L14.3 YNARDLAKRNVGVSGQRVVSI LGDTADINEYLSRLLDYES Uncharacterized protein
KH.S1531.4 INKKFRWHGKRKWWLRFVKQYSGNENIQ Uncharacterized protein
KH.S2775.1 KGRSLKKIRQFWRKFYKPFR NENIQRNFLNMERESIEEMMADEIFRNF Uncharacterized protein
KH.S655.3 RRRRIAGKIGGGVAKTAAEL TAAELAAEQALESSTGGGSWS Ci-META6
WNQQRKMENAMNDEMDAELLLNLLKE
KH.S775.4 SLLRVETKAILGTLALRRRTWNENKASQQITP ITPEMEEKLDAEMEKLMQQLAEDQ similar to Ci-MAM-A
KH.S775.5 SLAAGFKLLFKSWVHRRRTWNEKTTSD NEKTTSDQFTAENDKPFDFAEMDGLLNNLETENQ Ci-MAM-Ca
KH.S908.1 KGGKFLNFLKKAAKVGAKVGMAAL MAALGDEGEIEAFERLDTETQHAILAEALEN Uncharacterized protein
KH.S921.1 TWPKNYWRKVWSKKNWRKFVKKFKHWNQGQNVED KFKHWNQGQNVEDMDLEDMQLLWE Uncharacterized protein
KH.S921.3 QAGVFDRKFWTRKHWSQVGKGLKRWNQKQNVENM RWNQKQNVENMDLDDEIQYYE Uncharacterized protein

aNomenclature of LCAMPs by Fedders et al.19.

Ciona LCAMP candidates identified by our screening method include known LCAMPs such as Ci-MAM-family genes20 and a number of uncharacterized proteins. In addition to Ciona genome, we predicted LCAMPs in X. tropicalis genome using our screening method. Eleven LCAMP candidates containing seven known LCAMPs22 were selected from 26,132 non-redundant protein sequences in the X. tropicalis genome (Supplementary Table S1), which suggests that our screening method is able to support the identification of LCAMPs from various genomes. LCAMP precursors are known to have a highly conserved signal peptide23. Two conserved signal peptides were found in Ciona LCAMP candidates identified by our screening method (Fig. 1). In five members of Ci-MAM family, signal peptides composed of 21–22 amino acid residues were well-conserved (80% majority-rule consensus sequence: MDRKIVFALXLVXXLXVSXXXA). In addition, another conserved signal peptide composed of 23 amino acid residues (80% majority-rule consensus sequence: MNKSALLXLLXXGLXVLXEXXXA) was identified in six LCAMP candidates, suggesting that they belong to a novel LCAMP family. Previous studies showed that Ciona LCAMP precursors possess an anionic helical region in addition to a cationic amphipathic region19,20. Using HeliQuest server, anionic helical sequences were found at the C-terminus of 17Ciona LCAMP precursor candidates (Table 1), indicating that most Ciona LCAMP precursors are composed of a signal peptide, a cationic amphipathic region, and an anionic helical region in that order.

Figure 1.

Figure 1

Multiple sequence alignment of the signal peptide and identity matrix in LCAMP families. Sequences of the predicted signal peptides in Ci-MAM (A) and novel (B) families were aligned using ClustalW. Percentage identity values for pairwise comparisons of the sequences without signal peptides of these family genes are shown.

Antimicrobial activity of Ciona LCAMPs

Uncharacterized proteins in Table 1 are promising candidates of novel LCAMPs. To identify novel LCAMPs in Ciona, we tested antimicrobial activity in five LCAMP candidates, KH.C1.640, KH.C7.94, KH.S1531.4, KH.S908.1, and KH.S921.1. All synthesized peptides exhibited a broad-spectrum of antimicrobial activity (Table 2). They had potent antimicrobial activity against two anaerobic bacteria E. coli and Staphylococcus aureus. KH.S908.1 and KH.S921.1 peptides also showed potent antimicrobial activity against aerobic bacteria Pseudomonas aeruginosa. Furthermore, antifungal activity against Saccharomyces cerevisiae was observed in KH.C1.640, KH.C7.94, KH.S1531.4, and KH.S908.1 peptides. These results show that our screening method is capable of identifying novel LCAMPs.

Table 2.

Antimicrobial properties of Ciona LCAMPs.

