Abstract
The DNA mismatch repair (MMR) factor Mlh1–Pms1 contains long intrinsically disordered regions (IDRs) whose exact functions remain elusive. We performed cross-linking mass spectrometry to identify interactions within Mlh1–Pms1 and used this information to insert FRB and FKBP dimerization domains into their IDRs. Baker's yeast strains bearing these constructs were grown with rapamycin to induce dimerization. A strain containing FRB and FKBP domains in the Mlh1 IDR displayed a complete defect in MMR when grown with rapamycin. but removing rapamycin restored MMR functions. Strains in which FRB was inserted into the IDR of one MLH subunit and FKBP into the other subunit were also MMR defective. The MLH complex containing FRB and FKBP domains in the Mlh1 IDR displayed a rapamycin-dependent defect in Mlh1–Pms1 endonuclease activity. In contrast, linking the Mlh1 and Pms1 IDRs through FRB-FKBP dimerization inappropriately activated Mlh1–Pms1 endonuclease activity. We conclude that dynamic and coordinated rearrangements of the MLH IDRs both positively and negatively regulate how the MLH complex acts in MMR. The application of the FRB-FKBP dimerization system to interrogate in vivo functions of a critical repair complex will be useful for probing IDRs in diverse enzymes and to probe transient loss of MMR on demand.
INTRODUCTION
Intrinsically disordered regions (IDRs), characterized as being conformationally flexible, are present in roughly 30% of eukaryotic proteins. While many IDRs have unknown roles, some facilitate interactions with other proteins or between regions of the same protein. IDRs are often critical for overall protein function, but the mechanisms of action are lacking because IDRs do not have a clear structure and amino acid substitutions in IDRs often have no effect (1–3). Here, we investigate the roles that the IDRs of the highly conserved MutL family proteins play during DNA mismatch repair (MMR).
MMR acts to correct DNA misincorporation errors that arise during replication (4). In baker's yeast, DNA mismatches are recognized by the MutS homolog (MSH) proteins Msh2–Msh6 and Msh2–Msh3. These proteins act as ATP-modulated sliding clamps to recruit MLH proteins, principally Mlh1–Pms1, which nick the newly replicated strand of DNA in the vicinity of the mismatch through steps that require interactions with the DNA polymerase processivity clamp PCNA (Figure 1A; 5–8). ATP binding by Mlh1–Pms1 stimulates its endonuclease activity on double-stranded DNA, and this stimulation is significantly greater on DNA substrates loaded with PCNA (9–13). Nicks located 5′ to the mismatch act as entry sites for Exo1, a 5′ to 3′ exonuclease, to digest the DNA strand containing the misincorporation error. The single stranded binding protein RPA then coats the ssDNA gap, after which DNA polymerase δ (and possibly DNA polymerase ϵ; 14) resynthesizes the gapped DNA. A partially redundant Exo1-independent mechanism requires Mlh1–Pms1 to make multiple nicks on the newly replicated strand in the vicinity of the mismatch, enabling DNA polymerase δ to remove the mismatch via DNA synthesis and strand displacement. The nicks generated by both pathways are sealed by DNA ligase (9,15–18).
Single molecule studies have provided a mechanistic view of how Mlh1–Pms1 interacts with MSH proteins and mismatched DNA (Figure 1A). Studies by Gorman et al. (6,19) showed that Mlh1–Pms1 is targeted to lesion-bound Msh2–Msh6 by one-dimensional hopping and three-dimensional diffusion mechanisms, and the addition of ATP provoked the release of Msh2–Msh6/Mlh1–Pms1 from mismatched DNA. How do the MLH proteins accomplish these diffusion steps? Initial hints came from atomic force microscopy and ATP hydrolysis analyses which showed that ATP binding by Mlh1–Pms1 is accompanied by conformational rearrangements involving IDRs in both subunits (Figure 1B; 20–22). Mlh1 (IDR is 164 amino acids in length) and Pms1 (IDR is 295 amino acids in length) each contain IDRs separated by globular N- and C-terminal domains (Supplementary Figure S1A; 20,23–26). Kim et al. (9) showed that an MMR defective Mlh1–Pms1 complex containing shorter IDRs retained wild-type DNA binding affinity but showed diffusion defects on both naked and nucleosome-coated DNA. They also showed that the IDRs regulated the ATP hydrolysis and nuclease activities encoded by the N- and C-terminal domains of the complex, respectively. These studies suggest multi-functional roles for IDRs in regulating Mlh1–Pms1 diffusion on DNA and nucleolytic processing. Liu et al. (27) showed that Escherichia coli MutS sliding clamps recruited MutL on mismatched DNA to form a MutS-MutL search complex. In their model they hypothesized that ‘an open conformation of EcMutL is required to interact with EcMutS sliding clamps, which then binds ATP to form a second, exceedingly stable, ring-like clamp’ that acts as a search complex (27,28).
The above models argue that the MLH IDRs play key roles in facilitating these steps (9,21,29), but it remains unclear how they occur. Sacho et al. (21) and Kunkel and Erie (4) proposed that ATP binding to the Mlh1 subunit of the Mlh1–Pms1 heterodimer promotes the formation of a one-armed collapsed complex in which the N-terminal ATP binding domain of Mlh1 and its IDR fold into or near the C-terminal Mlh1–Pms1 domain (Figure 1B). ATP binding to Pms1 then condenses its linker arm to yield a condensed complex that positions the N-terminus of Mlh1 and Pms1 in proximity to the C-terminal domains. This conformational change, modulated through the IDR domains of both proteins, is hypothesized to change Mlh1–Pms1 affinity for DNA and activate its endonuclease activity located at the C-terminus of Pms1 (11,21,30–32).
We performed a direct test of the above models by inserting FRB and FKBP dimerization domains into the Mlh1 and Pms1 IDRs. The FRB and FKBP domains form tight dimers upon the addition of the small molecule rapamycin (33). Introducing both FRB and FKBP domains into the Mlh1 IDR conferred in the presence of rapamycin a null MMR phenotype. This condition also disrupted the endonuclease activity of Mlh1–Pms1, showing that changes in conformation in the Mlh1 IDR are critical for MMR. We also inserted FRB and FKBP domains into each IDR and showed that strains containing these constructs displayed strong MMR defects when grown in the presence of rapamycin. In vitro studies of one such complex showed that MMR defects were accompanied by the inappropriate activation of Mlh1–Pms1 and a defect in Mlh1–Pms1 binding to DNA. Our observations indicate that the MLH IDRs mediate dynamic conformational steps required for Mlh1–Pms1 to form a clamp on DNA and for licensing subsequent repair steps. Importantly, we provide a general strategy to reversibly lock conformational changes in IDR domains that can be used to study a diverse number of cellular processes.
