Abstract
Atherosclerosis arises from leukocyte infiltration and thickening of the artery walls and constitutes a major component of vascular disease pathology, but the molecular events underpinning this process are not fully understood. Proteins containing an Asn-Gly-Arg (NGR) motif readily undergo deamidation of asparagine to generate isoDGR structures that bind to integrin αvβ3 on circulating leukocytes. Here we report the identification of isoDGR motifs in human atherosclerotic plaque components including extracellular matrix (ECM) proteins fibronectin and tenascin C, which have been strongly implicated in human atherosclerosis. We further demonstrate that deamidation of NGR motifs in fibronectin and tenascin C leads to increased adhesion of the monocytic cell line U937 and enhanced binding of primary human monocytes, except in the presence of a αvβ3-blocking antibody or the αv-selective inhibitor cilengitide. In contrast, under the same deamidating conditions monocyte-macrophages displayed only weak binding to the alternative ECM component vitronectin which lacks NGR motifs. Together, these findings confirm a critical role for isoDGR motifs in mediating leukocyte adhesion to the ECM via integrin αvβ3 and suggest that protein deamidation may promote the pathological progression of human atherosclerosis by enhancing monocyte recruitment to developing plaques.
Introduction
Endothelial dysfunction and inflammation promote leukocyte and lipid accumulation in the arterial intima, leading to the formation of atherosclerotic plaques which are the primary cause of cardiovascular disease (CVD)1. Plaque formation narrows the blood vessel lumen and can limit or even occlude oxygen supply to vital tissues, leading to myocardial infarction, stroke and/or fatal organ damage2, 3. Consequently, CVD is a leading cause of human morbidity and mortality worldwide4, 5, and there is an urgent need to better understand the molecular basis of atherosclerotic plaque formation so that this can be more effectively targeted with novel therapies and disease interventions.
Blood vessel walls are arranged in three concentric layers, the innermost tunica intima, the tunica media and outer tunica adventitia, which are separated by a sheet-like layer of extracellular matrix (ECM) proteins. The vascular ECM is comprised of glycoproteins that play major roles in host processes including haemostasis, thrombosis, inflammation, wound healing, angiogenesis and embryogenesis6, 7. During a conventional inflammatory response, circulating monocytes are recruited to cardiac tissues via cell surface integrin binding to RGD motifs in ECM proteins, but dysregulation of this process in CVD may enhance leukocyte infiltration of the blood vessel wall and promote vascular pathology8.
Protein deamidation is an irreversible, degenerative protein modification (DPM) that is strongly associated with the pathogenesis of several age-related human disorders including atherosclerosis9–19. Deamidation of asparagine (N) residues is a spontaneous process that leads to the formation of aspartic acid and isoaspartic acid isoforms from a succinimide intermediary20, 21. Blast analyses indicate that ~5% of all proteins contain at least one NGR sequence and that ~0.5% contain several of these motifs. However, not all NGR sites are equally susceptible to deamidation, and subsequent changes in protein function also depend on amino acid sequence, molecular structure, and microenvironmental conditions22. Indeed, while the majority of previous studies have reported that deamidation inhibits protein function23, in certain settings this modification may instead confer gain-of-function changes that mediate key pathological events in age-related human diseases.
Inflammatory processes such as atherosclerosis induce protein oxidation, which leads to structural changes that promote NGR deamidation22, 24. Rather than disrupting immune responses, deamidation of NGR has previously been identified as a gain-of-function change that generates an integrin-binding isoAsp-Gly-Arg (isoDGR) structure which mimics the cognate Arg-Gly-Asp (RGD) target sequence21, 25–32. Integrin-mediated adhesion of circulating monocytes to endothelial cells is an early event in atherosclerotic plaque formation33, and isoDGR formation has already been shown to promote leukocyte binding to endothelial cells during cancer development34. However, it remains unknown whether isoDGR motifs also contribute to the pathogenesis of human atherosclerosis. In a recent proteomic analysis of human carotid atherosclerotic plaques, we detected extensive deamidation of NGR motifs in several ECM component proteins including fibronectin (FN) and tenascin C (TNC)35–38, which have been strongly implicated in the pathophysiology of atherosclerosis and CVD39–44. We therefore hypothesized that deamidation of FN and TNC generates gain-of-function isoDGR motifs that mediate integrin binding and promote leukocyte recruitment to atherosclerotic plaque proteins. To test this hypothesis, we assessed the ECM adhesion capacity of mononuclear cells that express integrin αvβ3. Using this approach, we demonstrate that as little as 5–8% deamidation of NGR motifs in FN and TNC can significantly enhance mononuclear cell adhesion to key ECM components. Our data indicate that ECM protein deamidation may promote plaque formation via recruitment of circulating monocytes due to gain-of-function structural changes that increase binding to integrin αvβ3.
Results
Atherosclerotic plaque-derived ECM proteins exhibit highly deamidated NGR motifs
In a previous mass spectrometry-based proteomic analysis of carotid plaque tissues, we identified >4,500 individual proteins and multiple novel pathways implicated in the development and progression of human atherosclerosis38. Sample processing for this earlier investigation was conducted in ammonium acetate buffer (pH 6.5) which permits in-depth analysis of protein deamidation45, so in the current study we interrogated these data to identify that many key ECM proteins including FN and TNC displayed extensive deamidation at NGR motifs (Table 1). Most of the isoDGR-containing proteins identified displayed ~50% deamidation of NGR sites, and selected proteins including EMILIN1 and LOXL1 exhibited 100% deamidation of specific residues (N219 in EMILIN1 and N365 in LOXL1). Given that EMILIN1 and LOXL1 are involved in the regulation of vascular assembly and flexibility46–51, it is possible that deamidation leading to functional impairment of these proteins could promote atherosclerosis in human patients.
Table 1.