Peptide MIC (μM)
E. coli (NBRC 14237) S. aureus (NBRC 12732) S. cerevisiae (NBRC 10217) P. aeruginosa (NBRC 12582)
KH.C1.640 < 3.125 < 3.125 12.5 Negative
KH.C7.94 6.25 6.25 6.25 Negative
KH.S1531.4 < 3.125 < 3.125 6.25 Negative
KH.S908.1 < 3.125 < 3.125 6.25 6.25
KH.S921.1 < 3.125 < 3.125 Negative < 3.125

Ci-PAP-A (KH.C1.453) and Ci-MAM-A (KH.C1.100) are known to exhibit antimicrobial activity in the presence of 100 and 450 mM NaCl, respectively19,20. We examined the effects of five novel Ciona LCAMPs in the presence of NaCl on antimicrobial activity against E. coli. Reflective of the habitat of C. intestinalis, salt resistance was found in all peptides at the concentration of 12.5 μM (Fig. 2). In particular, KH.C1.640, KH.S908.1, and KH.S921.1 peptides retained potent antimicrobial activity in the presence of up to 500 mM NaCl. Previous studies suggest that helical stability, hydrophobicity and amphipathicity in LCAMPs are important for salt resistance2427. However, each property of Ciona LCAMPs cannot explain salt resistance per se, as shown in Table 3. Therefore, we predicted the membrane interaction property of Ciona LCAMPs using AmphipaSeek server, which predicts that a protein or peptide can be monotopic and anchored via an amphipathic helix inserted parallel to the membrane interface28. The prediction showed that a membrane anchor region was found in higher salt resistant LCAMPs (Ci-MAM-A, KH.C1.640, KH.S908.1, and KH.S921.1) but not in low-salt resistant LCAMPs (Ci-PAP-A and KH.C7.94; Table 3). This suggests that in-plane membrane anchoring might be responsible for salt resistance.

Figure 2.

Figure 2

Effect of salt on the antimicrobial activity of Ciona LCAMPs. Antimicrobial activity of KH.C1.640, KH.C7.94, KH.S1531.4, KH.S908.1, and KH.S921.1 peptides against E. coli was assessed in the presence of 100, 200, 300, and 500 mM NaCl. Peptide concentrations were 3.12, 6.25, and 12.5 μM. Error bars show the standard deviation (n = 3) from a single experiment.

Table 3.

Physicochemical properties of Ciona LCAMPs.

Gene ID Antimicrobial peptide sequence Hydrophobicity Hydrophobic moment Net charge
KH.C1.640 WWLSRRRSSLFYWR 0.624 0.170 + 4
KH.C7.94 SRRRFDFSRRRIYVARRRSLAFAHRRR − 0.033 0.118 + 11
KH.S1531.4 TINKKFRWHGKRKWWLRFVKQ 0.316 0.151 + 8
KH.S908.1 KGGKFLNFLKKAAKVGAKVGMAALG 0.294 0.319 + 6
KH.S921.1 KLKTWPKNYWRKVWSKKNWRKFVKKFKHW 0.272 0.141 + 12
KH.C1.100 (Ci-MAM-A) WRSLGRTLLRLSHALKPLARRSGW 0.428 0.380 + 6
KH.C1.453 (Ci-PAP-A) ALRSAVRTVARVGRAVLPHVAI 0.449 0.350 + 4

The membrane anchor segments predicted by AmphipaSeeK are highlighted in bold.

The hydrophobicity, hydrophobic moment, and net charge values calculated by HeliQuest.

LCAMP gene expression in Ciona hemocytes

To investigate the expression of Ciona LCAMPs in response to microbial infections, we performed RT-PCR analysis on Ciona hemocytes stimulated with bacterial lipopolysaccharide (LPS). First, the expression of Ci-mam-A (KH.C1.100), known as an inducible antimicrobial peptide20, was examined using our culture system. As a previous study, Ci-mam-A expression was induced by LPS stimulation (Fig. 3). The expression of eight LCAMP genes in LPS-treated hemocytes was also further assessed by RT-PCR. Ci-meta4 and two novel LCAMP genes (KH.C1.640 and KH.S908.1) were transcriptionally upregulated by LPS, whereas there were no changes in four LCAMP genes containing Ci-pap-A (Fig. 3). NF-κB is activated in cells challenged with LPS and other inflammatory stimuli and is involved in the transcriptional activation of responsive genes29. To confirm the involvement of Ciona LCAMPs in the immune response, we predicted NF-κB binding sites in the upstream regions of each gene. Using Match-1.0 public, putative NF-κB binding sites were identified in the upstream regions of LPS-inducible LCAMP genes, but not in the upstream regions of KH.C7.94 and KH. S1531.4 genes (Table 4). These suggests that four inducible LCAMPs (Ci-MAM-A, Ci-META4, KH.C1.640, and KH.S908.1) may play a role in the innate immune response.

Figure 3.

Figure 3

LCAMP mRNA expression in Ciona hemocytes stimulated with LPS. The expression of LCAMP genes in Ciona hemocytes treated (+) or untreated (−) with 0.1 mg/mL LPS for 1 h was analyzed by RT-PCR. EF1α and PPIA were used as internal controls.