MATERIALS AND METHODS
Media
Saccharomyces cerevisiae strains were grown at 30°C in either yeast extract-peptone-dextrose (YPD) media or minimal selective media (SC; 34). When required, geneticin (Invitrogen, San Diego) was added at 200 μg/ml (35).
Strains
S288c background derived yeast strains are listed in Supplementary Table S1, with details regarding their construction available upon request. Briefly, the rapamycin resistant strain EAY4450, derived from EAY1269, was constructed as described by Zhu et al. (36) for the yeast strain JJY70. Plasmids bearing MLH1 and PMS1 derivatives (Supplementary Table S2) were digested with the appropriate restriction enzymes and introduced into EAY4450 using methods described in Rose et al. (34) and Gietz et al. (37). mlh1Δ derivatives of EAY4450, EAY4488-4490, were constructed by digesting pEAI160 (mlh1Δ::KanMX) with the SphI and KpnI prior to transformation. All integrants were genotyped by PCR using primers that map outside of the restriction sites used for integration, and the presence of specific alleles was confirmed by DNA sequencing.
Plasmids
Plasmids used in this study are listed in Supplementary Table S2. Briefly, integration vectors (pEAA672, 674, 675, 713 derived from pEAA213-MLH1::KanMX; pEAI453, 454, 455, 468, derived from pEAA238-PMS1) containing FRB or FKBP insertions were constructed using HiFi Gibson cloning (New England Biolabs, Ipswich, MA), with PCR fragments generated from pEAA213 or pEAA238, and gBlocks (Integrated DNA Technologies, Coralville, IA) encoding FRB and FKBP protein domains (23,38,39). The FRB and FKBP domains were inserted immediately after the indicated amino acid position of Mlh1 and Pms1 (Supplementary Figure S1A). PMS1 integration vectors were constructed through HiFi Gibson cloning by inserting the LEU2 gene from pRS415 (40) downstream of PMS1 in the ARS-CEN vectors pEAA671, 676, 677, and 678. MLH1 (pEAE 269, 446, 447, 448, 460) and PMS1 (pEAE431, 433, 435) protein expression vectors were derived from pMH1 (GAL1-MLH1-VMA-CBD,2μ, TRP1) and pMH8 (GAL10-PMS1,2μ, LEU2), respectively (41). The DNA sequence of the open reading frames (including 300 bp upstream and 150 bp downstream) of constructs was confirmed by Sanger DNA sequencing (Cornell BioResource Center). The amino acid sequence of the FRB insertions, with glycine (G) and serine (S) linkers shown in bold is: GSILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLLQAWDLYYHVFRRISKGS. The amino acid sequence of the FKBP insertions, with glycine and serine linkers shown in bold is: GSGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLEGS (33,39).
lys2::insE-A14 reversion assay (Tables 1, 2)
Table 1.
Relevant genotype in tor1-1, fpr1Δ background | Mutation rate (×10−7) (95% CI) | n | Relative to wild-type | Mutation rate (×10−7) (95% CI) | n | Relative to wild-type |
---|---|---|---|---|---|---|
With 2 μg/ml rapamycin | ||||||
wild-type | 2.44 (1.96–2.91) | 64 | 1 | 2.25 (2.04–3.32) | 38 | 0.92 |
mlh1Δ | 12 500 (10 900–17 100) | 15 | 5110 | 13 100 (7890–18 200) | 15 | 5370 |
Single IDR Insertions | ||||||
MLH1 integrations | ||||||
mlh1-FRB355 | 4.45 (3.18–15.6) | 15 | 1.82 | 253 (125–327) | 15 | 104 |
mlh1-FKBP464 | 12.1 (5.79–26.5) | 15 | 4.94 | 256 (183–305) | 15 | 105 |
mlh1-FRB464 | 6.39 (3.75–7.59) | 15 | 2.62 | 154 (118–294) | 15 | 62.1 |
mlh1-FRB355, FKBP464(Complex #1) | 127 (109–171) | 30 | 51.9 | 12 700 (10 400–16 100) | 30 | 5190 |
PMS1 integrations | ||||||
pms1-FRB460 | 4.73 (2.21–6.47) | 15 | 1.93 | 24.5 (18.1–31.5) | 15 | 10.0 |
pms1-FKBP460 | 4.03 (1.84–4.35) | 15 | 1.65 | 54.9 (45.1–82.4) | 15 | 22.5 |
pms1-FRB627 | 8.16 (5.72–11.7) | 15 | 3.34 | 64.9 (53.9–131) | 15 | 26.6 |
pms1-FKBP627 | 11.4 (8.47–16.4) | 15 | 4.69 | 242 (220–286) | 15 | 99.2 |
Double IDR insertions | ||||||
MLH1, PMS1 integrations | ||||||
mlh1-FKBP464, pms1-FRB627(Complex #2) | 16.4 (12.2–19.2) | 15 | 6.72 | 194 (142–232) | 15 | 79.5 |
mlh1-FRB464, pms1-FKBP460(Complex #3) | 4.03 (3.37–6.35) | 15 | 1.65 | 2400 (1740–3490) | 15 | 984 |
mlh1-FKBP464, pms1-FRB460(Complex #4) | 5.49 (3.47–6.56) | 15 | 2.25 | 2830 (2230–4530) | 15 | 1160 |
mlh1-FRB355, pms1-FKBP460(Complex #5) | 12.5 (4.58–15.8) | 15 | 5.12 | 3520 (2690–4160) | 15 | 1440 |
mlh1-FRB355, pms1-FKBP627(Complex #6) | 184 (165–220) | 15 | 75.5 | 2630 (2340–4200) | 15 | 1080 |
Post-rapamycin treatment* | ||||||
wild-type | 3.11 (1.80–6.78) | 15 | 1.27 | |||
mlh1-FRB355, FKBP464 (Complex #1) | 162 (77.5–190) | 15 | 66.4 |
The indicated alleles were integrated into their native MLH1 or PMS1 loci in the S288C strain background. Strains were tested for DNA mismatch repair functions in the presence and absence of 2 μg/ml of rapamycin using the lys2-A14 reversion assay (Materials and Methods) with 95% confidence interval (CI) presented. The wild-type strain for these experiments, EAY4450, was generated by deleting the FPR1 locus and introducing the tor1-1 (S1972A) allele into EAY1269. n represents the number of independent measurements from at least two transformants. *Wild-type and mlh1-FRB355,FKBP464-PMS1 (Complex #1) strains were grown in the presence of rapamycin, after which independent colonies from these strains were grown in the absence of rapamycin, and then the mutation rate was determined.
