Skip to main content
Scientific Reports logoLink to Scientific Reports
. 2021 Apr 29;11:9301. doi: 10.1038/s41598-021-88902-4

Theileria equi claudin like apicomplexan microneme protein contains neutralization-sensitive epitopes and interacts with components of the equine erythrocyte membrane skeleton

Cynthia K Onzere 1,, Lindsay M Fry 1,2, Richard P Bishop 1, Marta G Silva 1, Reginaldo G Bastos 1, Donald P Knowles 1,#, Carlos E Suarez 1,2,✉,#
PMCID: PMC8085155  PMID: 33927329

Abstract

Theileria equi is a widely distributed apicomplexan parasite that causes severe hemolytic anemia in equid species. There is currently no effective vaccine for control of the parasite and understanding the mechanism that T. equi utilizes to invade host cells may be crucial for vaccine development. Unlike most apicomplexan species studied to date, the role of micronemes in T. equi invasion of host cells is unknown. We therefore assessed the role of the T. equi claudin-like apicomplexan microneme protein (CLAMP) in the invasion of equine erythrocytes as a first step towards understanding the role of this organelle in the parasite. Our findings show that CLAMP is expressed in the merozoite and intra-erythrocytic developmental stages of T. equi and in vitro neutralization experiments suggest that the protein is involved in erythrocyte invasion. Proteomic analyses indicate that CLAMP interacts with the equine erythrocyte α-and β- spectrin chains in the initial stages of T. equi invasion and maintains these interactions while also associating with the anion-exchange protein, tropomyosin 3, band 4.1 and cytoplasmic actin 1 after invasion. Additionally, serological analyses show that T. equi-infected horses mount robust antibody responses against CLAMP indicating that the protein is immunogenic and therefore represents a potential vaccine candidate.

Subject terms: Parasitic infection, Proteomic analysis, Confocal microscopy, Antibody generation, ELISA, Immunoblotting, Immunoprecipitation, Cell culture, Flow cytometry, Reverse transcription polymerase chain reaction, Electrophoresis, Mass spectrometry

Introduction

Theileria equi is an obligate intracellular apicomplexan protist that invades both leukocytes and erythrocytes in mammalian hosts, and causes severe anemia in infected equids, with mortality in some cases1. Unfortunately, recovered animals remain persistently infected and are involved in the dynamics of parasite transmission2. T. equi can be transmitted by multiple ixodidae tick species that thrive in tropical, sub-tropical and temperate climates1,3, making control of the global spread of the parasite difficult. Unfortunately, there is of yet no vaccine available for control of T. equi and understanding the mechanism that the parasite uses to enter host cells is central to development of an effective vaccine.

T. equi is classified within the phylum Apicomplexa due to the presence of secretory organelles on the anterior end of the parasite that are essential for invasion of host cells47. Key among these organelles are the rod-shaped micronemes, whose contents are first to be discharged following mobilization of intracellular calcium stores8, facilitating irreversible attachment of apicomplexan parasites to host cells during invasion6,9. Studies have demonstrated a direct link between the number of micronemes and parasite motility and invasion efficacy, since invasive stages of apicomplexan parasites with higher number of micronemes displayed enhanced motility and robust active cell entry10 compared to those without, or with fewer, micronemes9,11.

Unlike most apicomplexan species, transforming Theileria spp. developmental stages that invade mammalian cells lack micronemes and are therefore immotile11,12. Theileria parva (T. parva) sporozoites and merozoites for instance interact with host cells by chance and attach irreversibly before utilizing a zippering mechanism to invade the cells passively and in any orientation12. By contrast, the non-transforming T. equi sporozoites and merozoites contain micronemes13. This indicates that the parasite may be motile and utilizes microneme contents to attach to and invade host cells. Unfortunately, this is yet to be ascertained because no studies have been conducted to investigate functional roles of microneme proteins and the mechanism that T. equi utilizes to enter host cells.

To clarify this issue, we assessed the role of the claudin-like apicomplexan microneme protein (CLAMP) in invasion of equine erythrocytes, as a first step in dissecting the function of T. equi micronemes in host cell invasion. CLAMP was recently identified as an indispensable conserved apicomplexan protein (ICAP) that is conserved in sequence and synteny among apicomplexan species14. The study demonstrated that conditional knockdown of the clamp gene in Toxoplasma gondii and Plasmodium falciparum resulted in abrogation of host cell invasion, indicating functional importance of the protein in these species14. We hypothesized that like P. falciparum and T. gondii, T. equi expresses CLAMP and uses it during the invasion of equine erythrocytes. The results emerging from this study are consistent with the hypothesis and indicate that CLAMP plays a role in invasion of equine erythrocytes and interacts with key erythrocyte membrane skeleton proteins likely as part of the mechanism of invasion and establishment of the parasite within the cell. The findings also show that CLAMP is considerably immunogenic and is therefore a suitable target for vaccine development.

Results

T. equi CLAMP is predicted to be an integral membrane protein

In silico prediction of CLAMP’s transmembrane topology was performed to determine the likelihood that the protein can be recognized by equine immune response components during T. equi infection. Phobius (http://phobius.sbc.su.se/) was used to predict CLAMP’s transmembrane profile and Protter15 was used to visualize the output. The results showed that T. equi CLAMP is likely an integral membrane protein, containing four transmembrane and two extracellular domains (Fig. 1a). In silico B cell epitope mapping was performed for detection of antigenic determinants on CLAMP, and this led to the identification of three potentially immunogenic regions that map onto the two extracellular loops of the protein. Three synthetic peptides representing the regions of the protein that contain predicted B-cell epitopes (Fig. 1a) were synthesized and used to immunize rabbits for development of the polyclonal anti-CLAMP antibody that was used for downstream analyses.

Figure 1.

Figure 1

T. equi CLAMP contains immunogenic epitopes, and the gene is transcribed and expressed by T. equi merozoites. (a) CLAMP’s transmembrane topology as predicted and annotated by Phobius and Protter algorithms, respectively. Peptides 1, 2 and 3 indicate the protein’s predicted immunogenic peptides. (b) A 1% agarose gel showing amplified clamp transcript at ~ 1226 bp. The T. equi equine merozoite antigen-1 (ema-1) transcript was amplified as a positive control, and rt- (negative control) represents amplified merozoites’ RNA without addition of reverse transcriptase. L indicates the Thermo Scientific GeneRuler 1 kb DNA Ladder. (c) Immunoblot showing CLAMP expressed by T. equi merozoites (test) at ~ 39 kDa. Probing of merozoites lysate with pre-immunization serum and the polyclonal anti-RAP-1a antibody were used as negative control (NC) and positive control (PC) respectively. L represents the ProteinSimple Wes Ladder.