Table 4.

Putative NF-κB binding sites in the upstream region of Ciona LCAMP genes.

Gene ID Positions from ATG start codon
KH.C1.100 − 99/− 108, − 480/− 493, − 1,291/− 1,300
KH.C1.453 − 523/− 532, − 545/− 554, − 1,121/− 1,131, − 1,210/− 1,221, − 1,235/− 1,248, − 1,635/− 1,648
KH.C1.640 − 286/− 299
KH.C14.152 − 37/− 46, − 243/− 253, − 1,449/− 1,458
KH.C14.235 − 1,446/− 1,455
KH.C7.94 N.D.
KH.S1531.4 N.D.
KH.S908.1 − 692/− 701, − 747/− 756
KH.S921.1 − 124/− 133, − 811/− 824, − 1,290/− 1,299

*N.D. not detected.

Discussion

In this study, we applied a computational approach to identify novel LCAMPs in C. intestinalis and identified 22 potential LCAMP candidates using their known physicochemical characteristics and subcellular localization predictions. Furthermore, we experimentally validated the broad-spectrum antimicrobial activity of five selected LCAMPs. Two of them were induced with LPS and putative NF-κB binding sites were identified in the upstream region of their genes, suggesting that they may play a role in the innate immune response. However, our data do not rule out the involvement of the other three genes in the immune response, as they may be regulated by uncharacterized innate immune signaling pathways.

In order to explore the proteins and peptides with similar function among different species, homology search tools such as BLAST have generally been used. Several defensin homologs were identified by BLAST search in plant and vertebrate genomes3032. In these studies, some defensins that could be missed by BLAST search were further identified by a hidden Markov model based on a conserved cysteine-rich defensin motif. In contrast to defensin with three unique cysteine frameworks, it is difficult to find LCAMPs among different species using commonly used homology search tools due to poor sequence conservation of LCAMPs, especially in the cationic amphipathic α-helical region33. Therefore, computational approaches without sequence homology information have been designed to discover novel LCAMPs from sequence databases. In marine mussels, novel antimicrobial peptides, myticalins, were identified in the genomes and transcriptomes using bioinformatics analyses13. In Ciona, two LCAMP families, Ci-MAM and Ci-PAP, were identified from a hemocyte EST database based on two structural criteria of LCAMPs, signal peptide, and cationic α-helical region19,20. We developed an in silico method for screening LCAMPs based on seven criteria, size, cationicity, hydrophobicity, amphipathicity, helicity, aggregation propensity, and subcellular location. Thus, we identified peptides that potentially have antimicrobial activity based on the structural and physicochemical features and eliminated non-antimicrobial peptides which cannot come into contact with microbes using subcellular localization prediction. In the prediction of these properties, we used web-based tools that can handle a large number of sequences simultaneously (see “Materials and methods”). This enables screening of LCAMPs in genome databases. Consequently, we identified novel LCAMPs containing KH.S921.1 from C. intestinalis genome database using our in silico method. In addition to C. intestinalis genome, we applied this method to X. tropicalis and succeeded in identifying the cationic amphipathic region including known LCAMPs. Our newly developed method is effective in screening LCAMPs in the genomes of various species. However, our in silico method does not completely exclude false positives. Experimental validation is necessary to validate novel LCAMPs in other organisms using our screening method.

A number of LCAMP precursors are known to possess a signal peptide, cationic amphipathic region, and anionic proregion34,35. In C. intestinalis, almost all candidates shared a typical primary structure composed of a signal peptide, a cationic amphipathic region, and an anionic helical proregion in that order. The signal peptide is highly conserved within the species, and this conservation tendency increases within the individual LCAMP families. For instance, the signal peptides of Ci-MAM family genes are well-conserved20 (Fig. 1). We identified a novel conserved signal peptide composed of 23 amino acid residues, indicating that six LCAMP precursors containing KH.S921.1 with their conserved signal peptide form a novel LCAMP family. In this novel LCAMP family, the anionic proregion is short or absent, whereas in the Ci-MAM family, it is relatively conserved. LCAMP precursors require proteolytic processing in which anionic proregions are removed by proteolytic cleavage to attain their active forms. In frog, LCAMP precursors are processed at the RXXR-, KK-, or RR-motifs corresponding to common cleavage sites in proregions22,23. However, in Ciona LCAMP candidates, acidic amino acid residues, E and D, were found around the boundary of putative cationic active region and proregion, but their basic processing motifs were not. In ascidian, LCAMP precursors may be processed at the N-terminal of the acidic amino acid residue. Previous studies showed that ascidian LCAMPs, Styelins and Clavanins, are cleaved at the N-terminal of D and DD, respectively36,37.