Table 2.
Relevant genotype in tor1-1, fpr1Δ background | Mutation rate (×10−7) (95% CI) | n | Relative to wild-type | Mutation rate (×10−7) (95% CI) | n | Relative to wild-type |
---|---|---|---|---|---|---|
with 2 μg/ml rapamycin | ||||||
Strains containing empty vector | ||||||
wild-type, pRS416 | 3.22 (1.79–4.06) | 15 | 1 | 2.11 (1.54–3.61) | 15 | 1 |
mlh1Δ, pRS416 | 23 300 (11 500–24 200) | 15 | 7230 | 13 100 (11 100–18 100) | 15 | 6190 |
mlh1-FKBP464, pms1-FRB627, pRS416 (Complex #2) | 26.3 (17.5–31.1) | 15 | 8.15 | 303 (288–337) | 15 | 143 |
mlh1-FRB464, pms1-FKBP460, pRS416 (Complex #3) | 8.23 (6.02–13.2) | 15 | 2.55 | 2520 (2340–3840) | 15 | 1190 |
mlh1-FKBP464, pms1-FRB460, pRS416 (Complex #4) | 8.95 (4.95–11.5) | 15 | 2.78 | 2950 (1550–5040) | 15 | 1390 |
mlh1-FRB355, pms1-FKBP460, pRS416 (Complex #5) | 25.8 (17.7–34.8) | 15 | 8.02 | 3480 (2450–4080) | 15 | 1650 |
mlh1-FRB355, pms1-FKBP627, pRS416 (Complex #6) | 432 (284–526) | 15 | 136 | 3170 (2450–3980) | 15 | 1500 |
Strains containing pMLH1, PMS1 | ||||||
wild-type, pEAA67 | 2.75 (1.94–3.57) | 15 | 1 | 2.80 (2.06–4.45) | 15 | 1 |
mlh1Δ, pEAA67 | 4.16 (2.52–5.93) | 15 | 1.51 | 4.32 (2.56–6.67) | 15 | 1.5 |
mlh1-FKBP464, pms1-FRB627, pEAA67 (Complex #2) | 3.01 (1.74–5.83) | 15 | 1.1 | 68.7 (55.8–86.9) | 15 | 24.5 |
mlh1-FRB464, pms1-FKBP460, pEAA67 (Complex #3) | 4.37 (3.03–6.64) | 15 | 1.59 | 314 (186–446) | 15 | 112 |
mlh1-FKBP464, pms1-FRB460, pEAA67 (Complex #4) | 4.32 (2.45–8.83) | 15 | 1.57 | 687 (496–1327) | 15 | 245 |
mlh1-FRB355, pms1-FKBP460, pEAA67 (Complex #5) | 6.15 (5.24–7.57) | 15 | 2.24 | 898 (875–1078) | 15 | 320 |
mlh1-FRB355, pms1-FKBP627, pEAA67 (Complex #6) | 71.7 (47.6–93.5) | 15 | 26.1 | 788 (529–1131) | 15 | 281 |
MLH1, pms1-FKBP460, pmlh1-FRB355, PMS1* | 4.32 (2.61–10.4) | 15 | 1.57 | 848 (416–1050) | 15 | 303 |
mlh1 strains containing pMLH1 | ||||||
wild-type, pEAA213 | 2.35 (1.93–3.97) | 15 | 1 | 1.77 (1.11–3.45) | 15 | 1 |
mlh1Δ, pEAA213 | 2.69 (1.22–4.78) | 15 | 1.14 | 2.11 (1.85–4.78) | 15 | 1.2 |
mlh1-FRB355, pEAA213 | 3.54 (2.68–5.08) | 15 | 1.27 | 9.45 (2.47–13.8) | 15 | 5.1 |
mlh1-FKBP464, pEAA213 | 4.98 (2.58–6.22) | 15 | 1.79 | 12.6 (5.54–20.3) | 15 | 6.82 |
mlh1-FRB464, pEAA213 | 3.22 (1.59–5.56) | 15 | 1.16 | 4.62 (2.51–7.07) | 15 | 2.49 |
The indicated strains were transformed with either an empty vector (pRS416), an ARS-CEN plasmid expressing MLH1, PMS1, MSH2 (pEAA67), or an ARS-CEN plasmid expressing MLH1 (pEAA213). Strains were tested for DNA mismatch repair functions both in the presence and absence of 2 μg/ml of rapamycin using the lys2-A14 reversion assay (Materials and Methods). * EAY4495 (relevant genotype MLH1, pms1-FKBP460) was transformed with an ARS-CEN plasmid expressing mlh1-FRB355 (pEAA672) and an ARS-CEN plasmid expressing PMS1 (pEAA248). 95% confidence intervals (CI) are presented. n represents the number of independent measurements from at least two transformants.
Assays were performed as described previously (9). Briefly, strains listed in Supplementary Table S1 were freshly struck from frozen stocks and grown in synthetic complete media in the presence or absence of rapamycin (2 μg/ml) and then inoculated in liquid complete media maintaining either the presence or absence of rapamycin prior to plating onto complete and lysine dropout plates. Strains containing plasmids were grown in minimal selective leucine dropout, to maintain pEAA213, or uracil dropout, to maintain pRS416 and pEAA67. Rapamycin was included in growth media until just before cell cultures were plated onto complete and lysine dropout plates to measure lys2::insE-A14 reversion. Rates of lys2::insE-A14 reversion were calculated as μ = f/ln(N·μ), where f is reversion frequency and N is the total number of revertants in the culture (42). For each strain, 15–64 independent cultures, obtained from two to three independent transformants bearing a unique allele, were assayed on at least two different days to prevent batch effects, and 95% confidence intervals and all computer‐aided rate calculations were performed as described previously (9,43). For the post-rapamycin treatment described in Table 1, the wild-type and Complex #1 strains were grown both in the presence and absence of rapamycin (2 μg/ml) and then inoculated in liquid complete media maintaining either the presence or absence of rapamycin prior to plating onto complete and lysine dropout plates. Upon colony counting after 3 days of incubation, a single colony from the complete plate was inoculated in liquid media lacking rapamycin and then assayed again for mutator phenotype.