The clamp gene is transcribed, and the protein expressed in merozoites and intra-erythrocytic stages of T. equi development

RNA was extracted from T. equi merozoites and reverse transcription, cDNA amplification, agarose gel analysis, gel purification and sequencing were performed to assess transcription of the clamp gene in the parasite. The results showed that transcription of the gene occurs in merozoites as indicated by the presence of an amplicon of approximately 1226 bp in size (Fig. 1b). Sequencing confirmed that the cDNA amplicon sequence was identical to that available in GenBank (accession number: BEWA_005470).

Immunoblotting was then performed to determine whether merozoites express CLAMP. A T. equi merozoite lysate was used as antigen, and the rabbit polyclonal anti-CLAMP antibody developed against the three immunogenic synthetic peptides (Fig. 1a) was used as the primary antibody. The pre-immunization serum and the polyclonal anti-RAP-1a antibody that targets RAP-1a (~ 60 kDa) were used as negative control (NC) and positive control (PC) respectively. The analysis showed that the polyclonal anti-CLAMP antibody recognized a single protein of ~ 39 kDa, which is consistent with the predicted in silico molecular weight of CLAMP (~ 39 kDa), confirming that the protein is expressed by in vitro cultured T. equi merozoites (Fig. 1c).

Indirect immunofluorescence antibody tests (IFAT) were conducted to establish whether CLAMP is expressed on the surface of extracellular T. equi merozoites and the intra-erythrocytic developmental stages, respectively. In the case of extracellular merozoites, the parasites were incubated with the polyclonal anti-CLAMP antibody prior to incubation with the Invitrogen Goat anti-Rabbit IgG (H + L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor Plus 647 and subsequent mounting using the Invitrogen SlowFade Gold Antifade Mountant with DAPI. In the fixed indirect IFAT, fixed slides of T. equi-infected erythrocyte smears were incubated with the polyclonal antibody prior to incubation the fluorescent labeled secondary antibody. The resulting confocal microscopy images are consistent with expression of CLAMP on the cell surface of extracellular merozoites (Fig. 2) and in the intra-erythrocytic developmental stages of the parasite (Fig. 3). Incubation of the extracellular parasites and fixed slides with a monoclonal antibody specific for T. equi EMA-1 and pre-immunization serum were used as positive and negative controls, respectively.

Figure 2.

Figure 2

CLAMP is expressed on the surface of T. equi merozoites. Confocal microscopy images showing expression of CLAMP by extracellular T. equi merozoites. The first row shows expression of CLAMP on the surface of an extracellular merozoite (indicated by an asterisk (*)). The nuclei are stained in blue with DAPI, and CLAMP is stained in magenta. The second row represents merozoites incubated with the pre-immunization serum (negative control (NC)) and shows lack of protein staining indicating that the staining in the first row was CLAMP-specific. The third row shows expression of EMA-1 (positive control (PC)) by merozoites. In all cases, BF refers to brightfield panels.

Figure 3.

Figure 3

CLAMP is expressed in the intra-erythrocytic stages of T. equi development. Confocal microscopy images showing expression of CLAMP in T. equi infected erythrocytes. The first row shows expression of CLAMP by T. equi gamonts. Parasite nuclei are stained in blue with DAPI, and CLAMP is stained in magenta. The second row shows infected erythrocytes incubated with pre-immunization serum (negative control) and it shows lack of staining indicating test specificity. The third row indicates expression of EMA-1 (positive control (PC)) by intra-erythrocytic parasites. In all cases, BF refers to brightfield panels.

CLAMP elicits antibody responses in T. equi infected horses

Serological analysis using an indirect ELISA was performed to determine whether CLAMP elicits antibody responses in T. equi-infected horses. A cocktail of the three synthetic CLAMP peptides containing predicted B-cell epitopes (Fig. 1a) was used as the antigen and sera obtained from five horses i.e., H5, HO-209, HO-168, HO-198 and HO-183 prior to T. equi infection (pre-infection) were used as negative controls. Sera obtained from the horses at 1.5 to 34 months post-infection were used to assess development of antibody responses to CLAMP during T. equi infection. Two-way ANOVA was used for statistical analysis at a significance level (α) of 0.05, and the results showed that the T. equi infected horses developed significant antibody responses against the synthetic peptides that represent predicted B-cell epitopes of CLAMP (Fig. 4).

Figure 4.

Figure 4

CLAMP elicits antibody responses in horses during infection with T. equi. CLAMP-specific antibodies are significantly present in horses after infection with T. equi (post- infection). **p = 0.0014, ***p = 0.0002, ****p < 0.0001.

CLAMP-specific antibodies inhibit invasion of equine erythrocytes by T. equi

An in vitro neutralization assay was performed to determine whether neutralization of CLAMP by specific antibodies prevents T. equi from invading equine erythrocytes. T. equi-infected cells were separately incubated with heat-inactivated pre-immunization serum, post-immunization serum (polyclonal anti-CLAMP antibody) and polyclonal anti-B. bovis HAP-2 antibody. The sera were diluted in T. equi growth medium at 1:10, 1: 20 and 1:40 dilutions. Each dilution was assessed in triplicate, and the cultures were harvested at 24, 48, 72- and 96-h post-infection. Flow cytometry was performed to evaluate the degree of invasion inhibition in the presence of post-immunization and pre-immunization sera relative to infected erythrocytes cultured in the absence of both sera (control). Statistical analysis was performed using two-way ANOVA at a significance level of 0.05, and it was evident that addition of polyclonal anti-CLAMP antibody to the cultures results in significant inhibitory effect on erythrocyte invasion by T. equi over time. Conversely, the pre-immunization serum and polyclonal anti-B. bovis HAP-2 antibody did not significantly inhibit parasite invasion. This indicated that the inhibitory effect was likely specific to the anti-CLAMP antibody (Fig. 5a).

Figure 5.

Figure 5

Polyclonal anti-CLAMP antibody significantly inhibits invasion of equine erythrocytes by T. equi. (a) In vitro neutralization assay data showing invasion inhibition activity of the CLAMP-specific antibody (post-immunization serum), pre-immunization serum and polyclonal anti-B. bovis HAP-2 antibody at different dilutions over time. T. equi infected erythrocytes cultured in the presence of CLAMP-specific antibodies were significantly less parasitized (PPE) compared to parasites cultured in the presence of pre-immunization serum and the polyclonal anti-B. bovis HAP-2 antibody. Control represents T. equi infected red blood cells (iRBC) cultured in the absence of both pre- and post-immunization sera. *p < 0.05, **p < 0.0090. (b) Anti-CLAMP antibodies inhibit a significant percentage of parasites from invading erythrocytes at 72 h post-infection. Percentage inhibition was calculated as the difference between percentage inhibition in the presence of polyclonal anti-CLAMP antibodies (post-immunization serum) and percentage inhibition in the presence of pre-immunization serum. In this regard, anti-CLAMP antibodies in the post-immunization serum inhibited parasite invasion by 41%, 33.4% and 23.3% at 1:10, 1:20 and 1: 40 dilutions, respectively. Factors present in the B. bovis HAP-2 post immunization serum (polyclonal anti-B. bovis HAP-2 antibody) also minimally inhibited invasion.