Herein, we demonstrated salt resistance of Ciona LCAMPs. Many antimicrobial peptides lose their activities under physiological salt concentration, although they exhibit significant in vitro activity against bacteria in the presence of low salt concentration. Considering the therapeutic application, the salt-dependent inactivation of antimicrobial peptides is a major obstacle38. Marine organisms, including C. intestinalis, are considered a good resource of salt-resistant antimicrobial peptides. So far, several salt-resistant antimicrobial peptides have been identified in marine organisms39. We demonstrated that three synthetic peptides derived from KH.C1.640, KH.S908.1, and KH.S921.1 retained potent antimicrobial activity in the presence of up to 500 mM NaCl. Additionally, AmphipaSeek prediction strongly suggested these peptides appear to insert parallel to membrane interface. We propose that salt resistance is influenced by hydrophobic interaction between the peptide and membrane. The action mechanism of LCAMPs, such as dermaseptins and cecropins, is explained by “carpet model”40. According to this model, the peptides first align parallel to the phospholipid bilayer membrane, remaining in contact with the lipid head groups and effectively coating the surrounding area. When a threshold concentration of the peptide is reached, the peptides self-assemble within the membrane plane and this reorientation leads to a local disturbance in membrane stability, causing the formation of large cracks, leakage of cytoplasmic components, disruption of the membrane potential, and ultimately disintegration of the membrane. High-salt concentration tends to disturb the first step of the action mechanism, especially the electrostatic interaction between cationic peptides and negatively charged bacterial membranes. It seems likely that salt-resistant LCAMPs could be bound to the membrane surface by the hydrophobic interaction, even if the electrostatic interaction was disturbed under high-salt conditions.

In this study, we demonstrated the effectiveness of a combination of computational and experimental approaches used to identify putative and novel LCAMPs from ascidian and frog genomes. LCAMP is a promising candidate for a new class of antibiotics, with a broad spectrum of antimicrobial activity, ease of synthesis, and a novel mechanism of action against microbes. Our in silico screening method will allow us to discover novel LCAMPs from genetic resources and shed light on the relationship between the structure and function of LCAMPs.

Materials and methods

Genome-wide in silico screening for antimicrobial peptides

The amino acid sequences used for discovery of novel LCAMPs were retrieved from two genome databases, Ciona intestinalis type A (recently called Ciona robusta) sequences from Ghost database (https://ghost.zool.kyoto-u.ac.jp/cgi-bin/gb2/gbrowse/kh/)41 and Xenopus tropicalis sequences from Xenbase (https://www.xenbase.org/entry/)42. LCAMP prediction was performed for sequences with 50–100 residues in length. LCAMP candidates were selected based on signal peptide sequence, hydrophobicity, hydrophobic moment, net charge, α-helix structure, and aggregation propensity. The signal peptide searches and cleavage site predictions were carried out using SignalP 4.1 server (https://www.cbs.dtu.dk/services/SignalP-4.1/)43. Upon the removal of the signal peptide region, the sequences were used for the prediction of membrane-spanning regions using TMHMM server v.2.0 (https://www.cbs.dtu.dk/services/TMHMM/)44 to eliminate transmembrane proteins. Subsequently, cationic amphipathic helix prediction was performed using HeliQuest (https://heliquest.ipmc.cnrs.fr/)45. HeliQuest program slides an 18-residue window along the protein sequence and calculates hydrophobicity, hydrophobic moment, and net charge for each generated segment. Appropriate screening parameters were determined by analyses of cecropin-A (GenBank: AAA29185), moricin (BAB13508), Ci-PAP-A (ABR45664), Ci-MAM-A (ACA97856), dermaseptin SI (CAD92232), and PGLa (CAA25963): hydrophobicity between 0 and 0.6, hydrophobic moment between 0.1 and 1.0, and net charge between 3 and 10. Sequence statistics used in HeliQuest screening were as follows: minimal number of polar residues, minimal number of uncharged residues (serine, threonine, asparagine, glutamine, and histidine), minimal number of glycine residues, and maximal number of charged residues were 6, 1, 0, and 12, respectively, and cysteine was excluded. For identification of an anionic helical region in the LCAMP precursor, parameters were limited: hydrophobicity between − 0.7 and 0.4, hydrophobic moment between 0 and 0.5, and net charge between − 10 and − 3. Secondary structures of putative cationic amphipathic segments were further confirmed by PROTEUS (https://www.proteus2.ca/proteus/)46, and their aggregation propensities were calculated using AGRRESCAN (https://bioinf.uab.es/aggrescan/)47. Finally, subcellular localization was predicted using DeepLoc-1.0 (https://www.cbs.dtu.dk/services/DeepLoc/) to confirm the secretion of LCAMP candidates48.