Biochemical assays
Cross-linking mass spectrometry (XL-MS)
Mlh1–Pms1 and Complex #5 were crosslinked with disuccinimidyl sulfoxide (DSSO; Thermo Fisher Scientific). A 50 mM stock solution of DSSO was freshly prepared by dissolving DSSO into anhydrous dimethyl sulfoxide (DMSO). 5 μg of Mlh1–Pms1 and Complex #2 and #5 derivatives were incubated in 50 μl of buffer containing 25 mM HEPES pH 8.0, 180 mM NaCl, 10% glycerol). DSSO was included at a final concentration of 1.25 mM and the reaction was then incubated for 30 min at room temperature. Reactions were quenched by the addition of Tris–HCl pH 8.0 to a final concentration of 10 mM. Samples were digested and processed for MS as described in Yugandhar et al. (44). In brief, the cross-linked samples were denatured with 1% sodium dodecyl sulfate (SDS) at 65°C for 15 min, reduced by 1 mM dithiothreitol (DTT) at room temperature for 15 min, and then alkylated with 25 mM iodoacetamide at room temperature for 15 min. Proteins were precipitated by adding 3× volumes of cold acetone/ethanol/acetic acid solution (50:49.9:0.1, v/v/v). The precipitates were resuspended in 8 M urea, 50 mM Tris–Cl and 150 mM NaCl, pH 8.0. After dilution to 2 M Urea, trypsin (Trypsin Gold, Promega, Madison, WI) digestion was performed at 37°C overnight. Trifluoroacetic acid-formic acid (TFA-FA) solution was applied to terminate digestion. The digested peptides were desalted using Sep-Pak C18 cartridge (Waters, Dublin, Ireland), dried using SpeedVac™ Concentrator (Thermo Fisher Scientific, Pittsburgh, PA) and stored in –80°C for further analysis.
Peptides were resuspended in 0.1% TFA and then analyzed using an Orbitrap Fusion Lumos Tribrid mass spectrometer (Thermo Fisher Scientific) coupled online to an EASY-nLC 1200 system (Thermo Fisher Scientific) equipped with a 75 μm × 25 cm capillary column (in-house packed with 3 μm C18 resin; Michrom BioResources). For each analysis, peptides were eluted using a 45 min liquid chromatography gradient (5% B–40% B; mobile phase A composed of 0.1% formic acid (FA), and mobile phase B composed of 0.1% FA and 80% acetonitrile (ACN)) at a flow rate of 200 nl/min.
The CID-MS2-HCD-MS3 acquisition method was used for DSSO-crosslinking identification. The MS1 precursors were detected in the Orbitrap mass analyzer at resolution of 60 000 with a scan range from 375 m/z to 1500 m/z. The precursor ions with the charge of +4 to +8 were selected for MS2 analysis at a resolution of 30 000 (AGC target = 1 × 105, precursor isolation width = 1.6 m/z, and maximum injection time = 105 ms), with the normalized collision energy of CID at 25%. The two most abundant reporter ions with a mass difference of 31.9721 Da in CID-MS2 spectra were selected for further MS3 analysis. The selected ions were fragmented in an Ion Trap using HCD with the normalized collision energy at 35% and AGC target of 2 × 104. All spectra were recorded by Xcalibur 4.1 software and Orbitrap Fusion Lumos Tune Application v. 3.0 (Thermo Fisher Scientific).
The cross-link search was performed using MaXLinker software (44). The wildtype and engineered Mlh1–Pms1 cross-linked samples were searched against database with corresponding target and randomized sequences, along with randomized sequences of E. coli proteome (5268 sequences) for efficient FDR estimation. Crosslink maps for Mlh1–Pms1 are a composite of results from two independent crosslink trials.
Protein purification
Mlh1–Pms1 and Complex #1 to #5 variants (Supplementary Figure S1B) were purified as described from galactose-induced cultures of BJ2168 (MATa, ura3-52, leu2-3,112, trp1-289, prb1-1122, prc1-407, pep4-3) bearing pEAE expression vectors (Supplementary Tables S1, S2; 23,41). The MLH1 expression constructs pEAE 446–448 contain a FLAG tag at position 499 (with respect to the wild-type sequence). RFC and PCNA were expressed and purified from E. coli (45,46). All biochemical assays were performed with at least two independently purified Mlh1–Pms1 complexes.
DNA substrates for biochemical assays
Closed circular pUC18, and when specified pUC19 (both are 2.7 kb and are nearly identical in sequence, with only the polylinker regions reversed, Thermo Fisher Scientific, Waltham, MA), were used as DNA substrates in the endonuclease assays presented in Figures 3 and 4, and Supplementary Figures S2 to S4. A 49-mer homoduplex DNA substrate was included in the ATPase experiments presented in Figures 3B, 4B and Supplementary Figure S2B. This substrate was made by annealing AO3142 (5′GGGTCAACGTGGGCAAAGATGTCCTAGCAAGTCAGAATTCGGTAGCGTG) and AO3144 (5′CACGCTACCGAATTCTGACTTGCTAGGACATCTTTGCCCACGTTGACCC). AO3142 and AO3144 were added at an equal molar ratio in buffer containing 10 mM Tris–HCl, pH 7.5, 100 mM NaCl, 10 mM MgCl2 and 0.1 mM EDTA. These oligonucleotides were annealed through an incubation at 95°C for 5 min, followed by cooling to 25°C at a rate of 1°C/min. Following annealing, excess single-stranded DNA was removed using an S300 spin column (GE Healthcare). For the microscale thermophoresis (MST) analysis presented in Figures 3A, 4A, Supplementary Figure S2A, a 48-mer homoduplex DNA substrate was made by annealing AO4549 (5′-6-FAM-CTGGACGGGTTAAGACCGAACGTGGCTCCAGAAACGGGTGCAACTGGG; synthesized by Integrated DNA technologies) and AO4548 (5′CCCAGTTGCACCCGTTTCTGGAGCCACGTTCGGTCTTAACCCGTCCAG) as described above.