Percentage inhibition capacity for each dilution of the polyclonal anti-CLAMP antibody was determined at 72 h post T. equi infection because optimum neutralization activity of the antibody was observed at this time point. The results were compared to percentage inhibition in the presence of pre-immunization serum, and the output showed that incubation of T. equi merozoites using the optimal antibody dilution (1:10) inhibited parasite invasion by 85%, while incubation with the pre-immunization serum at the same concentration inhibited invasion by 44% (Fig. 5b). This strongly suggested that serum factors other than CLAMP-specific antibodies may also contribute to invasion inhibition. We therefore concluded that the difference between the two percentages (i.e., 41%) represented the actual percentage inhibition value of CLAMP-specific antibodies at 1:10 dilution. Percentage inhibition analysis showed that the polyclonal anti-B. bovis HAP-2 antibody also minimally inhibited invasion confirming that other factors present in the immune serum may contribute to neutralization of parasite invasion.

Collectively, these findings indicate that CLAMP is involved in invasion of equine erythrocytes.

T. equi CLAMP interacts with components of the equine erythrocyte membrane skeleton

Cross-linking of equine erythrocyte extracellular, intramembrane, and intracellular proteins to T. equi CLAMP was performed prior to co-immunoprecipitation to isolate proteins that interact with CLAMP. SDS-PAGE analysis was performed for detection of CLAMP’s interacting partners, and western blot analysis was conducted to confirm that CLAMP was isolated alongside its interacting partners.

SDS-PAGE analysis showed the presence of two high molecular weight bands (> 250 kDa) after crosslinking with the 3,3´-dithiobis (sulfosuccinimidylpropionate) (DTSSP) crosslinker that targets extracellular proteins (Fig. 6a). Several bands were observed after crosslinking with the dithiobis (succinimidylpropionate) (DSP) crosslinker that targets intramembrane and intracellular proteins (Fig. 6b). Western blot analysis showed the presence of an approximately 39 kDa band confirming that CLAMP was eluted alongside its interacting partners both on the surface and within equine erythrocytes (Fig. 6c).

Figure 6.

Figure 6

T. equi CLAMP interacts with equine erythrocyte proteins. (a,b) show SDS-PAGE gels of proteins (within black boundaries) isolated from the erythrocyte surface (test) and within the cell membrane and cell (test) after crosslinking to CLAMP with DTSSP and DSP, respectively. (c) Represents an immunoblot showing the presence of CLAMP at ~ 39 kDa. In all cases agarose resin eluates were used as negative controls (control/NC). The ~ 15 kDa band on the SDS-PAGE gels indicate non-specific binding of the equine α- and β-hemoglobin subunits to the Thermo Scientific AminoLink (test) and agarose (control) coupling resins.

Nano LC–MS/MS was performed to identify the equine erythrocyte proteins that interact with CLAMP. The resultant data revealed that the protein interacts with key components of the equine erythrocyte membrane skeleton16 including the α- and β- spectrin chains, anion-exchange protein, band 4.1, cytoplasmic actin 1 and tropomyosin 3 (Table 1 and Supplementary Table 1).

Table 1.

CLAMP interacts with components of the erythrocyte membrane skeleton in the inner cell membrane of equine erythrocytes.

Crosslinker Protein ID Uniprot accession number Molecular weight (KDa) Erythrocyte compartment
DTSSP Spectrin alpha, erythrocytic 1 F6ZK25 280.9 Inner cell membrane
Spectrin beta chain F6SIV4 268.2
DSP Spectrin alpha, erythrocytic 1 F6ZK25 280.9
Spectrin beta chain F6SIV4 268.2
Anion—exchange protein Q2Z1P9 104.2
Band 4.1 A0A3Q2H952 110.4
Actin, cytoplasmic 1 F6T3Y8 41.9
Tropomyosin 3 A0A5F5PGV6 28.9

Discussion

The prediction of B-cell epitopes on the extracellular loops of T. equi CLAMP suggested that the protein is expressed on the cell surface. This in silico prediction suggests that CLAMP could be a microneme-specific protein that is translocated to the cell surface rendering it possible for it to be recognized by protective equine immune responses during T. equi infection. This was consistent with the production of robust CLAMP-specific antibodies in horses during infection with the parasite, indicating that the protein is immunogenic, and is therefore a suitable candidate for evaluation as a vaccine component.

The indirect immunofluorescence antibody tests further suggests that translocation of CLAMP occurs from the micronemes to the cell surface in extracellular merozoites, and its expression is maintained in the intra-erythrocytic developmental stages. This indicates functional significance of the protein in the parasite. A significant role of T. equi CLAMP in invasion of equine erythrocytes was demonstrated by the in vitro neutralization assay, which showed that CLAMP-specific antibodies significantly inhibit cellular invasion by merozoites. This finding also suggests that the antibodies developed against CLAMP in vivo could also have a neutralizing capacity against T. equi, thus reinforcing the fact that the protein is a viable vaccine candidate and future studies should be focused on testing its potential in vivo.

Investigation of erythrocyte proteins that interact with CLAMP presumably during invasion and establishment of T. equi within the cell led to the isolation and identification of key components of the erythrocyte membrane skeleton that form a complex network in the inner membrane of the cell16. These proteins maintain the structure, shape, durability, stability, and plasticity of the cell membrane16,17. Crosslinking of CLAMP to extracellular erythrocytic proteins led to isolation of the α- and β-spectrin proteins and crosslinking of the protein to intramembrane and intracellular erythrocytic proteins led to the isolation of the spectrin proteins alongside the anion-exchange protein, band 4.1, cytoplasmic actin 1 and tropomyosin 3.

A model emerging from the interpretation of these findings suggest that T. equi merozoites use CLAMP to attach to the α- and β-spectrin proteins in the initial stages of invasion, possibly during the formation of a tight junction between the parasite and the host cell. Once inside the cell, the parasites maintain their association with the spectrin proteins while also interacting with the anion-exchange protein, band 4.1, cytoplasmic actin 1 and tropomyosin 3 (Fig. 7). This observation indicates that like most apicomplexan species, the early stages of T. equi invasion is possibly characterized by attachment and re-orientation of the parasite such that the anterior end is in direct apposition with the host cell6,7. This enables CLAMP to interact with the spectrin proteins in the inner cell membrane and these interactions are maintained post-invasion (Fig. 7). This suggests that T. equi micronemes are involved in the invasion of equine erythrocytes thus implying that the parasites utilize a mechanism that is distinct from that of transforming Theileria spp.12 to enter erythrocytes. Notably, a study conducted by Fawcett et al. showed that T. parva develops micronemes in the tick salivary gland during sporogony18. This indicates that the parasite possibly undergoes morphological changes through the life cycle and microneme-specific proteins could be important in the salivary gland developmental stage. Whether CLAMP is also involved in the invasion of leukocytes by T. equi sporozoites remains unknown.