Sequence analysis

Peptide sequences were aligned using ClustalW. The prediction of NF-κB binding sites upstream of the initiating methionine codon of each gene (less than 2,000 base pairs) was carried out using Match-1.0 public (https://www.gene-regulation.com/pub/programs.html)49. The values of the cut-off for core and matrix similarities were 0.75 and 0.8, respectively.

Antimicrobial activities of the peptides

Peptides used in this study were chemically synthesized using the Fmoc method and obtained from Eurofins Genomics (Tokyo, Japan). The sequences of synthetic peptides were as follows:

KH.C1.365, RRRRRIAARIGSGVAQTGGELI;

KH.C1.640, WWLSRRRSSLFYWR;

KH.C7.94, SRRRFDFSRRRIYVARRRSLAFAHRRR;

KH.L63.9, FRRRRRRRRHWHHHHHYHYHHHRRRRRRRRRW;

KH.S1531.4, TINKKFRWHGKRKWWLRFVKQ;

KH.S908.1, KGGKFLNFLKKAAKVGAKVGMAALG;

KH.S921.1, KLKTWPKNYWRKVWSKKNWRKFVKKFKHW;

KH.S930.2, AERLMRKAAKDHWSNKMAKDVIWWEQ;

KH.S1007.2, FGRRRRVPGRRRRWWNERAMNEI.

Antimicrobial activities of the peptides were measured as described previously50. Synthetic peptides were added to the microbial suspension in the individual wells of a microplate at final concentrations of 3.125, 6.25, 12.5, and 25 μM. The relative activities (RA) were calculated by the equation RA = ((APC − ANC)  − ASA)/(APC − ANC), where APC, ANC, and ASA represent the absorbance of positive control, negative control, and samples, respectively. The bacteria and yeast strains used were Escherichia coli (NBRC14237), Staphylococcus aureus (NBRC12732), Pseudomonas aeruginosa (NBRC12582), and Saccharomyces cerevisiae (NBRC10217), which were purchased from Biological Resource Center, National Institute of Technology and Evaluation (NBRC, Tokyo, Japan). The interaction between Ciona LCAMPs and membrane interface was predicted using AmphipaSeek server (https://npsa-pbil.ibcp.fr/cgi-bin/npsa_automat.pl?page=/NPSA/npsa_amphipaseek.html)28.

Hemocyte collection and stimulation

Ciona adults were provided by the Maizuru Fisheries Research Station of Kyoto University and by the Misaki Marine Biological Station of the University of Tokyo through the National BioResource Project of MEXT, Japan.

The animals were bled by removal of the tunic and puncture of the heart, and washed with sterile Ca2+- and Mg2+-free artificial seawater (CMF-ASW; 463 mM NaCl, 11 mM KCl, 25.5 mM Na2SO4, 2.15 mM NaHCO3, 5 mM HEPES (pH 8.0), 5 mM EDTA). The coelomic fluid (hemolymph) and wash solution were collected and filtered through a nylon net. After centrifugation at 1,000×g for 30 s, the hemocyte pellet was washed with CMF-ASW and resuspended in CMF-ASW. Coelomic fluid was further centrifuged and the resulting supernatant (hemolymph) was used for the cultivation of hemocytes.

Hemocytes were plated in a 24-well plate and cultured at 16 °C in filtered seawater containing 20% hemolymph in the presence of penicillin (final concentration of 50 units/mL) and streptomycin (final concentration of 50 μg/mL). After incubation for 36 h, the cells were cultured in 20% hemolymph/seawater without antibiotics and then stimulated with 0.1 mg/mL LPS from E.coli (Sigma-Aldrich, St. Louis, MO, USA) for 1 h at 16 °C.

Reverse transcription-polymerase chain reaction (RT-PCR) analysis

Total RNA was extracted from uninduced and LPS-induced cells and was reverse transcribed using PrimeScript RT reagent Kit (TAKARA Bio Inc., Shiga, Japan) with oligo dT primer. The primers used in this study are mentioned in Supplementary Table S2. PCR cycles were as follows: initial denaturation at 94 °C for 2 min; 35 or 40 cycles at 94 °C for 30 s, 48 °C for 30 s, and 68 °C for 30 s. EF1α (elongation factor 1α) and PPIA (peptidylprolyl isomerase A) were used as internal control for RT-PCR analyses. The PCR products were separated by electrophoresis on 2% agarose gel and stained with ethidium bromide.