Endonuclease assays
Reactions were performed in 20 μl in 1× endonuclease buffer (20 mM HEPES–KOH (pH 7.5), 20 mM KCl, 2.5 mM MnSO4, 0.2 mg/ml BSA, 1% glycerol; Ref. 47). Mlh1–Pms1, Complex #1, Complex #2, or Complex #5 were included at final concentrations of 6.25–100 nM. When indicated, rapamycin was included at a final concentration of 1 μM. Rapamycin was dissolved into DMSO at a concentration of 10 mM then serially diluted in DMSO to a final concentration of 100 μM. The 100 μM solution was then diluted in 1× endonuclease reaction buffer to a concentration of 20 μM before being added to individual reaction tubes at a final concentration of 1 μM. Rapamycin was added to the reaction before the addition of the DNA substrate and the reaction was incubated at 37°C for 5 min prior to DNA addition. Reactions (37°C, 40 min) were started following the addition of 5.1 nM final concentration of pUC18 (or pUC19 when indicated, no differences were seen for MLH endonuclease activity on these substrates) and stopped by the addition (final concentrations shown) of 0.1% SDS, 14 mM EDTA and 0.1 mg/ml Proteinase K (New England Biolabs). DNA was electrophoresed in 1.2% agarose gels in 1xTAE (Tris-acetate-EDTA) containing 0.1 μg ml−1 ethidium bromide, which causes covalently closed circular DNA isoforms to separate from nicked DNA product. Gels were run in 1× TAE at 100 V for 45 min. Negative control lanes were used as background and were subtracted out of reported quantifications. BioRad Image Lab Software, v5.2.1 was used to quantify gels.
ATPase assays
ATPase activity was determined using the Norit A absorption method described previously (9,47). Briefly, 30 μl reactions contained 0.4 μM of Mlh1–Pms1, Complex #2, or Complex #5, 100 μM [γ-32P]-ATP, 20 mM Tris, pH 7.5, 2.0 mM MgCl2, 0.1 mM DTT, 1 mM MnSO4, 75 mM NaCl, 1% glycerol, 40 μg/ml BSA. Reactions were incubated for 40 min at 37°C. When specified, DNA (49-mer homoduplex DNA substrate), PCNA, and rapamycin were included at 0.75, 0.5 and 1 μM, respectively. Just prior to addition, rapamycin was diluted and included in reactions as described for the endonuclease assays.
Microscale thermophoresis (MST) assay
MST was performed using a Monolith NT.115 instrument (NanoTemper Technologies) equipped with red and blue filters using methods described in 48). MLH complexes were serially diluted 16 times in 2-fold steps to final concentrations of 4400 to 2.14 nM for Mlh1–Pms1, 4000 to 1.95 nM for Complex #2, and 4800 to 2.34 nM for Complex #5, and then mixed with an equal volume of a 40 nM solution of 6-FAM-labeled duplex oligonucleotide (sequence described above). Reaction buffer contained 20 mM Tris–HCl (pH 7.5), 20 mM NaCl, 0.01 mM EDTA, 2 mM MgCl2, 40 μg/ml BSA, 0.1 mM DTT and 0.05% TWEEN-20. Assays with nucleotide, rapamycin, or both contained 1 mM ATP and 1 μM rapamycin. ATP and rapamycin were added to reactions containing Mlh1–Pms1 prior to DNA addition. The reactions (20 μl volumes) were then incubated for 5 min at room temperature. Following DNA addition, reactions were incubated at room temperature at 30 ºC for 15 min. They were then loaded into standard capillaries (NanoTemper Technologies). Reactions were then tested with 40% excitation power, medium MST power, and measured using M.O. Control software (NanoTemper Technologies). M.O. Affinity Analysis software (version 2.3, Nanotemper Technologies) was used to analyze data and determine the normalized fluorescence (Fnom) for each concentration. Fnorm is calculated by dividing Fhot (average fluorescence value in the heated state) by Fcold (average fluorescence value measured in the cold state before the infrared (IR) laser is turned on) and plotted as parts per thousand (%). Three independent reactions were measured to obtain Fnorm values, which were then averaged (mean ± standard deviation) and plotted against the respective concentration of Mlh1–Pms1 (Figures 3A, 4A, Supplementary Figure S2A). Binding constants (Kd) were determined by nonlinear curve fitting using GraphPad Prism 9. All experiments were performed using at least two independently purified proteins.
RESULTS
Mlh1–Pms1 inter-subunit interactions involve the N-terminal, IDR and C-terminal domains of both proteins
We used cleavable cross-linking coupled with mass spectrometry (XL-MS) as a tool to map intra- and inter-subunit interactions in Mlh1–Pms1. In this approach, disuccinimidyl sulfoxide (DSSO; Materials and Methods) was used to cross-link exposed lysine residues in close proximity (10.1 angstrom spacer length; 44,49). While this method cannot yield detailed structural information, it can identify regions of proteins that potentially interact and thus give insights into the movements of Mlh1–Pms1 during MMR. We were unable to perform XL-MS in the presence of ATP or the non-hydrolysable ATP analog AMP-PMP because the primary amines present in these molecules interfered with our detection of DSSO-induced cross-linking by mass spectrometry. Also, we did not attempt XL-MS with an ATP analog that lacks the primary amine, 6-methyl ATP, because this analog did not activate Mlh1–Pms1’s latent endonuclease activity.
We identified large numbers of crosslinks involving the IDRs in Mlh1–Pms1 (76 of 102 crosslinks; Figure 2A and Supplementary Table S3), indicating that the IDRs are highly flexible, solvent exposed, and are capable of interacting with nearby partners. Crosslinks were also seen between the Mlh1 and Pms1 C-terminal domains, consistent with the C-terminal domains being required for Mlh1–Pms1 interactions (32), and between the ATP binding (N-terminal) domains of Mlh1 and Pms1, consistent with structural and biochemical studies showing that these domains interact when both domains are ATP bound (11,30). Interestingly, many of the 15 inter-subunit crosslinks map to regions of Mlh1 and Pms1 that are genetically critical for their function (see asterisks in Figure 2A, Supplementary Table S4; 11,23,25,50). Lastly, crosslinks were identified between the Mlh1 IDR and the Pms1 C-terminal endonuclease domain, providing evidence for models in which the condensation of the N- and C-termini of MLH proteins is linked to the activation of MLH functions (21,30- 32).