Accession | Gene | Protein | Most abundant modified peptide | Modified site | N#GR | NGR | Total | % N#GR |
---|---|---|---|---|---|---|---|---|
P01023 | A2M | Alpha-2-macroglobulin | K.EQAPHCICAN#GR.Q | 851 | 22 | 7 | 29 | 75.9 |
C9JF17 | APOD | Apolipoprotein D | R.WYEIEKIPTTFEN#GR.C | 86 | 59 | 9 | 68 | 86.8 |
P51452 | DUSP3 | Dual specificity protein phosphatase 3 | R.AADFIDQALAQKN#GR.V | 117 | 6 | 3 | 9 | 66.7 |
A0A0C4DFX3 | EMILIN1 | EMILIN-1 | R.AVETAFN#GR.Q | 219 | 10 | 0 | 10 | 100.0 |
FA9 | F9 | Coagulation factor IX | K.NCELDVTCNIKN#GR.C | 138 | 6 | 1 | 7 | 85.7 |
P35555 | FBN1 | Fibrillin-1 | R.DIDECLQN#GR.I | 537 | 65 | 10 | 75 | 86.7 |
P35555 | FBN1 | Fibrillin-1 | R.DIDECLQN#GRICN#N#GR.C | 543 | 9 | 25 | 34 | 26.5 |
P35555 | FBN1 | Fibrillin-1 | R.YCKDINECETPGICMN#GR.C | 625 | 44 | 68 | 112 | 39.3 |
P35555 | FBN1 | Fibrillin-1 | R.RPDGEGCVDENECQTKPGICEN#GR.C | 2304 | 11 | 42 | 53 | 20.8 |
C9JC84 | FGG | Fibrinogen gamma chain | R.VELEDWN#GR.T | 288 | 73 | 156 | 229 | 31.9 |
P02751 | FN1 | Fibronectin | R.GNLLQCICTGN#GRGEWK.C | 263 | 54 | 43 | 97 | 55.7 |
P02751 | FN1 | Fibronectin | K.QMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYN#GR.T | 367 | 5 | 76 | 81 | 6.2 |
P02751 | FN1 | Fibronectin | R.CTCVGN#GRGEWTCIAYSQLR.D | 501 | 9 | 16 | 25 | 36.0 |
P02751 | FN1 | Fibronectin | R.NSITLTNLTPGTEYVVSIVALN#GR.E | 1432 | 29 | 91 | 120 | 24.2 |
P10915 | HAPLN1 | Hyaluronan and proteoglycan link protein 1 | K.SRYDVFCFTSN#FN#GR.F | 258 | 28 | 29 | 57 | 49.1 |
A0A0G2JIW1 | HSPA1B | Heat shock 70 kDa protein 1B | K.LLQDFFN#GRDLNK.S | 356 | 11 | 11 | 22 | 50.0 |
P11021 | HSPA5 | 78 kDa glucose-regulated protein | K.N#GRVEIIANDQGNR.I | 47 | 3 | 7 | 10 | 30.0 |
P11047 | LAMC1 | Laminin subunit gamma-1 | R.ATAESASECLPCDCN#GR.S | 345 | 6 | 30 | 36 | 16.7 |
Q08397 | LOXL1 | Lysyl oxidase homolog 1 | R.LSVGSVYRPNQN#GRGLPDLVPDPN#YVQASTYVQR.A | 365 | 12 | 0 | 12 | 100.0 |
Q15149 | PLEC | Plectin | K.TLPN#GRDALDGPAAEAEPEHSFDGLRR.K | 2765 | 30 | 2 | 32 | 93.8 |
P08567 | PLEK | Pleckstrin | R.GCVVTSVESNSN#GR.K | 305 | 10 | 3 | 13 | 76.9 |
PLMN | PLG | Plasminogen | R.YEFLN#GR.V | 736 | 44 | 2 | 46 | 95.7 |
K7EKI8 | PPL | Periplakin | R.SLLDLEN#GR.R | 814 | 4 | 0 | 4 | 100.0 |
H7C2N1 | PTMA | Prothymosin alpha (Fragment) | K.EVVEEAEN#GR.D | 67 | 20 | 26 | 46 | 43.5 |
Q96B97 | SH3KBP1 | SH3 domain-containing kinase-binding protein 1 | R.KEDGGWWEGQIN#GR.R | 42 | 2 | 1 | 3 | 66.7 |
H0Y7S5 | SHANK2 | SH3 and multiple ankyrin repeat domains protein 2 | -.FM#N#VPGGGAAAVMMTGYNN#GR.C | 19 | 2 | 0 | 2 | 100.0 |
A0A0C4DG40 | SYNE1 | Nesprin-1 | R.DLQ#DRLSQMN#GRWDR.V | 8480 | 1 | 0 | 1 | 100.0 |
A0JNU9 | TBC1D1 | TBC1 domain family member 1 | R.KQ#N#LDLLEQLQ#VAN#GR.I | 369 | 1 | 0 | 1 | 100.0 |
J3QSU6 | TNC | Tenascin | K.N#GRENFYQNWK.A | 1849 | 3 | 3 | 6 | 50.0 |
J3QSU6 | TNC | Tenascin | K.VEGYSGTAGDSMAYHN#GR.S | 1936 | 14 | 62 | 76 | 18.4 |
O76076 | WISP2 | WNT1-inducible-signaling pathway protein 2 | R.GALCLLAEDDSSCEVN#GR.L | 103 | 15 | 82 | 97 | 15.5 |
We and others have previously reported the optimal protein database search parameters for robust identification of deamidation sites. By applying a 5ppm precursor ion tolerance and #13C of 2 in Mascot searches, we prevented the C13 peaks of native peptides being misassigned as the monoisotopic peaks of the deamidated peptides45, 52. Numerous earlier studies have indicated that atherosclerotic disease is strongly associated with plaque accumulation of FN (which features NGR motifs at residues 263, 367, 501 and 1432)42–44, as well as TNC (which includes NGR motifs at residues 2031 and 2118)40, 53–55. In the current report, our use of optimized search parameters revealed that both FN and TNC exhibit significant deamidation of their respective NGR motifs. The deamidated and native peptides were identified with high confidence by Mascot protein database searches with extensive y-ions fragments (Figs 1 and S1 and Supplementary Data 1). The Mascot-identified peptides are included in Supplementary Data 2. Using a spectral counting quantitation method56, we observed that FN peptide GNLLQCICTGNGRGEW displayed 55.7% deamidation of the NGR motif, whereas TNC peptides NGRENFYQNWK and VEGYSGTAGDSMAYHNGR exhibited 50% and 18% deamidation respectively at the NGR domain (Table 1), which was significantly higher than the 6.4% basal deamidation level detected across the rest of the proteome. These data suggest that ECM proteins FN and TNC display elevated levels of deamidation in atherosclerotic plaques and that these post-translational modifications may promote disease pathogenesis.