Supplementary information

Acknowledgements

We thank Dr. Reiko Yoshida, Dr. Satoe Aratake, and other members working under the National BioResource Project (MEXT, Japan) for providing experimental animals and Dr. Satoshi Ueno for his technical help on this project. This work was supported by a grant from National Institute of Advanced Industrial Science and Technology.

Abbreviations

LCAMP

Linear cationic α-helical antimicrobial peptide

MIC

Minimum inhibitory concentration

LPS

Lipopolysaccharide

EF1α

Elongation factor 1α

PPIA

Peptidylprolyl isomerase A

Author contributions

Y.O. and H.I. designed and performed the experiments, and wrote the paper.

Competing interests

The authors declare no competing interests.

Footnotes

Publisher's note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

Contributor Information

Yukio Ohtsuka, Email: y-ohtsuka@aist.go.jp.

Hidetoshi Inagaki, Email: h-inagaki@aist.go.jp.

Supplementary information

is available for this paper at 10.1038/s41598-020-69485-y.

References

  • 1.Bulet P, Stocklin R, Menin L. Anti-microbial peptides: From invertebrates to vertebrates. Immunol. Rev. 2004;198:169–184. doi: 10.1111/j.0105-2896.2004.0124.x. [DOI] [PubMed] [Google Scholar]
  • 2.Zasloff M. Antimicrobial peptides of multicellular organisms. Nature. 2002;415:389–395. doi: 10.1038/415389a. [DOI] [PubMed] [Google Scholar]
  • 3.Boman HG. Antibacterial peptides: Basic facts and emerging concepts. J. Intern. Med. 2003;254:197–215. doi: 10.1046/j.1365-2796.2003.01228.x. [DOI] [PubMed] [Google Scholar]
  • 4.Waghu FH, Barai RS, Gurung P, Idicula-Thomas S. CAMPR3: A database on sequences, structures and signatures of antimicrobial peptides. Nucleic Acids Res. 2016;44:D1094–1097. doi: 10.1093/nar/gkv1051. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Wang G, Li X, Wang Z. APD3: The antimicrobial peptide database as a tool for research and education. Nucleic Acids Res. 2016;44:D1087–1093. doi: 10.1093/nar/gkv1278. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 6.Hoskin DW, Ramamoorthy A. Studies on anticancer activities of antimicrobial peptides. Biochim. Biophys. Acta. 2008;1778:357–375. doi: 10.1016/j.bbamem.2007.11.008. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 7.Jenssen H, Hamill P, Hancock RE. Peptide antimicrobial agents. Clin. Microbiol. Rev. 2006;19:491–511. doi: 10.1128/CMR.00056-05. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 8.Marr AK, Gooderham WJ, Hancock RE. Antibacterial peptides for therapeutic use: Obstacles and realistic outlook. Curr. Opin. Pharmacol. 2006;6:468–472. doi: 10.1016/j.coph.2006.04.006. [DOI] [PubMed] [Google Scholar]
  • 9.Ge Y, et al. In vitro antibacterial properties of pexiganan, an analog of magainin. Antimicrob. Agents. Chemother. 1999;43:782–788. doi: 10.1128/aac.43.4.782. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Ammerman JW, Fuhrman JA, Hagstrom A, Azam F. Bacterioplankton growth in seawater: I. Growth kinetics and cellular characteristics in seawater cultures. Mar. Ecol. Prog. Ser. 1984;18:31–39. [Google Scholar]
  • 11.Kang HK, Seo CH, Park Y. Marine peptides and their anti-infective activities. Mar. Drugs. 2015;13:618–654. doi: 10.3390/md13010618. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 12.Charlet M, et al. Innate immunity. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis. J. Biol. Chem. 1996;271:21808–21813. doi: 10.1074/jbc.271.36.21808. [DOI] [PubMed] [Google Scholar]
  • 13.Leoni G, et al. Myticalins: A novel multigenic family of linear, cationic antimicrobial peptides from marine mussels (Mytilus spp.) Mar. Drugs. 2017;15:20. doi: 10.3390/md15080261. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 14.Dehal P, et al. The draft genome of Ciona intestinalis: Insights into chordate and vertebrate origins. Science. 2002;298:2157–2167. doi: 10.1126/science.1080049. [DOI] [PubMed] [Google Scholar]