Figure 7.

Figure 7

Hypothetical model showing the role of T. equi CLAMP in invasion of equine erythrocytes and its interactions with membrane skeleton proteins. (a) T. equi attaches to the equine erythrocyte surface, and (b) reorientates itself such that the apical end is in direct association with the cell membrane. (c) The parasite uses CLAMP (that is possibly translocated from the micronemes to the cell surface) to attach to the α- and β-spectrin proteins during the initial stages of invasion. (d) Once inside the cell, T. equi CLAMP maintains its interactions with the spectrin proteins while also interacting with band 4.1, tropomyosin 3, cytoplasmic actin 1 and anion-exchange protein (AE).

Previous studies have shown that P. falciparum exploits components of the erythrocyte membrane skeleton to maintain itself in infected cells. For instance, the parasite utilizes the ring-infected erythrocyte surface antigen (RESA) that is expressed in the early intra-erythrocytic stages to bind to spectrin19, rendering the cell resistant to thermal stress during febrile conditions20,21 and resilient to mechanical pressure22. The interaction also prevents other parasites from invading parasitized cells thus minimizing the number of P. falciparum in a single cell22. Conversely, the interaction between α-spectrin and the P. falciparum erythrocyte membrane protein 3 (PfEMP3) that is expressed in the late stages of intra-erythrocytic development, leads to disruption of the spectrin-actin-4.1R network rendering the cell susceptible to mechanical pressure23. It is suspected that this interaction contributes to egress of mature merozoites from infected erythrocytes23. Studies have also shown that the cytoplasmic domain of the P. falciparum erythrocyte membrane protein 1 (PfEMP1) interacts with spectrin, actin and the P. falciparum knob-associated histidine-rich protein (KAHRP)24. These interactions anchor PfEMP1 to the erythrocyte membrane allowing it to mediate adhesion of infected erythrocytes to receptors on endothelial cells25. Additionally, Magowan et al. showed that binding of the mature-parasite-infected erythrocyte surface antigen (MESA) to protein 4.1 is crucial for the intra-erythrocytic survival of P. falciparum26.

Collectively, these studies show that the interaction between parasite and host erythrocyte membrane skeleton proteins is important for the survival of P. falciparum in infected erythrocytes, suggesting that this may also be the case for T. equi. Further studies are therefore required to determine whether the role of CLAMP extends beyond the erythrocyte entry process and to ascertain whether it interacts with the entire erythrocyte membrane protein complex or primarily with one of the network of co-immunoprecipitated host proteins.

In conclusion, the immunogenicity of CLAMP and neutralization capacity of CLAMP-specific antibodies suggest that the protein can be explored for development of an effective vaccine against T. equi and other apicomplexan parasites because it is conserved among these species14. Our discovery of the importance of CLAMP, and by implication also micronemes, in the invasion of equine erythrocytes by T. equi provides further evidence that in addition to their intermediate position between Babesia and Theileria, based on comparative genomics27,28, Theileria spp. that only transiently infect host leukocytes without inducing immortalization are also distinct in their cell biology relative to transforming Theileria. The identification of equine erythrocyte proteins that interact with CLAMP highlight dynamics of host-parasite interactions between T. equi and the host cells. Further studies are required to not only establish the significance of these interactions in invasion of erythrocytes and parasite survival, but to also determine how the interactions can be applied in drug discovery studies for the control of T. equi.

Methods

Ethics statement

All animal experiments were approved by the Institutional Animal Care and Use Protocol Committees of the Pacific Immunology Corporation, CA, USA (protocol #11/11/19. Ref. SOP-1) and the University of Idaho, ID, USA (protocol #2010-54). The procedures were performed according to the U.S. National Institutes of Health (NIH) Guide for the Care and Use of Laboratory Animals and the ARRIVE guidelines and regulations.

Experimental animals

Four New Zealand white rabbits (14481, 14482, 14483 and 14484) and five Welsh cross horses (H5, Te0018 (HO-168), HO-198, HO-209 and HO-183).

Parasite

The T. equi Florida strain was used in the experiments described herein.

In silico analysis

The T. equi CLAMP amino acid sequence (accession number: BEWA_005470) was retrieved from GenBank. Phobius (http://phobius.sbc.su.se/) was used to predict the protein’s transmembrane topology and Protter15 was used for visualization and annotation of the transmembrane profile. B cell epitope mapping was performed using a proprietary suite of 20 separate predictive algorithms available at Pacific Immunology Corporation. This led to the identification of three immunogenic peptides i.e. peptide 1 (SERVNHIKTKGYLAIQNSAQNQKGNFNNLFVNEC), peptide 2 (DRFTHEMWKIAC) and peptide 3 (RQQMIPFPYLSYC) that map onto positions 103–136, 208–219 and 220–232 of the CLAMP amino acid sequence, respectively. The peptides were synthesized by Pacific Immunology Corporation.

Generation of T. equi-infected erythrocyte cultures and isolation of extracellular merozoites

T. equi-infected erythrocyte cultures were set up in five 25 cm2 Corning cell culture flasks and maintained as previously described29 until a parasitemia of ~ 10% was attained. To isolate extracellular merozoites, the infected cell cultures were centrifuged at 650xg for 10 min to pellet erythrocytes. The supernatant was obtained and spun at 2800xg for 30 min at 10 °C to pellet merozoites. The parasites were washed twice with 40 ml of 1X phosphate buffered saline (PBS) (pH7.2) and suspended in 10 ml of the same buffer.

Transcriptional analysis of the clamp gene in T. equi merozoites

RNA was extracted from T. equi merozoites using the Qiagen RNeasy Mini Kit (Qiagen, Hilden, Germany) in compliance with the manufacturer’s instructions. Residual DNA was removed using the Invitrogen DNase I, Amplification Grade Kit (Thermo Fisher Scientific, Waltham, MA) and cDNA synthesis was performed using the Invitrogen SuperScript III First-Strand Synthesis System in accordance with the manufacturer’s instructions. Amplification of the transcript was performed using the Invitrogen Platinum SuperFi DNA Polymerase with specific primers (clamp fwd; 5′-GTA TAC ACA GAT AAG CCA TAA ATA ATC GTG-3′ and clamp rev; 5′-TCA AAA CTG GAA GTT ACG TGC C-3spp′). The PCR conditions used were as follows; initial denaturation at 98 °C for 30 s, 40 cycles of denaturation at 98 °C for 10 s, annealing at 57.6 °C for 30 s and extension at 72 °C for 90 s. Final extension was conducted at 72 °C for 10 min and transcription of the clamp gene was visualized using a 1% agarose gel. The Qiagen QIAquick Gel Extraction Kit was used to clean-up the amplified transcript in accordance with the manufacturer’s instructions and Sanger sequencing was performed to confirm the integrity of the amplicon. Amplification of the equine merozoite antigen-1 (ema-1) transcript as previously described30 was used as a positive control, and amplification of RNA without addition of reverse transcriptase was used as a negative control.