Monocyte adhesion to fibronectin and tenascin C is increased by NGR deamidation
We next hypothesized that isoDGR modifications in ECM proteins promote integrin-mediated mononuclear cell adhesion and recruitment into atherosclerotic plaques, leading to arterial dysfunction and disease progression. To test this possibility, we assessed the ability of integrin αvβ3-expressing pre-monocytic cells to adhere to ECM proteins FN and TNC that had been coated onto plastic overnight in the presence or absence of 50 mM tetraethyl ammonium bicarbonate (TEAB) buffer (pH 8.5) to induce asparagine deamidation. We first assessed the extent of protein deamidation induced by TEAB treatment by extracting plate-bound FN and TNC for LC-MS/MS analysis, which revealed extensive FN deamidation at residue 263 in the sequence GNLLQCICTGNGRGEWK and marked TNC deamidation at residue 2118 in the sequence VEGYSGTAGDSMAYHNGR. The percentage of deamidation at each targeted NGR motif was determined by integrating the area of the extracted ion chromatogram (XIC) with the calculated precursor masses of the native and deamidated peptides (+/− 5 ppm mass range). Using this approach, we determined that overall levels of protein deamidation in TEAB-treated plates were ~8% for FN and ~5.3% for TNC, whereas the PBS-treated control plates exhibited <0.5% deamidation of either protein (Fig. 2). We therefore proceeded to test the capacity of these different ECM substrates to bind U937 pre-monocytic cells that had been stimulated with 50 ng TPA (12-O-tetradecanoyl Phorbol-13-acetate)57 to induce differentiation and upregulation of integrin αvβ3. Western blot analyses indicated that β3 integrin expression was increased after 3 h and reached a stable maximum within 12–24 h of TPA treatment, consistent with differentiation of U937 cells towards a macrophage phenotype (Fig. S2a,b). We therefore elected to stimulate U937 cells with 50 ng TPA for 24 h and then incubate for 48 h in fresh RPMI-1640 medium supplemented with 10% FBS prior to use in the cell adhesion assays58. Analysis by microscopy revealed that the number of adherent U937 cells counted within a fixed area during the 60 min assay period was increased ~2-fold in the presence of deamidated FN (Fig. 3b) and ~2.5-fold with deamidated TNC (Fig. 4b) compared with unmodified protein controls. Preferential monocyte-macrophage binding to deamidated FN was observed within just 15 min and continued to increase over the entire assay period (Fig. 3b), while increased cell adhesion to deamidated TNC was evident after 30–60 min incubation (Fig. 4a,b). Similar data were obtained when using these same assays to determine the binding capacity of primary human CD14+ blood monocytes, which also displayed preferential adhesion to deamidated FN (~1.3-fold) and deamidated TNC (~2-fold) (Fig. 5b).
Integrin αvβ3 mediates monocyte-macrophage binding to deamidated ECM Proteins
Our observation that monocyte-macrophages expressing αvβ3 preferentially adhere to deamidated FN and TNC suggested that isoDGR modification of these proteins can enhance integrin binding. We therefore assessed whether the preferential binding of U937 cells to deamidated ECM proteins was attenuated in the presence of the αv-selective antagonist cilengitide59 and results were further confirmed by blocking of integrins αv and β3 using monoclonal antibodies. Primed U937 cells were incubated with or without 5 µg cilengitide overnight and then assessed for ability to bind to unmodified or deamidated ECM proteins via counting of adherent cells (Figs 3a,b and 4a,b). Consistent with our previous findings, U937 cell binding to deamidated FN was increased >2-fold relative to the unmodified control protein, whereas cilengitide treatment impaired cell binding to both the unmodified and deamidated proteins (Fig. 3a,b). Cilengitide-mediated blocking of integrin αv conferred a ~3-fold reduction in U937 cell binding to both native and deamidated FN compare to their native control, although the inhibitory effect declined with increasing assay duration (Fig. 3a,b). Cilengitide also induced a ~4-fold reduction in cell adhesion to native and deamidated TNC protein respect to the native control over the 60 min assay period (Fig. 4a,b). Inhibition of αv and β3 using monoclonal blocking antibodies replicated the effect of cilengitide (Figs 3a,b and 4a,b). A maximum of 2.88-fold and 2.86-fold reduction in cell adhesion to both native and deamidated FN was achieved by respective αv and β3 monoclonal blocking antibodies while the vales were 3.6-fold and 3.7-fold for TNC protein (Figs 3a,b and 4a,b). Together, these data reveal that deamidation of NGR motifs in ECM proteins FN and TNC enhances monocyte-macrophage adhesion mediated by αvβ3 integrin and likely promotes leukocyte recruitment to human atherosclerotic plaques.
Discussion
The current report provides evidence of a critical role for isoDGR motifs in mediating leukocyte adhesion to the ECM via interactions with integrin αvβ3 and indicates that protein deamidation may promote atherosclerosis by enhancing monocyte-macrophage recruitment to developing plaques. Integrins are heterodimeric transmembrane molecules that bind to a conserved RGD sequence present in various host peptides60, but it has long been recognised that alternative motifs may also be capable of mediating integrin binding. In 1995, the peptide NGRAHA was identified by Koivunen and colleagues as a low-affinity homolog of the RGD ligand for αvβ3 integrin61, but it was not until 2006 that Curnis et al. reported that the NGR domain of fibronectin can undergo asparagine deamidation to form isoaspartic acid and increase integrin binding6. Our data now indicate that deamidation of ECM components can also induce gain-of- function structural changes that increase monocyte-macrophage binding to atherosclerotic plaque proteins.
During early-phase vascular injury, circulating monocytes migrate to the dysfunctional endothelial lining where they differentiate into macrophages (MФ) and produce pro-inflammatory cytokines and chemokines that recruit additional monocytes33. Having populated the endothelial lining, MФ then engulf oxidised LDL deposits in the lamina and develop into foam cells which are strongly associated with disease progression33, 62. Our data now suggest that deamidation-prone ECM proteins containing NGR motifs are likely to undergo gain-of-function modifications under stress conditions such as local inflammation during vascular injury63. We report for the first time that asparagine deamidation of the extracellular matrix proteins FN and TNC in particular can enhance monocyte adhesion via isoDGR interactions with integrin αvβ3. Our initial proteomic analysis of human carotid atherosclerotic plaque tissues demonstrated that both FN and TNC proteins exhibit extensive NGR deamidation in vivo, and we further showed that these modifications confer a significant increase in monocyte-macrophage adhesion to ECM in vitro. Indeed, our observation that monocyte binding to the ECM was increased up to ~3.5-fold following induction of isoDGR motifs suggests that this mechanism could exert a major influence on the rate of plaque formation in human patients.