  • 15.Brozovic M, et al. ANISEED 2015: A digital framework for the comparative developmental biology of ascidians. Nucleic Acids Res. 2016;44:D808–818. doi: 10.1093/nar/gkv966. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 16.Satou Y, et al. Improved genome assembly and evidence-based global gene model set for the chordate Ciona intestinalis: New insight into intron and operon populations. Genome Biol. 2008;9:R152. doi: 10.1186/gb-2008-9-10-r152. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 17.Parrinello N, Cammarata M, Parrinello D. In: Advances in Comparative Immunology. Cooper EL, editor. Berlin: Springer; 2018. pp. 521–590. [Google Scholar]
  • 18.Azumi K, et al. Genomic analysis of immunity in a Urochordate and the emergence of the vertebrate immune system: "Waiting for Godot". Immunogenetics. 2003;55:570–581. doi: 10.1007/s00251-003-0606-5. [DOI] [PubMed] [Google Scholar]
  • 19.Fedders H, Leippe M. A reverse search for antimicrobial peptides in Ciona intestinalis: Identification of a gene family expressed in hemocytes and evaluation of activity. Dev. Comp. Immunol. 2008;32:286–298. doi: 10.1016/j.dci.2007.06.003. [DOI] [PubMed] [Google Scholar]
  • 20.Fedders H, Michalek M, Grotzinger J, Leippe M. An exceptional salt-tolerant antimicrobial peptide derived from a novel gene family of haemocytes of the marine invertebrate Ciona intestinalis. Biochem. J. 2008;416:65–75. doi: 10.1042/BJ20080398. [DOI] [PubMed] [Google Scholar]
  • 21.Torrent M, Andreu D, Nogues VM, Boix E. Connecting peptide physicochemical and antimicrobial properties by a rational prediction model. PLoS One. 2011;6:e16968. doi: 10.1371/journal.pone.0016968. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 22.Roelants K, et al. Origin and functional diversification of an amphibian defense peptide arsenal. PLoS Genet. 2013;9:e1003662. doi: 10.1371/journal.pgen.1003662. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Vanhoye D, Bruston F, Nicolas P, Amiche M. Antimicrobial peptides from hylid and ranin frogs originated from a 150-million-year-old ancestral precursor with a conserved signal peptide but a hypermutable antimicrobial domain. Eur. J. Biochem. 2003;270:2068–2081. doi: 10.1046/j.1432-1033.2003.03584.x. [DOI] [PubMed] [Google Scholar]
  • 24.Deslouches B, et al. De novo generation of cationic antimicrobial peptides: Influence of length and tryptophan substitution on antimicrobial activity. Antimicrob. Agents Chemother. 2005;49:316–322. doi: 10.1128/AAC.49.1.316-322.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 25.Friedrich C, Scott MG, Karunaratne N, Yan H, Hancock RE. Salt-resistant alpha-helical cationic antimicrobial peptides. Antimicrob. Agents Chemother. 1999;43:1542–1548. doi: 10.1128/aac.43.7.1542. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Park IY, et al. Helix stability confers salt resistance upon helical antimicrobial peptides. J. Biol. Chem. 2004;279:13896–13901. doi: 10.1074/jbc.M311418200. [DOI] [PubMed] [Google Scholar]
  • 27.Rydlo T, Rotem S, Mor A. Antibacterial properties of dermaseptin S4 derivatives under extreme incubation conditions. Antimicrob. Agents Chemother. 2006;50:490–497. doi: 10.1128/AAC.50.2.490-497.2006. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 28.Sapay N, Guermeur Y, Deleage G. Prediction of amphipathic in-plane membrane anchors in monotopic proteins using a SVM classifier. BMC Bioinform. 2006;7:255. doi: 10.1186/1471-2105-7-255. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 29.Baldwin AS., Jr The NF-kappa B and I kappa B proteins: New discoveries and insights. Annu. Rev. Immunol. 1996;14:649–683. doi: 10.1146/annurev.immunol.14.1.649. [DOI] [PubMed] [Google Scholar]
  • 30.Lynn DJ, et al. Bioinformatic discovery and initial characterisation of nine novel antimicrobial peptide genes in the chicken. Immunogenetics. 2004;56:170–177. doi: 10.1007/s00251-004-0675-0. [DOI] [PubMed] [Google Scholar]
  • 31.Schutte BC, et al. Discovery of five conserved beta-defensin gene clusters using a computational search strategy. Proc. Natl. Acad. Sci. USA. 2002;99:2129–2133. doi: 10.1073/pnas.042692699. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Silverstein KA, Graham MA, Paape TD, VandenBosch KA. Genome organization of more than 300 defensin-like genes in Arabidopsis. Plant Physiol. 2005;138:600–610. doi: 10.1104/pp.105.060079. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Nicolas P, Vanhoye D, Amiche M. Molecular strategies in biological evolution of antimicrobial peptides. Peptides. 2003;24:1669–1680. doi: 10.1016/j.peptides.2003.08.017. [DOI] [PubMed] [Google Scholar]