Evaluation of expression of CLAMP in merozoites and intra-erythrocytic stages of T. equi development

Development of polyclonal antibody against synthetic CLAMP peptides

The polyclonal anti-CLAMP antibody was produced by Pacific Immunology Corporation (Pacific Immunology, Ramona, CA). Briefly, 5 ml of serum (pre-immunization serum) was obtained from each of the New Zealand white rabbits prior to immunization with 1 mg/ml of synthetic CLAMP peptides conjugated to the keyhole limpet hemocyanin (KLH) carrier protein. The peptide conjugates were mixed with the Pacific Immunology AdjuLite Freund’s complete adjuvant at a 1:1 ratio. Rabbits 14481 and 14482 were immunized with peptide 1 and rabbits 14483 and 14484 were co-immunized with peptides 2 and 3. Three subsequent immunizations were performed at a 21-day interval, with the synthetic peptide conjugates mixed with the Pacific Immunology AdjuLite Freund’s incomplete adjuvant at a 1:1 ratio. 25 ml of serum was collected from the rabbits at 49- and 63-days post-initial immunization and at 7- and 21-days post-final boost to assess antibody responses. The rabbits were euthanized at 31 days post-final boost, and serum containing the polyclonal antibody was obtained from the individual rabbits and pooled for downstream analysis.

Assessment of the expression of CLAMP in extracellular T. equi merozoites

Immunoblotting was performed to evaluate expression of CLAMP in extracellular T. equi merozoites. The ProteinSimple Wes Kit (ProteinSimple, San Jose, CA) was used to conduct the analysis in accordance with the manufacturer’s instructions. Merozoite lysate was used as the antigen and the rabbit polyclonal anti-CLAMP antibody was used as a primary antibody at 1:100 dilution. The KPL affinity purified peroxidase labeled Goat anti-Rabbit IgG (H + L) antibody (Seracare Life Sciences, Milford, MA) was used as a secondary antibody at 1: 500 dilution. In the case of negative and positive controls, merozoite lysates were used as the antigen and pre-immunization serum and the polyclonal anti-RAP-1a antibody were used as primary antibodies at 1:100 and 1:250 dilutions, respectively. A chemiluminescent detection method using luminol and peroxide was used for band detection, and the Simple Western Wes capillary-based immunoassay platform (ProteinSimple, San Jose, CA) was used to perform the protein separation. The Compass software was then used for detection and output analysis.

An indirect immunofluorescence antibody test with subsequent fixation and permeabilization was performed to confirm that CLAMP is expressed on the surface of T. equi as predicted by in silico analysis. Briefly, 6-CFDA staining was performed as previously described31 for viability assessment and quantification of the extracellular merozoites. 1 ml of 1X PBS containing viable 2.5 × 108 merozoites was then pipetted into three 1.5 ml Eppendorf tubes. The tubes were spun at 3000xg for 5 min to pellet the parasites. The merozoites were obtained and incubated with 10% bovine serum albumin (BSA) in 1X PBS (blocking buffer) at room temperature for 15 min. The parasites were pelleted and washed twice using 500 µl of 1XPBS prior to being incubated with the polyclonal anti-CLAMP antibody diluted in the blocking buffer at 1:100 (test sample). Monoclonal anti-EMA-1 antibody and the pre-immunization serum were used as positive and negative controls at 1:200 and 1:100 dilutions, respectively. Incubation was performed at 37 °C for 30 min and the parasites were spun and washed thrice prior to incubation with fluorescent-labeled secondary antibodies. The test sample and negative control were incubated with the Invitrogen Goat anti-Rabbit IgG (H + L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor Plus 647 and the positive control was incubated with Invitrogen Goat anti-Mouse IgG (H + L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor 594. Both antibodies were diluted in the blocking buffer at 1:200 and incubation was performed at 37 °C for 30 min prior to being pelleted once more and washed thrice. The merozoites were suspended in 50 µl of 1X PBS and 10 µl of the suspensions from each of the Eppendorf tubes were transferred onto respective wells of a 12-well teflon printed diagnostic microscopic slide. The slide was air-dried and fixed using ice cold acetone and methanol as previously described32. It was then air-dried, and mounting was performed using the Invitrogen SlowFade Gold Antifade Mountant with DAPI. A coverslip was used to cover the slide and confocal microscopy was performed using the Leica microsystems SP8-X white light pulsed laser point scanner with lightning confocal microscope (Leica Microsystems Inc., Buffalo Grove, IL) and the data was collected using the Leica Application Suite X (LAS X) software.

Evaluation of the localization and expression of CLAMP in T. equi’s intra-erythrocytic developmental stages

The indirect fixed immunofluorescence antibody test was performed to assess expression of CLAMP in the intra-erythrocytic stages of T. equi development. Briefly, infected erythrocyte smears were permeabilized and fixed using ice cold acetone and methanol at equal ratios as previously described32. The slides were air dried and blocked with 200 µl of the blocking buffer for 15 min at 37 °C in a wet chamber prior to being washed twice with 1X PBS. 200 µl of the polyclonal anti-CLAMP antibody diluted in the blocking buffer at 1:10 dilution was pipetted onto one of the slides (test slide). 1:10 and 1:50 dilutions of the pre-immunization serum and monoclonal anti-EMA-1 antibody were used as negative and positive controls, respectively. The slides were incubated at 37° C for 30 min prior to being washed twice with 1X PBS. The test and negative control slides were then incubated with 200 µl of the Invitrogen Goat anti-Rabbit IgG (H + L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor Plus 647 diluted in the blocking buffer at 1:200. The positive control was incubated with 200 µl of the Invitrogen Goat anti-Mouse IgG (H + L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor 594 diluted at 1:200. The three slides were incubated at 37 °C for 30 min prior to being washed twice using 1X PBS. They were then air-dried, and the Invitrogen SlowFade Gold Antifade Mountant with DAPI was used for mounting. Evaluation of the localization and expression of CLAMP was performed using the Leica microsystems SP8-X white light pulsed laser point scanner with lightning confocal microscope and LAS X software was used for data acquisition.