FN is a ubiquitous and highly abundant protein in human plasma and ECM. Initially secreted as a soluble disulphide-bonded dimer, FN is subsequently assembled into an insoluble multimeric protein in the ECM and provides structural support via interactions with collagens and fibrin. FN has also been shown to mediate cell surface receptor interactions with the ECM via activation of intracellular cytoskeletal rearrangements and signalling pathways. Consequently, FN is particularly abundant in tissues that are undergoing active regeneration in response to injury and has been strongly implicated in the pathology of atherosclerosis leading to cardiovascular disease42–44. Increased expression of FN in the injured vascular wall regulates smooth muscle cell transformation from a contractile phenotype to a synthesizing/proliferative phenotype that may contribute to intimal thickening. In atherosclerotic lesions there is a marked increase in FN co-localization with collagen type III, which is an archetypal feature of the tissue repair process during wound healing, whereas inhibition of FN expression using angiotensin II receptor antagonists is associated with a decrease in intimal thickening. These data suggest that drug targeting of FN structure-function changes may yield therapeutic benefit in human CVD patients.
TNC is highly expressed during embryogenesis but is almost absent in postnatal life and lacking in healthy arterial tissues53. However, TNC can be detected in tissues undergoing active remodelling and is up-regulated in atherosclerotic plaques where the protein reportedly contributes to smooth muscle cell migration and proliferation54. Sharifi and co-workers used immunohistochemical staining and in situ hybridization to demonstrate that TNC co-localizes with macrophages in human coronary atherosclerotic plaques that feature an organized lipid core or areas of rupture40, thus indicating that TNC expression and distribution correlate with inflammation. In a separate study, analysis of single nucleotide polymorphisms in human aortic tissues revealed that TNC genetic variants are strongly associated with atherosclerosis and coronary artery disease55. Taken together, these data demonstrate that FN and TNC are closely linked with the pathology of atherosclerosis and may represent promising targets for clinical interventions.
Intriguingly, we observed that the extent of TEAB-induced deamidation in fibronectin and tenascin C was <10% higher than the levels of spontaneous NGR deamidation observed in the untreated control. These data are consistent with previous reports that spontaneous NGR deamidation of ECM proteins is highly dependent on flanking residues, secondary/tertiary structure, and overall three-dimensional conformation64, which can be influenced by microenvironmental conditions including pH, temperature, and ionic strength65. Our data now reveal that these factors are also likely to exert a major influence on human atherosclerotic plaque progression to CVD via effects on monocyte-macrophage recruitment to the affected tissues. Pre-treatment of monocytic cells with the cyclic RGD-based pentapeptide cilengitide blocks αvβ3 integrin binding sites and reduced adhesion to NGR-deamidated fibronectin and tenascin C by 3–4-fold. The specific blocking of αv and β3 integrin by monoclonal blocking antibodies reproduce the effect as achieved by RGD-motif specific blocking by cilengitide confirms the NGR-deamidation mediated integrin binding which mimic the RGD-specific integrin binding. Since protein deamidation is a spontaneous reaction the quantity of modified protein present in affected tissues progressively increases with time9–11. We used human carotid plaque tissues from elderly donors, hence the samples contained significant amounts of deamidated FN and TNC (acquired over the course of natural ageing). Deamidation of freshly prepared proteins by short-term chemical treatment in vitro was predictably lower than can be generated in vivo, but still conferred a significant increase in leukocyte adhesion to ECM. It is therefore possible that deamidation of FN and TNC in human tissues in vivo leads to even greater enhancement of leukocyte recruitment to carotid plaques than was observed in our assays. Collectively, these findings indicate that deamidation of the NGR domain confers gain-of-function changes in ECM proteins that increase leukocyte binding mediated by αvβ3. Therapeutic targeting of this novel mechanism may represent an effective approach to inhibiting plaque development and delaying/preventing progression to CVD in human patients.
Conclusion
In this study, we performed proteomic profiling of human carotid atherosclerotic plaque samples and identified that numerous extracellular matrix (ECM) proteins display isoDGR motifs with potential ‘gain-of-function’ properties. IsoDGR is generated by deamidation of the NGR domain in select ECM proteins and mimics the functions of the integrin αvβ3-binding RGD motif. Accordingly, monocyte-macrophage adhesion to ECM proteins was significantly enhanced upon NGR deamidation of the atherosclerosis-associated matrix components fibronectin and tenascin C via a mechanism that required integrin αvβ3. In conclusion, deamidation of asparagine residues in the NGR motif of atherosclerotic plaque proteins likely contributes to disease progression via recruitment of circulating monocytes that adhere to the modified ECM via integrin αvβ3.
Materials and Methods
Antibodies and reagents
All reagents and chemicals used in this study were purchased from Sigma (St. Louis, USA) unless otherwise specified. For cell culture, RPMI-1640 medium was purchased from PAA Laboratories GmbH (Austria). Tenascin C protein (Cat. No. CC065) was obtained from EMD Millipore (Billerica, Massachusetts, USA). Cilengitide was purchased from Selleckchem (Houston, USA). Rabbit anti-human integrin αv and β3 were from Cell Signaling Technologies, Inc. (Danvers, MA, USA). HRP goat anti-rabbit IgG secondary antibody was from Zymed (San Francisco, California, USA). Sequencing-grade trypsin was from Promega (Madison, MI, USA). Human Pan Monocyte Isolation Kits were purchase from Miltenyi Biotec GmbH (Germany) and 5-Carboxyfluorescein N-Succinimidyl ester (CFSE) fluorescent dye was purchase from Cayman Chemical (Michigan, USA).