  • 34.Novkovic M, Simunic J, Bojovic V, Tossi A, Juretic D. DADP: The database of anuran defense peptides. Bioinformatics. 2012;28:1406–1407. doi: 10.1093/bioinformatics/bts141. [DOI] [PubMed] [Google Scholar]
  • 35.Tincu JA, Taylor SW. Antimicrobial peptides from marine invertebrates. Antimicrob. Agents Chemother. 2004;48:3645–3654. doi: 10.1128/AAC.48.10.3645-3654.2004. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Zhao C, Liaw L, Lee IH, Lehrer RI. cDNA cloning of Clavanins: Antimicrobial peptides of tunicate hemocytes. FEBS Lett. 1997;410:490–492. doi: 10.1016/s0014-5793(97)00646-7. [DOI] [PubMed] [Google Scholar]
  • 37.Zhao C, Liaw L, Lee IH, Lehrer RI. cDNA cloning of three cecropin-like antimicrobial peptides (Styelins) from the tunicate, Styela clava. FEBS Lett. 1997;412:144–148. doi: 10.1016/s0014-5793(97)00769-2. [DOI] [PubMed] [Google Scholar]
  • 38.Mohanram H, Bhattacharjya S. Salt-resistant short antimicrobial peptides. Biopolymers. 2016;106:345–356. doi: 10.1002/bip.22819. [DOI] [PubMed] [Google Scholar]
  • 39.Sperstad SV, et al. Antimicrobial peptides from marine invertebrates: Challenges and perspectives in marine antimicrobial peptide discovery. Biotechnol. Adv. 2011;29:519–530. doi: 10.1016/j.biotechadv.2011.05.021. [DOI] [PubMed] [Google Scholar]
  • 40.Shai Y. Mechanism of the binding, insertion and destabilization of phospholipid bilayer membranes by alpha-helical antimicrobial and cell non-selective membrane-lytic peptides. Biochim. Biophys. Acta. 1999;1462:55–70. doi: 10.1016/s0005-2736(99)00200-x. [DOI] [PubMed] [Google Scholar]
  • 41.Satou Y, Kawashima T, Shoguchi E, Nakayama A, Satoh N. An integrated database of the ascidian, Ciona intestinalis: Towards functional genomics. Zool. Sci. 2005;22:837–843. doi: 10.2108/zsj.22.837. [DOI] [PubMed] [Google Scholar]
  • 42.Karimi K, et al. Xenbase: A genomic, epigenomic and transcriptomic model organism database. Nucleic Acids Res. 2018;46:D861–D868. doi: 10.1093/nar/gkx936. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 43.Petersen TN, Brunak S, von Heijne G, Nielsen H. SignalP 4.0: Discriminating signal peptides from transmembrane regions. Nat. Methods. 2011;8:785–786. doi: 10.1038/nmeth.1701. [DOI] [PubMed] [Google Scholar]
  • 44.Moller S, Croning MD, Apweiler R. Evaluation of methods for the prediction of membrane spanning regions. Bioinformatics. 2001;17:646–653. doi: 10.1093/bioinformatics/17.7.646. [DOI] [PubMed] [Google Scholar]
  • 45.Gautier R, Douguet D, Antonny B, Drin G. HELIQUEST: A web server to screen sequences with specific alpha-helical properties. Bioinformatics. 2008;24:2101–2102. doi: 10.1093/bioinformatics/btn392. [DOI] [PubMed] [Google Scholar]
  • 46.Montgomerie S, Sundararaj S, Gallin WJ, Wishart DS. Improving the accuracy of protein secondary structure prediction using structural alignment. BMC Bioinform. 2006;7:301. doi: 10.1186/1471-2105-7-301. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 47.Conchillo-Sole O, et al. AGGRESCAN: A server for the prediction and evaluation of "hot spots" of aggregation in polypeptides. BMC Bioinform. 2007;8:65. doi: 10.1186/1471-2105-8-65. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 48.Almagro Armenteros JJ, Sonderby CK, Sonderby SK, Nielsen H, Winther O. DeepLoc: Prediction of protein subcellular localization using deep learning. Bioinformatics. 2017;33:3387–3395. doi: 10.1093/bioinformatics/btx431. [DOI] [PubMed] [Google Scholar]
  • 49.Kel AE, et al. MATCH: A tool for searching transcription factor binding sites in DNA sequences. Nucleic Acids Res. 2003;31:3576–3579. doi: 10.1093/nar/gkg585. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 50.Steinberg DA, Lehrer RI. Designer assays for antimicrobial peptides. Disputing the "one-size-fits-all" theory. Methods Mol. Biol. 1997;78:169–186. doi: 10.1385/0-89603-408-9:169. [DOI] [PubMed] [Google Scholar]

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials


Articles from Scientific Reports are provided here courtesy of Nature Publishing Group

RESOURCES