Assessment of antibody responses to CLAMP in T. equi infected horses

Indirect ELISA was conducted to determine whether CLAMP elicits antibody responses in T. equi infected horses. Horse sera obtained from previous studies were used in this analysis. This included sera from horses H533, Te0018 (HO-168)34 and HO-198, HO-209 & HO-18335 that were collected prior to T. equi infection and at 34, 14, 11, 1.5 and 18 months post-infection respectively. Briefly, two 96-well Thermo Scientific Nunc, Immulon plates (Thermo Fisher Scientific, Waltham, MA) were labeled as pre- and post-infection plates. The wells were then coated with 100 µl/ well of the combined CLAMP synthetic peptides diluted in 0.05 M carbonate-bicarbonate (Na2CO3-NaHCO3) buffer (pH 9.6) to final concentrations of 0.05 mg/ml each. Coating was performed in triplicates and the plates were incubated overnight at 4 °C. They were then washed once using 0.05% tween 20 diluted in 1X PBS (wash buffer) and blocked with 200 µl of 20% skimmed milk diluted in the wash buffer at room temperature for 1 h. The blocking buffer was discarded and 75 µl of the pre- and post-infection sera diluted in 0.3% BSA (diluted in the wash buffer) were pipetted into wells of the respective plates at 1:100 dilution. The plates were incubated at room temperature for one hour prior to being washed four times. 100 µl of the KPL affinity purified peroxidase labeled goat anti-Rabbit IgG (H + L) antibody diluted in the dilution buffer at 1:10,000 was pipetted into the wells, and the plates were incubated at room temperature for one hour. The wells were then washed four times and 100 µl of the Thermo Scientific 1-Step Ultra TMB-ELISA substrate solution was added to each well. Incubation was performed at room temperature for 15 min prior to addition of 100 µl of 2 M sulfuric acid to stop the reaction. The SpectraMax 190 microplate reader (Molecular Devices, San Jose, CA) was used to measure the absorbance of each well at 450 nm. Cut-off was calculated using the formula: mean (of the pre-infection serum) + 3*SD (of the pre-infection serum)36. Any value above the cut-off was considered to be a true positive. Two-way ANOVA available in GraphPad Prism 8.4.3 (GraphPad Software, San Diego, CA) was used to perform the statistical analysis at a significance level (α) of 0.05.

Evaluation of the role of T. equi CLAMP in the invasion of equine erythrocytes

The in vitro neutralization assay was performed to determine whether T. equi utilizes CLAMP to invade host cells. Briefly, heat inactivated post-immunization serum (polyclonal anti-CLAMP antibody) was diluted in 162 µl of the T. equi growth medium29 at 1:10, 1:20 and 1:40 dilutions prior to being added to the wells of a Corning Costar 96-well flat-bottom tissue culture-treated plate (Millipore Sigma, Burlington, MA) in triplicate. Heat inactivated pre-immunization serum and polyclonal anti-B. bovis HAP-2 antibody diluted in T. equi growth medium at dilutions identical to the polyclonal anti-CLAMP antibody were used as controls to evaluate test specificity. Like T. equi CLAMP, the polyclonal anti-B. bovis HAP-2 antibody was produced by immunizing New Zealand white rabbits with synthetic HAP-2 peptides37 conjugated to KLH and in the presence of the AdjuLite Freund’s adjuvants. 18 µl of T. equi infected erythrocytes at 0.2% parasitemia were added to the wells and the plate was incubated at 37 °C and 5% CO2 for 96 h. The antibody containing medium was replaced after every 24 h.

5 µl of the infected cells were harvested from the bottom of the wells after every 24 h and centrifuged at 500xg for 5 min at 4 °C. The pelleted cells were obtained and washed twice with 200 µl of 1X PBS (pH 7.2) prior to being suspended in 100 µl of the same buffer containing 25 µg/µl of the Invitrogen Dihydroethidium to stain the parasites’ nuclei. The cell suspension was incubated at 5% CO2 and 37 °C for 30 min in the dark prior to being washed twice with 200 µl of 1X PBS. They erythrocytes were then suspended in 200 µl of the same buffer.

Flow cytometry was performed to assess the neutralization capacity of the polyclonal anti-CLAMP antibody as previously described38. Briefly, the suspended cells were analyzed by the Guava easyCyte flow cytometer (Luminex Corporation, Austin, Tx) at a proportion of 800–1,000 cells/µl with 20,000 events acquired. Normal, uninfected equine erythrocytes (nRBC) and infected erythrocytes cultured in the absence of antibodies (iRBC) were used as negative and positive controls respectively in the flow cytometric analysis. The results were analyzed using the De Novo FCS Express v6 software (De Novo Software, Pasadena, CA) and the output was presented as a percentage of parasitized erythrocytes (PPE). Statistical analysis was performed using two-way ANOVA at a significance level of 0.05.

Given the fact that optimum neutralization activity of the polyclonal anti-CLAMP antibody was observed at 72 h post infection, percentage inhibition of merozoites was calculated at this time point. The formula: 100 − [(Test – nRBC / iRBC − nRBC) × 100]39 was used to determine the percentage of merozoites that were inhibited at the three antibody dilutions, and the results were compared to percentage inhibition in the presence of pre-immunization serum.

Isolation and identification of equine erythrocyte proteins that interact with CLAMP

Crosslinking and co-immunoprecipitation of interacting proteins

To crosslink erythrocyte surface proteins to CLAMP, 5 ml of uninfected equine erythrocytes suspended in 10 ml of 1X PBS were incubated with 5 × 108 T. equi merozoites for 1 h at 4 °C. The Thermo Scientific DTSSP crosslinker was added to the suspension to a final concentration of 2 mM, and further incubation was performed on ice for 2 h. Tris was then added to the solution to a final concentration of 20 mM, and incubation was performed at room temperature for 15 min to quench the reaction.

To crosslink intramembrane and intracellular erythrocyte proteins to CLAMP, 5 ml of T. equi infected erythrocytes at ~ 11% PPE were washed twice in 1X PBS to remove T. equi growth media prior to being suspended in 10 ml of 1X PBS. The Thermo Scientific DSP crosslinker was then dissolved in DMSO to a final concentration of 25 mM prior to being added to the suspended erythrocytes to a final concentration of 2 mM. Incubation was performed on ice for 2 h and tris was added to a final concentration of 20 mM to quench the reaction.

The crosslinked proteins were isolated using the Thermo Scientific Pierce Co-Immunoprecipitation kit in accordance with the manufacturer’s instructions, and agarose resins supplied by the manufacturer were used as negative controls. SDS-PAGE analysis was performed using the Invitrogen NuPAGE 4–12% Bis–Tris protein gel for detection of CLAMP’s interacting partners, and immunoblot analysis was conducted as described herein to confirm that CLAMP was isolated alongside its interacting partners.

Mass spectrometry analysis

The protein gel was stained overnight with the Thermo Scientific Pierce Coomassie Brilliant Blue R-250 prior to being washed twice with double distilled water at 15 min each. Protein bands on the gel were cut-out and transferred into sterile 2 ml Eppendorf tubes, and trypsin digestion was performed as previously described40. Nano LC–MS/MS was performed to analyze the digested peptides using the Thermo Scientific Easy-nLC 1000 Ultra-High-Pressure Liquid Chromatography connected to the Thermo Scientific Orbitrap Fusion Tribrid mass spectrometer. The Waters NanoAcquity HSS T3 column with a Thermo Scientific Trap Column was used to separate the peptides as previously described41. Full MS scans (MS1) were acquired from peptides eluted from the orbitrap’s electrospray source and MS2 scans were conducted on 3 s timed scans that were data-dependent and were detected in the ion trap as previously described41.