Proteomic profiling of human carotid atherosclerotic plaques
LC-MS/MS-based proteomic profiling of human atherosclerotic plaque tissues was performed as previously described45. Briefly, atherosclerotic plaque samples were obtained from n = 38 patients who underwent carotid endarterectomy at University Medical Center Utrecht (Netherlands) between 2002 and 200666. Patients were aged 56–83 and included 32 males and 6 females. The clinical study has been approved by the Institutional Review board of the hospital and written informed consent was obtained from all patients. The experimental protocols were approved by the relevant ethical boards and were conducted in accordance with NTU guidelines. Blood clots were removed from the plaque samples, followed by extensive washing with PBS to remove any soluble materials prior to use in our analyses. Each of the 38 atherosclerotic plaque samples was transferred into lysis buffer (8 M Urea, 50 mM ammonium acetate, pH 6) containing protease inhibitors and then homogenized using a Bullet Blender® (Next Advance, Inc., NY), before pooling and subjecting these to trypsin digestion. The tryptic peptides derived from the atherosclerotic plaque samples were prepared as previously described, with minor modifications45. Peptides generated from approximately 1 mg of proteins were fractionated using ERLIC on a HPLC system and then combined into 20 separate fractions67. Peptides from each fraction were separated and analyzed in triplicate on a Dionex Ultimate 3000 RSLCnano system coupled to a Q Exactive instrument (Thermo Scientific, San Jose, USA). The raw data are available for download from PeptideAtlas using the dataset identifier PASS00406 (http://www.peptideatlas.org/PASS/PASS00406). Raw data were converted to Mascot generic file (mgf) format using Proteome Discoverer v1.4 (Thermo Scientific, San Jose, USA) with deisotope in MS/MS. The mgf files were searched against the Uniprot human proteome database in Mascot using the following parameters; fixed modification: Carbamidomethyl, variable modification: Deamidation (NQ), Oxidation (M); MS/MS tolerance 5.1 ppm, peptide mass tolerance: 0.02 Da, # of missed cleavage: 2. The Mascot results were exported to an Excel file for further analysis.
Cell culture
Pro-monocytic U937 cells were cultured in RPMI-1640 medium supplemented with 10% FBS and 1 mM sodium pyruvate. Cells were differentiated by stimulation with 50 ng/ml Phorbol 12-myristate 13-acetate (PMA) (Sigma, St. Louis, MO, USA) for 24 h followed by a further 48 h incubation in fresh culture medium.
Cell adhesion assay
ECM proteins were coated onto 96-well plates (2 µg protein in 50 µl PBS, pH 6.8) via overnight incubation at 37 °C. Non-adhered ECM proteins were then removed and the wells washed twice with PBS. Deamidation of ECM proteins was induced by addition of 50 mM TEAB buffer (pH 8.5) and overnight incubation at 37 °C. All wells were then washed twice with PBS to remove residual TEAB prior to addition of differentiated U937 cells (1 × 104 cells per well) and incubation at 37 °C for the indicated times. In inhibition experiments, U937 cells were pre-treated with 5 µg cilengitide overnight (1 × 104 cells per condition) prior to use in the adhesion assays. Alternatively, blocking of αv and β3 was achieved by incubating U937 cells with the corresponding anti-integrin monoclonal antibodies (1:500 dilution) in 10% FBS-supplemented DMEM at 37 °C for 1 h immediately prior to use in adhesion assays. After incubation, non-adherent cells were removed from the wells by washing twice with PBS. Adherent cells were fixed by addition of 95% ethanol for 15 min at RT. The fixed cells were then stained with crystal violet for 20 min followed by extensive washing with PBS to remove excess dye. Images of the adherent cells were captured using a Nikon EU 2000 inverted microscope. Quantification was performed by cell counting in experimental triplets and the statistical significance was calculated by using nonparametric one-way ANOVA with multiple comparisons test.
Primary Monocyte Adhesion Assay
Blood samples were obtained after written informed consent from two healthy volunteers recruited via NTU health clinic (Singapore). Experimental protocols were approved by the ethical boards and were conducted in accordance with NTU guidelines. Human peripheral blood mononuclear cells (PBMCs) were isolated from each fresh 15 ml blood sample by density gradient centrifugation over Histopaque-1077 at 400 × g for 20 min. Finally, the human primary monocytes were isolated from PBMCs using monocyte isolation kits according to the manufacturer’s protocol. Isolated monocytes were suspended in PBS and labelled with 10 µM CFSE for 10 min at 37 °C prior to use in the adhesion assays (~3 × 104 cells per well). Images of adherent cells were captured in the green fluorescence channel of a Nikon ECLIPSE Ti-S inverted microscope coupled with a Nikon DS-Ri2 camera. Quantification was performed by cell counting in 4 experimental replicates and nonparametric one-way ANOVA was used for a comparison between groups.
Western blotting
U937 cells were stimulated with PMA for the indicated times and cell lysate was collected for assessment of β3 integrin expression levels. Briefly, cells were lysed in RIPA buffer containing a cocktail of EDTA-free protease inhibitors (Roche, Mannheim, Germany) and phosphatase inhibitors (Roche, Mannheim, Germany). Lysates were clarified by centrifugation (16,000 × g, 30 min) and subjected to Western blotting using an anti-integrin β3 antibody (1:1000 dilution). Protein-antibody conjugates were visualized using a chemiluminescence detection kit according to the manufacturer’s protocol (Thermo Scientific).
ECM protein extraction
ECM proteins were extracted from coated 96-well plates for LC-MS/MS analysis to determine the extent of deamidation. TEAB-treated (deamidated) and PBS-treated (non-deamidated) plates were incubated with 8 M urea and 50 mM ammonium acetate (pH 6.5) on a rotatory shaker for 2 h at 37 °C. Proteins extracted into the urea buffer were then collected in a microcentrifuge tube and precipitated in chilled acetone by incubation at −20 °C overnight. Precipitated proteins were finally subjected to LC-MS/MS analysis of deamidation.
LC-MS/MS analysis of ECM protein deamidation
Extracted ECM protein samples were reduced, alkylated, and diluted with ammonium acetate to achieve 1 M urea prior to trypsin digestion overnight at 37 °C. The digested protein samples were desalted and dried in a vacuum concentrator. Tryptic peptides were then separated and analysed on a Dionex Ultimate 3000 RSLC-nano system coupled to a LTQ-FT Ultra (Thermo Electron, Bremen, Germany) using a C18 nano-HPLC column with a standard LC-MS/MS gradient. Peptide ions were analysed on LTQ-FT with an ADVANCE™ CaptiveSpray™ Source (Michrom BioResources, USA). Spectra were acquired with XCalibur (version 2.0 SR2). MS/MS spectra were extracted from raw data and converted into mgf files in Proteome Discoverer 1.4 before searching these against the human database in Mascot software (parameters used were; fixed modification: Carbamidomethyl, variable modification: Deamidation (NQ), Oxidation (M); MS/MS tolerance 5.1 ppm, peptide mass tolerance: 0.8 Da, No. of missed cleavage: 2). The Mascot-annotated MS/MS spectra of the targeted deamidated and non-deamidated peptides were confirmed by manual inspection of the search results. The percentage of deamidation at each targeted NGR motif was determined by the area of the extracted ion chromatogram integrated with +/− 5 ppm mass range of the calculated precursor masses of the native and deamidated peptides.