Rapamycin-induced disruption of MMR in vivo
The identification of regions within the IDRs of Mlh1 and Pms1 that had few if any crosslinks (Figure 2A) and could be deleted without impacting MMR functions (Supplementary Figure S1A; 23) encouraged us to develop a method to restrict any potential coordinated interactions that drive MMR functions. We employed a chemically inducible system to control the dimerization of a pair of proteins with a small molecule that acts as a ‘dimerizer’. Dimerizers can reversibly bring regions of proteins together that normally lack interaction and have been used to study mechanistic aspects of protein localization, sister chromatid cohesion, targeted protein degradation, transcriptional control and signal transduction (36,38,39,51–53). Specifically, we targeted the Mlh1 and Pms1 IDRs through the 11 kDa FKBP–rapamycin binding (FRB) domain of the mammalian target of rapamycin protein (mTOR) protein and the 12-kDa FK506 binding protein (FKBP; Figure 2A; 33). The FRB (93 amino acids) and FKBP (107 amino acids) polypeptides are relatively small and each bind to the small molecule macrolide rapamycin. Rapamycin binding to each domain facilitates a stable and tight FRB-FKBP heterodimer (Kd in the sub nM range; 54,55). We first tested if we could reversibly inhibit MMR by restricting the motion of the linker arm of Mlh1 in the presence of rapamycin (Complex #1, Figure 2B). We chose Mlh1 as our initial target because Mlh1 has been proposed to initiate Mlh1–Pms1 IDR condensation (Figure 1B; 4,21,27). We then tested the effects of disrupting the Mlh1 IDR movement genetically, using a reversion assay with a wide range of sensitivity, and biochemically, by measuring Mlh1–Pms1 DNA binding, ATPase, and endonuclease activities.
In the first experiment, FRB and FKBP were introduced in tandem into the Mlh1 IDR (Figure 2B, Supplementary Figure S1A). The effects of these insertions were assessed using a highly sensitive reversion assay in which an insertion of 14 adenosine residues disrupts the LYS2 open reading frame (lys2-A14). Frameshift mutations (primarily –1) which restore the open reading frame are detected as Lys+ colonies. An mlh1Δ strain shows a nearly four-orders of magnitude (5000 to 6000-fold) higher rate of reversion to Lys+ compared to wild-type (9,42). As shown in Table 1, single insertions of FRB or FKBP in Mlh1 conferred reversion rates that were only marginally higher than wild-type (1.8- to 4.9-fold). As shown in Table 1, the double insertion allele, mlh1-FRB355-FKBP464, (referred to as Complex #1) conferred a very weak reversion phenotype (51.9-fold). The single domain insertion mlh1 alleles conferred higher reversion rates when rapamycin was added (68- to 114-fold), but to a much lower level than seen for mlh1Δ (5400-fold). One reason for the modest increase in reversion rate for the single insertion strain grown with rapamycin is that both FRB and FKBP bind rapamycin, and such binding could impact MMR by altering Mlh1 IDR flexibility. Alternatively, rapamycin binding proteins in the yeast cell other than Fpr1 (the yeast homolog of human FKBP, deleted in our strain background) may be able to weakly interact with FRB or FKBP, blocking Mlh1 from interacting with partners or mismatch substrates. Consistent with the latter idea is that the single domain insertion alleles were recessive (Table 2); if rapamycin impacted IDR function, one might have expected to still see a mutator phenotype when the FRB and FKBP insertion alleles were expressed in the presence of wild-type MLH1, though at lower levels (see below).
In contrast to the single FRB and FKBP mlh1 insertion strains grown in the presence of rapamycin, a complete MMR defective phenotype was observed for the mlh1-FRB355-FKBP464 double insertion allele (Complex #1) in the presence of rapamycin, a phenotype identical to that seen when the Mlh1 IDR was completely deleted (23). We then asked if MMR can be re-initiated when rapamycin is washed out of the media in mlh1-FRB355-FKBP464 strains. With rapamycin removed, MMR activity of the mlh1-FRB355-FKBP464 (Complex #1) strain returned to pre-rapamycin levels (Table 1). This indicates that MMR functions can be reversibly and specifically modulated using a small molecule.
Rapamycin-induced interactions between Mlh1 and Pms1 IDRs disrupt MMR
MLH clamp formation is hypothesized to create a condensed state poised for endonuclease activation upon encountering PCNA on DNA (9,13,27). Based on this model we thought that restricting MLH clamp formation through FRB-FKBP interactions would inhibit MMR, and that such inhibition could be detected in biochemical assays. We constructed five additional Mlh1–Pms1 FRB/FKBP insertion complexes that maintained roughly wild-type levels of MMR in the absence of rapamycin (Figure 2B). This wild-type function was also seen when one subunit contained the FRB/FKBP insertion and the other a wild-type partner, indicating that the FRB/FKBP insertions were well tolerated (Table 2).
Complexes that restrain the IDRs of Mlh1 or Pms1 near the N-terminal region displayed similar and strong MMR defects in the presence of rapamycin (Complexes 3–6; 984- to 1440-fold higher reversion rate to Lys+; Table 1). Complex #2, predicted to restrain the IDRs of Mlh1 and Pms1 near their C-terminal regions, conferred weak MMR defects (79.5-fold). Interestingly, the small increase in reversion rate for Complex #2 seen in the presence of rapamycin was very similar to the rate seen when the FRB and FKBP insertion alleles in Complex #2 were expressed in the presence of a wild-type partner, indicating that the effect of rapamycin on Complex #2 function was minimal (Table 1). One explanation for these phenotypes is that interactions predicted to restrain the coordinated movements of the N-terminal ATP binding domains (Complexes 3–6) disrupt MMR whereas those predicted to maintain free movement of the N-terminal ATP binding domains (Complex #2) do not. However, we cannot exclude the possibility that the efficiency of FRB-FKBP dimerization is compromised for Complex #2.
We asked if Complexes 2–6 expressed in the presence of similar levels of wild-type complex would display evidence of subunit mixing. If this was the case, then one quarter of the complexes in a cell would be expected to contain FRB and FKBP insertions in the same heterodimer (evidence for intra-complex interactions), and the reversion rate for cells expressing both the complex and wild-type Mlh1–Pms1 in the presence of rapamycin would be expected to be one quarter of the rate seen when only the complex was expressed. If inter-complex interactions were prevalent then we would have expected to see at most a two-fold reduction in reversion rate. As shown in Table 2, the reversion rates for the five complexes expressed in the presence of rapamycin and wild-type Mlh1–Pms1 were roughly one quarter of the rates seen when only the complexes containing FRB and FKBP domains were expressed. Specifically, Mlh1–Pms1 presence/absence reversion rate ratios were 0.23, 0.12, 0.23, 0.26 and 0.25 for Complexes 2, 3, 4, 5 and 6, respectively. These observations are consistent with rapamycin inducing interactions between FRB and FKBP insertions within single heterodimers. They are also consistent with the determination that the local concentrations of the FRB and FKBP domains within a single heterodimer are expected to be much higher (estimated to be as high as three to four orders of magnitude) than between separate Mlh1–Pms1 molecules, which are present at ∼600 copies in a single yeast nucleus (56). This calculation is based on a haploid yeast nucleus volume of 2.9 ± 0.9 μm3 (57) and Mlh1–Pms1 molecules in a haploid yeast nucleus diffusing randomly throughout the nuclear volume, with the motion of FRB and FKBP within the IDRs of the Mlh1–Pms1 heterodimer restricted to a shell of an approximately 10 nm radius (19).