The Thermo Scientific Proteome Discoverer software (version 2.2) was used to search the LC–MS/MS raw data against the Equus caballus proteome sequences available in Uniprot (www.uniport.org) to identify equine erythrocyte proteins that interact with T. equi CLAMP. The static peptide and dynamic modification analyses, and a decoy database search to control for false discovery rate (FDR) were performed at previously described settings41.

Supplementary Information

Supplementary Information (819.9KB, pdf)

Acknowledgements

We are grateful to Paul Lacy and Jacob Laughery of the Department of Microbiology and Pathology, College of Veterinary Medicine, Washington State University, Pullman, WA, for the excellent technical and administrative support. We thank Lowell Kappmeyer, Dr. Massaro Ueti and Sara Davis of the United States Department of Agriculture (USDA)—Agricultural Research Service (ARS), Pullman, WA, for providing the equine serum samples. We thank Dr. Sylvia Omulo of Paul G. Allen School for Global Animal Health, Washington State University, Pullman, WA, for illustrating the interactions between CLAMP and the erythrocyte membrane skeleton proteins. We also acknowledge the Tissue Imaging and Proteomics Laboratory at Washington State University for performing the mass spectrometry experiments. This study was supported by the United States Department of Agriculture (USDA)—Agricultural Research Service (ARS) CRIS—Project No. 2090-32000-039-00D.

Author contributions

C.K.O. designed the study, performed the experiments, analyzed the data, and drafted the manuscript. L.M.F., R.P.B. and M.G.S. designed the study, analyzed the data, and reviewed the manuscript. R.G.B. performed the flow cytometry experiments and reviewed the manuscript. D.P.K. and C.E.S. obtained funding and resources for the project, designed the study, analyzed the data, and reviewed the manuscript.

Competing interests

The authors declare no competing interests.

Footnotes

Publisher's note

Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.

These authors contributed equally: Donald P. Knowles and Carlos E. Suarez.

Contributor Information

Cynthia K. Onzere, Email: cynthia.onzere@wsu.edu

Carlos E. Suarez, Email: carlos.suarez@usda.gov

Supplementary Information

The online version contains supplementary material available at 10.1038/s41598-021-88902-4.