Electronic supplementary material
Acknowledgements
This work was in part supported by grants from the Singapore Ministry of Education (MOE2014-T2-2-043), National Medical Research Council of Singapore (NMRC-OF-IRG-0003-2016), and NTU-NHG Ageing Research Grant (Grant ARG/14017).
Author Contributions
B.D. and J.E.P. contributed equally to this work and involved in designed and performed experiments, analyzed data and wrote the manuscript; S.K., P.H., X.G.P., A.S., and Y.R. performed MS experiments and data analysis; V.S., C.N.L., H.H.H. and D.K. provided materials; S.K.S. conceived, designed and supervised the experiments, and wrote the manuscript. All co-authors contributed to the revision of the manuscript.
Competing Interests
The authors declare that they have no competing interests.
Footnotes
Bamaprasad Dutta and Jung Eun Park contributed equally to this work.
Electronic supplementary material
Supplementary information accompanies this paper at doi:10.1038/s41598-017-06202-2
Publisher's note: Springer Nature remains neutral with regard to jurisdictional claims in published maps and institutional affiliations.
References
- 1.Kampoli AM, Tousoulis D, Antoniades C, Siasos G, Stefanadis C. Biomarkers of premature atherosclerosis. Trends Mol Med. 2009;15:323–332. doi: 10.1016/j.molmed.2009.06.001. [DOI] [PubMed] [Google Scholar]
- 2.Klingenberg, R., Hasun, M., Corti, R. & Lüscher, T. F. Clinical Manifestations of Atherosclerosis. Inflammation and Atherosclerosis 39–58 (2012).
- 3.Packard RR, Libby P. Inflammation in atherosclerosis: from vascular biology to biomarker discovery and risk prediction. Clin Chem. 2008;54:24–38. doi: 10.1373/clinchem.2007.097360. [DOI] [PubMed] [Google Scholar]
- 4.Roger VL, et al. Heart Disease and Stroke Statistics—2011 Update1. About 1. About These Statistics2. American Heart Association’s 2020 Impact Goals3. Cardiovascular Diseases4. Subclinical Atherosclerosis5. Coronary Heart Disease, Acute Coronary Syndrome, and Angina Pectoris6. Stroke (Cerebrovascular Disease) 7. High Blood Pressure8. Congenital Cardiovascular Defects9. Cardiomyopathy and Heart Failure10. Other Cardiovascular Diseases11. Family History and Genetics12. Risk Factor: Smoking/Tobacco Use13. Risk Factor: High Blood Cholesterol and Other Lipids14. Risk Factor: Physical Inactivity15. Risk Factor: Overweight and Obesity16. Risk Factor: Diabetes Mellitus17. End-Stage Renal Disease and Chronic Kidney Disease18. Metabolic Syndrome19. Nutrition20. Quality of Care21. Medical Procedures22. Economic Cost of Cardiovascular Disease23. At-a-Glance Summary Tables 24. Glossary. Circulation. 2011;123:e18–e209. doi: 10.1161/CIR.0b013e3182009701. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Roger VL, Go AS, Lloyd-Jones DM, Adams RJ, Berry JD. American Heart Association Statistics Committee and Stroke Statistics Subcommittee. Heart disease and stroke statistics–2011 update: a report from the American Heart Association. Circulation. 2011;123:e18–e209. doi: 10.1161/CIR.0b013e3182009701. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 6.Curnis F, et al. Spontaneous formation of L-isoaspartate and gain of function in fibronectin. J Biol Chem. 2006;281:36466–36476. doi: 10.1074/jbc.M604812200. [DOI] [PubMed] [Google Scholar]
- 7.Imanaka-Yoshida K. Tenascin-C in cardiovascular tissue remodeling: from development to inflammation and repair. Circ J. 2012;76:2513–2520. doi: 10.1253/circj.CJ-12-1033. [DOI] [PubMed] [Google Scholar]
- 8.Matsui Y, Morimoto J, Uede T. Role of matricellular proteins in cardiac tissue remodeling after myocardial infarction. World J Biol Chem. 2010;1:69–80. doi: 10.4331/wjbc.v1.i5.69. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Robinson NE, Robinson AB. Molecular clocks. Proceedings of the National Academy of Sciences of the United States of America. 2001;98:944–949. doi: 10.1073/pnas.98.3.944. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Robinson NE, Robinson AB. Deamidation of human proteins. Proceedings of the National Academy of Sciences of the United States of America. 2001;98:12409–12413. doi: 10.1073/pnas.221463198. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 11.Truscott RJ, Friedrich MG. The etiology of human age-related cataract. Proteins don’t last forever. Biochimica et biophysica acta. 2016;1860:192–198. doi: 10.1016/j.bbagen.2015.08.016. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Ray NJ, Hall D, Carver JA. Deamidation of N76 in human gammaS-crystallin promotes dimer formation. Biochimica et biophysica acta. 2016;1860:315–324. doi: 10.1016/j.bbagen.2015.08.015. [DOI] [PubMed] [Google Scholar]
- 13.Gallart-Palau X, et al. Extracellular vesicles are rapidly purified from human plasma by PRotein Organic Solvent PRecipitation (PROSPR) Scientific reports. 2015;5:14664. doi: 10.1038/srep14664. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Qin Z, Dimitrijevic A, Aswad DW. Accelerated protein damage in brains of PIMT +/− mice; a possible model for the variability of cognitive decline in human aging. Neurobiology of aging. 2015;36:1029–1036. doi: 10.1016/j.neurobiolaging.2014.10.036. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Barbariga M, et al. Ceruloplasmin functional changes in Parkinson’s disease-cerebrospinal fluid. Molecular neurodegeneration. 2015;10:59. doi: 10.1186/s13024-015-0055-2. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Dan A, et al. Extensive deamidation at asparagine residue 279 accounts for weak immunoreactivity of tau with RD4 antibody in Alzheimer’s disease brain. Acta neuropathologica communications. 2013;1:54. doi: 10.1186/2051-5960-1-54. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Hasegawa M, et al. Protein sequence and mass spectrometric analyses of tau in the Alzheimer’s disease brain. J Biol Chem. 1992;267:17047–17054. [PubMed] [Google Scholar]