The experiments presented in Table 2 and our calculation of Mlh1–Pms1 concentrations in vivo encouraged us to purify Complexes 1–5. These complexes formed stable heterodimers, remained soluble when rapamycin was added in solution, and for those tested, retained ATPase and endonuclease activities (Supplementary Figure S1B and below). Because Mlh1–Pms1 forms oligomers on DNA (22), we were concerned that the addition of rapamycin could cause neighbouring Mlh1–Pms1 complexes to aggregate and become insoluble. However, these proteins retained solubility and activity in the presence of rapamycin, providing further evidence for rapamycin promoting intra-complex interactions.
Rapamycin induced N-terminal dimerization prevents Complex #5 from stably binding to DNA
MLH proteins display DNA binding activities that are required for their MMR functions (20,23). To test if restriction of the IDRs of Mlh1–Pms1 affected DNA binding, we assayed the biochemical activities of Mlh1–Pms1, Complex #1, Complex #2 and Complex #5 in DNA binding, ATPase, and endonuclease assays. These complexes were chosen because strains bearing the corresponding mutant alleles showed a representative range of MMR defects in the absence and presence of rapamycin. Motivated by the XL-MS results, we first present biochemical analyses of Complexes 2 and 5 in which we restricted interactions between the Mlh1 and Pms1 IDRs. We then present the biochemical analysis of Complex #1 in which only the Mlh1 IDR was restricted.
We examined the binding of Complex #5, and Complex #2) to a 49 bp homoduplex oligonucleotide using Microscale Thermophoresis (MST). As shown in Figure 3A and Table 3, wild-type Mlh1–Pms1 affinity for DNA was reduced in the presence of ATP (141 nM in its absence to 675 nM in its presence). This binding was unaffected by the presence of rapamycin. The reduced binding of Mlh1–Pms1 in the presence of ATP is consistent with previous studies indicating that Mlh1–Pms1 ring opening and closing is linked to interactions with DNA (9,19,20). In the absence of rapamycin, Complex #5 DNA binding affinities were similar to Mlh1–Pms1 in both the presence and absence of ATP. The addition of rapamycin significantly reduced the DNA binding affinity for Complex #5 in the absence of ATP (775 nM for Complex #5 versus 173 nM for Mlh1–Pms1). The Kd for binding of Complex #5 in the presence of ATP and rapamycin was too weak to be determined due to the aggregation of Mlh1–Pms1 at high concentrations; however, the lower limit for the Kd, based on ∼50% binding, was estimated to be 5 μM compared to 628 nM for Mlh1–Pms1. In contrast, Complex #2, which showed a mild mutator phenotype in the presence of rapamycin, displayed a DNA binding activity similar to wild-type both in the presence and absence of rapamycin (Supplementary Figure S2A; Table 3). Together these experiments argue that the restriction of the IDRs in Complex #5 blocks the ability of Mlh1–Pms1 to form a stable complex on DNA, thus accounting for the MMR defect seen in vivo. It also matches with our previous observation that a deletion of the Pms1 IDR both disrupted DNA binding and prevented ternary complex formation of MSH and MLH proteins on a mismatched substrate (23).
Table 3.
alone | with ATP | with rapamycin | with rapamycin and ATP | |
---|---|---|---|---|
Wild-type | 141 (128–157) | 675 (584–803) | 173 (157–192) | 628 (563–709) |
Complex #1 | 98.4 (88.9–110) | 421 (378–526) | 198 (167–220) | 1030 (918–1240) |
Complex #2 | 207 (182–235) | 431 (380–494) | 211 (186–238) | 391 (347–444) |
Complex #5 | 287 (264–312) | 556 (510–610) | 775 (709–855) | ND |
Kdvalues, with 95% confidence intervals in parentheses, were determined in GraphPad Prism 9 through a nonlinear fit of graphs shown in Figures 3A, 4A and Supplementary Figure S2A. Curves were fit to data points representing the average of three independent assays. ND = not determined, due to incomplete saturation within the data acquisition range.
N-terminal dimerization in Complex #5 pre-activates Mlh1–Pms1 in vitro
We then assayed the activity of Complex #2 and #5 in ATPase and endonuclease assays (Figure 3B, Supplementary Figure S2B; 7,9,10). Previous studies showed that Mlh1–Pms1 ATPase activity is stimulated in the presence of DNA duplex oligonucleotide and PCNA (9,11–13,58). As shown in Figure 3B and Supplementary Figure S2B, we found that Mlh1–Pms1, Complex #2, and Complex #5 displayed, in the absence of rapamycin, similar ATPase activities. These activities were similar in both the presence or absence of DNA and PCNA. For Complex #2, rapamycin did not affect ATPase activity in the presence or absence of DNA and PCNA. However, for Complex #5 the addition of rapamycin resulted in significant increases in ATPase activities (∼two-fold) both in the absence and presence of DNA and PCNA (Figure 3B).
We next measured the endonuclease activity of Complex #2 and #5 (Figure 3C, D; Supplementary Figure S2C, D). In the absence of rapamycin both complexes displayed comparable levels of PCNA stimulation of endonuclease activity compared to Mlh1–Pms1. We then performed these experiments in the presence of rapamycin and found that rapamycin did not impact Mlh1–Pms1 or Complex #2 endonuclease activity; however, Complex #5 displayed an endonuclease activity that was higher (∼33% elevated) than seen for Mlh1–Pms1 (Figure 3D, Supplementary Figure S2D). Taken together, these observations indicate that Complex #5 is inappropriately activated in a manner that disrupts MMR.
Finally, we analyzed Complex #5 by XL-MS in the absence of rapamycin (Figure 2C, Supplementary Table S3). A similar number of crosslinks were observed for Complex #5 (132, of which 94 involved IDRs) and Mlh1–Pms1 (102 crosslinks). 34 inter-subunit crosslinks were identified for Complex #5, of which 25 were between Mlh1 and Pms1 residues. The remaining nine were between Pms1 and FRB residues. Of the 25 inter-subunit crosslinks involving Mlh1 and Pms1 in Complex #5, 23 contained at least one residue that was involved in an inter-subunit crosslink in Mlh1–Pms1. Lastly, 6 of the 15 inter-subunit crosslinks seen in Mlh1–Pms1 were also seen in Complex #5. These observations provided evidence for conservation of inter-molecular interactions between Mlh1–Pms1 and Complex #5. Our analysis of Mlh1–Pms1 (Figure 2A) indicated that the insertions of FRB and FKBP in Complex #5 were in locations of the two proteins that were devoid of crosslinks, supporting the deletion analysis that these locations appear to not be critical for Mlh1–Pms1 function. We did not see any crosslinks in Complex #5 between FRB and FKBP, consistent with genetic data indicating that these insertions did not interact unless rapamycin was present. We were unable to perform XL-MS in the presence of rapamycin because its addition interfered with sample preparation.