References

  • 1.Wise LN, Kappmeyer LS, Mealey RH, Knowles DP. Review of equine piroplasmosis. J. Vet. Intern. Med. 2013;27:1334–1346. doi: 10.1111/jvim.12168. [DOI] [PubMed] [Google Scholar]
  • 2.Ueti MW, Palmer GH, Scoles GA, Kappmeyer LS, Knowles DP. Persistently infected horses are reservoirs for intrastadial tick-borne transmission of the apicomplexan parasite Babesia equi. Infect. Immun. 2008;76:3525–3529. doi: 10.1128/IAI.00251-08. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 3.Scoles GA, et al. Piroplasmosis associated with amblyomma. Emerg. Infect. Dis. 2011;17:1903–1905. doi: 10.3201/eid1710.101182. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 4.Bargieri D, Lagal V, Andenmatten N, Tardieux I, Meissner M. Host cell invasion by apicomplexan parasites: The junction conundrum. PLoS Pathog. 2014;10:1–9. doi: 10.1371/journal.ppat.1004273. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 5.Carruthers V. B., S. L. D. Sequential protein secretion from three distinct organelles of Toxoplasma gondii accompanies invasion of human fibroblasts. Eur. J. Cell Biol.73, 114–123 (1997). [PMC free article] [PubMed]
  • 6.Kemp LE, Yamamoto M, Soldati-Favre D. Subversion of host cellular functions by the apicomplexan parasites. FEMS Microbiol. Rev. 2013;37:607–631. doi: 10.1111/1574-6976.12013. [DOI] [PubMed] [Google Scholar]
  • 7.Sam-Yellowe TY. Rhoptry organelles of the apicomplexa: Their role in host cell invasion and intracellular survival. Parasitol. Today. 1996;12:308–316. doi: 10.1016/0169-4758(96)10030-2. [DOI] [PubMed] [Google Scholar]
  • 8.Carruthers VB, Sibley LD. Mobilization of intracellular calcium stimulates microneme discharge in Toxoplasma gondii. Mol. Microbiol. 1999;31:421–428. doi: 10.1046/j.1365-2958.1999.01174.x. [DOI] [PubMed] [Google Scholar]
  • 9.Carruthers VB, Tomley FM. Receptor-ligand interaction and invasion: Microneme proteins in apicomplexans. Subcell. Biochem. 2008 doi: 10.1007/978-0-387-78267-6_2. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 10.Scholtyseck E, Mehlhorn H. Ultrastructural study of characteristic organelles (paired organelles, micronemes, micropores) of sporozoa and related organisms. Zeitschrift für Parasitenkd. 1970;34:97–127. doi: 10.1007/BF00260383. [DOI] [PubMed] [Google Scholar]
  • 11.Shaw MK. The same but different: The biology of Theileria sporozoite entry into bovine cells. Int. J. Parasitol. 1997;27:457–474. doi: 10.1016/S0020-7519(97)00015-5. [DOI] [PubMed] [Google Scholar]
  • 12.Shaw MK. Cell invasion by Theileria sporozoites. Trends Parasitol. 2003;19:2–6. doi: 10.1016/S1471-4922(02)00015-6. [DOI] [PubMed] [Google Scholar]
  • 13.Mehlhorn H, Schein E. Redescription of Babesia equi Laveran, 1901 as Theileria equi Mehlhorn, Schein 1998. Parasitol. Res. 1998;84:467–475. doi: 10.1007/s004360050431. [DOI] [PubMed] [Google Scholar]
  • 14.Sidik SM, et al. A genome-wide CRISPR screen in toxoplasma identifies essential apicomplexan genes. Cell. 2016;166:1423–1435. doi: 10.1016/j.cell.2016.08.019. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 15.Omasits U, Ahrens CH, Mu S, Wollscheid B. Protter: Interactive protein feature visualization and integration with experimental proteomic data. Bioinformatics. 2014;30:884–886. doi: 10.1093/bioinformatics/btt607. [DOI] [PubMed] [Google Scholar]
  • 16.Lux SE, IV, et al. Anatomy of the red cell membrane skeleton : unanswered questions. Blood. 2016;127:187–199. doi: 10.1182/blood-2014-12-512772. [DOI] [PubMed] [Google Scholar]
  • 17.Rui Z, Chenyu Z, Qi Z, Donghai LI. Spectrin: Structure, function and disease. Sci. China Life Sci. 2013;56:1076–1085. doi: 10.1007/s11427-013-4575-0. [DOI] [PubMed] [Google Scholar]
  • 18.Fawcett DW, Büscher G, Doxsey S. Salivary gland of the tick vector of east coast fever. III. The ultrastructure of sporogony in Theileria parva. Tissue Cell. 1982;14:183–206. doi: 10.1016/0040-8166(82)90017-9. [DOI] [PubMed] [Google Scholar]
  • 19.Foley M, Tilley L, Sawyer W, Anders R. The ring-infected erythrocyte surface antigen of Plasmodium falciparum associates with spectrin in the erythrocyte membrane. Mol. Biochem. Parasitol. 1991;46:137–147. doi: 10.1016/0166-6851(91)90207-M. [DOI] [PubMed] [Google Scholar]
  • 20.Da Silva E, et al. The Plasmodium falciparum protein RESA interacts with the erythrocyte cytoskeleton and modifies erythrocyte thermal stability. Mol. Biochem. Parasitol. 1993;66:59–69. doi: 10.1016/0166-6851(94)90036-1. [DOI] [PubMed] [Google Scholar]
  • 21.Silva MD, et al. A role for the Plasmodium falciparum RESA protein in resistance against heat shock demonstrated using gene disruption. Mol. Microbiol. 2005;56:990–1003. doi: 10.1111/j.1365-2958.2005.04603.x. [DOI] [PubMed] [Google Scholar]
  • 22.Pei X, et al. The ring-infected erythrocyte surface antigen (RESA) of Plasmodium falciparum stabilizes spectrin tetramers and suppresses further invasion. Blood. 2007;110:1036–1042. doi: 10.1182/blood-2007-02-076919. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 23.Pei X, Guo X, Coppel R, Mohandas N, An X. Plasmodium falciparum erythrocyte membrane protein 3 ( PfEMP3) destabilizes erythrocyte membrane skeleton*. J. Biol. Chem. 2007;282:26754–26758. doi: 10.1074/jbc.M701612200. [DOI] [PubMed] [Google Scholar]
  • 24.Oh S, et al. Plasmodium falciparum erythrocyte membrane protein 1 is anchored to the actin–spectrin junction and knob-associated histidine-rich protein in the erythrocyte skeleton. Mol. Biochem. Parasitol. 2000;108:237–247. doi: 10.1016/S0166-6851(00)00227-9. [DOI] [PubMed] [Google Scholar]
  • 25.Baruch DI, Gormley JA, Ma C, Howard RJ, Paloske BL. Plasmodium falciparum erythrocyte membrane protein 1 is parasitized erythrocyte receptor for adherence to CD36, thrombospondin, and intercellular adhesion molecule 1. Proc. Natl. Acad. Sci. USA. 1996;93:3497–3502. doi: 10.1073/pnas.93.8.3497. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 26.Magowan C, et al. Role of the Plasmodium falciparum mature-parasite-infected erythrocyte surface antigen (MESA/PfEMP-2) in malarial infection of erythrocytes. Blood. 1995;86:3196–3204. doi: 10.1182/blood.V86.8.3196.3196. [DOI] [PubMed] [Google Scholar]
  • 27.(CFSPH), T. C. for F. S. and P. H. Equine Piroplasmosis Equine Piroplasmosis. 1–6 (2018). http://www.cfsph.iastate.edu/Factsheets/pdfs/equine_piroplasmosis.pdf. Accessed April 7th, 2020.
  • 28.Kappmeyer, L. S. et al. Comparative genomic analysis and phylogenetic position of Theileria equi. BMC Genomics13 (2012). [DOI] [PMC free article] [PubMed]
  • 29.Schuster FL. Cultivation of babesia and babesia-like blood parasites: Agents of an emerging zoonotic disease. Clin. Microbiol. Rev. 2002;15:365–373. doi: 10.1128/CMR.15.3.365-373.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 30.Ueti MW, et al. Ability of the vector tick Boophilus microplus to acquire and transmit babesia equi following feeding on chronically infected horses with low-level parasitemia. J. Clin. Microbiol. 2005;43:3755–3759. doi: 10.1128/JCM.43.8.3755-3759.2005. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 31.Goff WL, et al. Identification of Babesia bovis merozoite surface antigens by using immune bovine sera and monoclonal antibodies. Infect. Immun. 1988;56:2363–2368. doi: 10.1128/iai.56.9.2363-2368.1988. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 32.Yokoyama N, et al. Cellular localization of Babesia bovis merozoite rhoptry-associated protein 1 and its erythrocyte-binding activity. Infect. Immun. 2002;70:5822–5826. doi: 10.1128/IAI.70.10.5822-5826.2002. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 33.Knowles DP, et al. A monoclonal antibody defines a geographically conserved surface protein epitope of Babesia equi merozoites. Infect. Immun. 1991;59:2412–2417. doi: 10.1128/iai.59.7.2412-2417.1991. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 34.Hall CM, et al. Genetic characterization of Theileria equi infecting horses in North America: Evidence for a limited source of U. S. introductions. Parasit. Vectors. 2013;6:1–12. doi: 10.1186/1756-3305-6-35. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 35.Scoles GA, Ueti MW. Amblyomma cajennense is an intrastadial biological vector of Theileria equi. Parasit. Vectors. 2013;6:1. doi: 10.1186/1756-3305-6-306. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 36.Lardeux F, Torrico G, Aliaga C. Calculation of the ELISA ’ s cut-off based on the change-point analysis method for detection of Trypanosoma cruzi infection in Bolivian dogs in the absence of controls. Mem. Inst. Oswaldo Cruz. 2016;111:501–504. doi: 10.1590/0074-02760160119. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 37.Hussein HE, et al. The Babesia bovis hap2 gene is not required for blood stage replication, but expressed upon in vitro sexual stage induction. PLoS Negl. Trop. Dis. 2017;11:1–19. doi: 10.1371/journal.pntd.0005965. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 38.Wyatt CR, Goff W, Davis WC. A flow cytometric method for assessing viability of intraerythrocytic hemoparasites. J. Immunol. Methods. 1991;140:23–30. doi: 10.1016/0022-1759(91)90122-V. [DOI] [PubMed] [Google Scholar]
  • 39.Sinha S, Prakash A, Sehgal R, Medhi B. Comparative effect of manuka honey on anaerobic parasitic protozoans with standard drug therapy under in vitro conditions: A preliminary study. Indian J. Pharmacol. 2018;50:197–203. doi: 10.4103/ijp.IJP_227_18. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 40.Nyagwange J, et al. Characterization of the Theileria parva sporozoite proteome. Int. J. Parasitol. 2017;48:265–273. doi: 10.1016/j.ijpara.2017.09.007. [DOI] [PMC free article] [PubMed] [Google Scholar]
  • 41.White, D. S.-D. Inactivating inhibitors of mycobacterium tuberculosis β-lactamases blac. (Washington State University, 2019).

Associated Data

This section collects any data citations, data availability statements, or supplementary materials included in this article.

Supplementary Materials

Supplementary Information (819.9KB, pdf)

Articles from Scientific Reports are provided here courtesy of Nature Publishing Group

RESOURCES