- 18.Adav SS, Sze SK. Insight of brain degenerative protein modifications in the pathology of neurodegeneration and dementia by proteomic profiling. Molecular brain. 2016;9:92. doi: 10.1186/s13041-016-0272-9. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Patananan AN, Capri J, Whitelegge JP, Clarke SG. Non-repair pathways for minimizing protein isoaspartyl damage in the yeast Saccharomyces cerevisiae. The Journal of biological chemistry. 2014;289:16936–16953. doi: 10.1074/jbc.M114.564385. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Sandmeier E, Hunziker P, Kunz B, Sack R, Christen P. Spontaneous deamidation and isomerization of Asn108 in prion peptide 106–126 and in full-length prion protein. Biochemical and biophysical research communications. 1999;261:578–583. doi: 10.1006/bbrc.1999.1056. [DOI] [PubMed] [Google Scholar]
- 21.Corti A, Curnis F. Isoaspartate-dependent molecular switches for integrin-ligand recognition. J Cell Sci. 2011;124:515–522. doi: 10.1242/jcs.077172. [DOI] [PubMed] [Google Scholar]
- 22.Barbariga M, et al. Oxidation-induced Structural Changes of Ceruloplasmin Foster NGR Motif Deamidation That Promotes Integrin Binding and Signaling. Journal of Biological Chemistry. 2014;289:3736–3748. doi: 10.1074/jbc.M113.520981. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 23.Weintraub SJ, Deverman BE. Chronoregulation by asparagine deamidation. Sci STKE. 2007;2007:re7. doi: 10.1126/stke.4092007re7. [DOI] [PubMed] [Google Scholar]
- 24.Chuang CY, et al. Oxidation modifies the structure and function of the extracellular matrix generated by human coronary artery endothelial cells. Biochem J. 2014;459:313–322. doi: 10.1042/BJ20131471. [DOI] [PubMed] [Google Scholar]
- 25.Spitaleri A, et al. Structural basis for the interaction of isoDGR with the RGD-binding site of alphavbeta3 integrin. J Biol Chem. 2008;283:19757–19768. doi: 10.1074/jbc.M710273200. [DOI] [PubMed] [Google Scholar]
- 26.Zou M, Zhang L, Xie Y, Xu W. NGR-based strategies for targeting delivery of chemotherapeutics to tumor vasculature. Anticancer Agents Med Chem. 2012;12:239–246. doi: 10.2174/187152012800228751. [DOI] [PubMed] [Google Scholar]
- 27.Ghitti M, et al. Molecular dynamics reveal that isoDGR-containing cyclopeptides are true alphavbeta3 antagonists unable to promote integrin allostery and activation. Angew Chem Int Ed Engl. 2012;51:7702–7705. doi: 10.1002/anie.201202032. [DOI] [PubMed] [Google Scholar]
- 28.Frank AO, et al. Conformational control of integrin-subtype selectivity in isoDGR peptide motifs: a biological switch. Angew Chem Int Ed Engl. 2010;49:9278–9281. doi: 10.1002/anie.201004363. [DOI] [PubMed] [Google Scholar]
- 29.Takahashi S, et al. The RGD motif in fibronectin is essential for development but dispensable for fibril assembly. J Cell Biol. 2007;178:167–178. doi: 10.1083/jcb.200703021. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Rizzardi, G. P. & Bordignon, C. NGR and isoDGR are separate moieties binding to different receptors. Blood113, 5366; author reply 5367, doi:10.1182/blood-2009-02-207068 (2009). [DOI] [PubMed]
- 31.Corti A, Curnis F, Arap W, Pasqualini R. The neovasculature homing motif NGR: more than meets the eye. Blood. 2008;112:2628–2635. doi: 10.1182/blood-2008-04-150862. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Curnis F, et al. Isoaspartate-glycine-arginine: a new tumor vasculature-targeting motif. Cancer Res. 2008;68:7073–7082. doi: 10.1158/0008-5472.CAN-08-1272. [DOI] [PubMed] [Google Scholar]
- 33.Libby P, et al. Macrophages and atherosclerotic plaque stability. Current opinion in lipidology. 1996;7:330–335. doi: 10.1097/00041433-199610000-00012. [DOI] [PubMed] [Google Scholar]
- 34.Bartolome RA, et al. An RGD motif present in cadherin 17 induces integrin activation and tumor growth. J Biol Chem. 2014;289:34801–34814. doi: 10.1074/jbc.M114.600502. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 35.Bleijerveld OB, et al. Proteomics of plaques and novel sources of potential biomarkers for atherosclerosis. Proteomics. Clinical applications. 2013;7:490–503. doi: 10.1002/prca.201200119. [DOI] [PubMed] [Google Scholar]
- 36.Ionita MG, et al. High myeloid-related protein: 8/14 levels are related to an increased risk of cardiovascular events after carotid endarterectomy. Stroke; a journal of cerebral circulation. 2010;41:2010–2015. doi: 10.1161/STROKEAHA.110.582122. [DOI] [PubMed] [Google Scholar]
- 37.Peeters W, et al. Adipocyte fatty acid binding protein in atherosclerotic plaques is associated with local vulnerability and is predictive for the occurrence of adverse cardiovascular events. European heart journal. 2011;32:1758–1768. doi: 10.1093/eurheartj/ehq387. [DOI] [PubMed] [Google Scholar]
- 38.Hao P, et al. Deep proteomic profiling of human carotid atherosclerotic plaques using multidimensional LC-MS/MS. Proteomics. Clinical applications. 2014;8:631–635. doi: 10.1002/prca.201400007. [DOI] [PubMed] [Google Scholar]
- 39.Schaff M, et al. Novel function of tenascin-C, a matrix protein relevant to atherosclerosis, in platelet recruitment and activation under flow. Arterioscler Thromb Vasc Biol. 2011;31:117–124. doi: 10.1161/ATVBAHA.110.206375. [DOI] [PubMed] [Google Scholar]
- 40.Wallner K, et al. Tenascin-C is expressed in macrophage-rich human coronary atherosclerotic plaque. Circulation. 1999;99:1284–1289. doi: 10.1161/01.CIR.99.10.1284. [DOI] [PubMed] [Google Scholar]
- 41.Imanaka-Yoshida K. Tenascin-C in cardiovascular tissue remodeling: from development to inflammation and repair. Circ J. 2012;76:2513–2520. doi: 10.1253/circj.CJ-12-1033. [DOI] [PubMed] [Google Scholar]
- 42.Santovito D, Weber C. Fibronectin extradomain A: balancing atherosclerotic plaque burden and stability. Thrombosis and haemostasis. 2015;114:4. doi: 10.1160/TH15-06-0447. [DOI] [PubMed] [Google Scholar]
- 43.Prakash P, Kulkarni PP, Lentz SR, Chauhan AK. Cellular fibronectin containing extra domain A promotes arterial thrombosis in mice through platelet Toll-like receptor 4. Blood. 2015;125:3164–3172. doi: 10.1182/blood-2014-10-608653. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 44.Murphy PA, Hynes RO. Alternative splicing of endothelial fibronectin is induced by disturbed hemodynamics and protects against hemorrhage of the vessel wall. Arterioscler Thromb Vasc Biol. 2014;34:2042–2050. doi: 10.1161/ATVBAHA.114.303879. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Hao, P., Ren, Y., Alpert, A. J. & Sze, S. K. Detection, evaluation and minimization of nonenzymatic deamidation in proteomic sample preparation. Mol Cell Proteomics10, O111 009381, doi:10.1074/mcp.O111.009381 (2011). [DOI] [PMC free article] [PubMed]
- 46.Litteri G, et al. Vascular smooth muscle Emilin-1 is a regulator of arteriolar myogenic response and blood pressure. Arterioscler Thromb Vasc Biol. 2012;32:2178–2184. doi: 10.1161/ATVBAHA.112.254664. [DOI] [PubMed] [Google Scholar]
- 47.Danussi C, et al. Emilin1 deficiency causes structural and functional defects of lymphatic vasculature. Molecular and cellular biology. 2008;28:4026–4039. doi: 10.1128/MCB.02062-07. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Shen C, et al. Emilin1 gene and essential hypertension: a two-stage association study in northern Han Chinese population. BMC medical genetics. 2009;10:118. doi: 10.1186/1471-2350-10-118. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Zacchigna L, et al. Emilin1 links TGF-beta maturation to blood pressure homeostasis. Cell. 2006;124:929–942. doi: 10.1016/j.cell.2005.12.035. [DOI] [PubMed] [Google Scholar]
- 50.Liu X, et al. Elastic fiber homeostasis requires lysyl oxidase-like 1 protein. Nature genetics. 2004;36:178–182. doi: 10.1038/ng1297. [DOI] [PubMed] [Google Scholar]
- 51.Nave AH, et al. Lysyl oxidases play a causal role in vascular remodeling in clinical and experimental pulmonary arterial hypertension. Arterioscler Thromb Vasc Biol. 2014;34:1446–1458. doi: 10.1161/ATVBAHA.114.303534. [DOI] [PubMed] [Google Scholar]
- 52.Nepomuceno AI, Gibson RJ, Randall SM, Muddiman DC. Accurate identification of deamidated peptides in global proteomics using a quadrupole orbitrap mass spectrometer. Journal of proteome research. 2014;13:777–785. doi: 10.1021/pr400848n. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 53.Chiquet-Ehrismann, R. & Tucker, R. P. Tenascins and the importance of adhesion modulation. Cold Spring Harb Perspect Biol3, doi:10.1101/cshperspect.a004960 (2011). [DOI] [PMC free article] [PubMed]
- 54.Golledge J, Clancy P, Maguire J, Lincz L, Koblar S. The role of tenascin C in cardiovascular disease. Cardiovasc Res. 2011;92:19–28. doi: 10.1093/cvr/cvr183. [DOI] [PubMed] [Google Scholar]
- 55.Minear MA, et al. Polymorphic variants in tenascin-C (TNC) are associated with atherosclerosis and coronary artery disease. Hum Genet. 2011;129:641–654. doi: 10.1007/s00439-011-0959-z. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 56.Arike L, Peil L. Spectral counting label-free proteomics. Methods in molecular biology (Clifton, N.J.) 2014;1156:213–222. doi: 10.1007/978-1-4939-0685-7_14. [DOI] [PubMed] [Google Scholar]
- 57.Pucillo CE, et al. Interactions of promonocytic U937 cells with proteins of the extracellular matrix. Immunology. 1993;80:248–252. [PMC free article] [PubMed] [Google Scholar]
- 58.Hass R, et al. TPA-induced differentiation and adhesion of U937 cells: changes in ultrastructure, cytoskeletal organization and expression of cell surface antigens. Eur J Cell Biol. 1989;48:282–293. [PubMed] [Google Scholar]
- 59.Mas-Moruno C, Rechenmacher F, Kessler H. Cilengitide: the first anti-angiogenic small molecule drug candidate design, synthesis and clinical evaluation. Anticancer Agents Med Chem. 2010;10:753–768. doi: 10.2174/187152010794728639. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Katoh K, Mohri H, Ogawa K, Okubo T. Human Plasma Fibronectin Mediates Adhesion of U937 Cells by RGD and CS1. J Thromb Thrombolysis. 1998;5:125–134. doi: 10.1023/A:1008878012268. [DOI] [PubMed] [Google Scholar]
- 61.Koivunen E, Gay DA, Ruoslahti E. Selection of peptides binding to the alpha 5 beta 1 integrin from phage display library. J Biol Chem. 1993;268:20205–20210. [PubMed] [Google Scholar]
- 62.Dutta P, et al. Myocardial infarction accelerates atherosclerosis. Nature. 2012;487:325–329. doi: 10.1038/nature11260. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Van Agthoven JF, et al. Structural basis for pure antagonism of integrin αVβ3 by a high-affinity form of fibronectin. Nat Struc & Mol Biol. 2014;21:383–388. doi: 10.1038/nsmb.2797. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 64.Serra, A., Gallart-Palau, X., Wei, J. & Sze, S. K. Characterization of Glutamine Deamidation by Long-Length Electrostatic Repulsion-Hydrophilic Interaction Chromatography-Tandem Mass Spectrometry (LERLIC-MS/MS) in Shotgun Proteomics. Analytical chemistry, doi:10.1021/acs.analchem.6b02688 (2016). [DOI] [PubMed]
- 65.Robinson NE, et al. Structure-dependent nonenzymatic deamidation of glutaminyl and asparaginyl pentapeptides. The journal of peptide research: official journal of the American Peptide Society. 2004;63:426–436. doi: 10.1111/j.1399-3011.2004.00151.x. [DOI] [PubMed] [Google Scholar]
- 66.de Kleijn DP, et al. Local atherosclerotic plaques are a source of prognostic biomarkers for adverse cardiovascular events. Arterioscler Thromb Vasc Biol. 2010;30:612–619. doi: 10.1161/ATVBAHA.109.194944. [DOI] [PubMed] [Google Scholar]
- 67.Hao P, et al. Novel application of electrostatic repulsion-hydrophilic interaction chromatography (ERLIC) in shotgun proteomics: comprehensive profiling of rat kidney proteome. Journal of proteome research. 2010;9:3520–3526. doi: 10.1021/pr100037h. [DOI] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.