Seven novel cross-links, with some identified multiple times, were observed for Complex #5 between the Mlh1 N-terminal domain and the Pms1 IDR, reminiscent of the formation of the single-arm condensed complex involving the N-terminal domain of Mlh1 observed by Sacho et al. (21). We also saw a shift to form crosslinks between the N-terminal and IDR domains of Mlh1 and the IDR domain of Pms1. One explanation for these changes is that the addition of new FRB/FKBP domains into the IDRs is responsible for the novel crosslinks. Alternatively, the insertions shift Complex #5 into a position where it is poised to perform the condensation steps that are normally seen only in the presence of ATP. Restricting such steps, as was done in the presence of rapamycin, could thus provide an explanation for the reduced MMR functions and inappropriate endonuclease activation seen for strains containing Complex #5 grown in the presence of rapamycin.
Rapamycin induced dimerization of FRB and FKBP within the MLH1 IDR in Complex #1 disrupts Mlh1–Pms1 endonuclease activity
Kunkel and Erie (4) proposed that ATP binding to the Mlh1 subunit promotes the formation of an Mlh1-mediated one-armed collapsed complex, after which ATP binding to Pms1 yields a condensed activated state (Figure 1B). The finding that restricting the Mlh1 IDR with rapamycin conferred a null MMR phenotype (mlh1-FRB355,FKBP464 allele, Table 1) encouraged us to analyze the activity of Complex #1, which contains both the FRB and FKBP dimerization domains within the Mlh1 IDR. As shown in Figure 4A and Table 3, Complex #1 displayed a modestly stronger DNA binding affinity (Kd = 98 nM in the absence of ATP, 421 nM in the presence) compared to Mlh1–Pms1 (Kd = 141 nM in the absence of ATP, 675 nM in the presence). However, Complex #1 and Mlh1–Pms1 showed similar Kd values in the presence of rapamycin (198 nM for Complex #1, 173 nM for Mlh1–Pms1); thus, rapamycin conferred a modest decrease in Complex #1’s DNA binding affinity (98 nM in the absence to 198 nM in the presence of rapamycin). Importantly, the addition of both ATP and rapamycin significantly reduced Complex #1’s DNA binding affinity (Kd of 1029 nM), suggesting that restricting the Mlh1 IDR in Complex #1 blocked its ability to form a stable ATP-dependent condensed complex on DNA.
To better understand why Complex #1 displayed a null-like MMR defect in the presence of rapamycin, we assayed the activity of Complex #1 in ATPase and endonuclease assays (Figure 4B). The ATPase activities of wild-type and Complex #1 were similarly induced by the presence of DNA and PCNA, and the presence of rapamycin did not affect this induction. However, the endonuclease activity of Complex #1 was strongly affected by the addition of rapamycin. As shown in Figure 4C and Supplementary Figure S4A, in the absence of rapamycin, Complex #1 (31.0 ± 1.7 and 63 ± 10% nicking at 25 and 50 nM concentrations, respectively) displayed a somewhat weaker level of PCNA stimulation of endonuclease activity compared to Mlh1–Pms1 (42.0 ± 0.5 and 75 ± 12% nicking at 25 and 50 nM concentrations, respectively). However, in the presence of rapamycin, Complex #1 displayed a very strong defect in endonuclease activity (7.5 ± 2.7 and 23.0 ± 4.3% nicking at 25 and 50 nM concentrations, respectively), whereas rapamycin had no effect on wild-type protein (39.0 ± 3.0 and 74.0 ± 8.6% nicking at 25 and 50 nM concentrations, respectively).
We were curious why Complex #1’s endonuclease activity but not it's ATPase activity was affected by restricting the Mlh1 IDR (Figure 4B, C and Supplementary Figure S4A). These observations also encouraged us to understand why the mlh1-FRB355, FKBP464 allele (forming Complex #1 in vivo) conferred a weak mutator phenotype in the absence of rapamycin (51.9-fold higher than wild-type; Table 1) and why Complex #1 showed a weaker PCNA stimulated endonuclease activity compared to wild-type (Figure 4C). One possibility is that Complex #1 is capable of forming the condensed state but is compromised for the conformational rearrangements that bring the DNA strand to be nicked by Mlh1–Pms1 close to the nuclease active site. To test this, we examined the stimulation of Complex #1 at different PCNA concentrations. As shown in Figure 4D and Supplementary Figure S4B, we found that the activation of Complex #1 in the absence of rapamycin was reduced at lower PCNA levels compared to wild-type. For example, at 50 nM PCNA, 58% of pUC18 DNA was nicked by Mlh1–Pms1 whereas only 20% was nicked by Complex #1. These observations indicated that the Mlh1 IDR is important for coordinating conformational rearrangements that bring the nicked DNA strand to the nuclease active site.
DISCUSSION
In this study, we examined roles for the MLH IDRs in coordinating the recruitment of MLH proteins during MMR. We found that handcuffing the IDRs of Mlh1 and Pms1 through the use of rapamycin-induced FRB-FKBP dimerization disrupted MMR. This phenotype and biochemical analysis of defective complexes provided evidence that the MLH IDRs undergo coordinated intra and inter-subunit interactions that both positively and negatively regulated MLH complex activity (9,19,20).
Our work provides molecular evidence for Mlh1 acting as a ‘trigger’ to initiate protein–protein and enzymatic functions in MMR (Figure 1A). Disrupting the Mlh1 IDR via intra-subunit FRB-FKBP interactions in Complex #1 caused a complete defect in MMR and disrupted endonuclease activity (Figure 4). Interestingly Complex #1 could still bind to DNA in the presence of ATP and rapamycin (though more weakly than wild-type Mlh1–Pms1), consistent with our previous work (23) in which we showed that a deletion of the IDR in Mlh1 conferred a complete defect in MMR but did not dramatically affect the ability of the mutant complex to bind to DNA or interact with Msh2–Msh6. We also saw novel cross-links for Complex #5 between the Mlh1 N-terminal domain and the Pms1 IDR, suggesting the presence of a single-arm condensed complex involving the N-terminal domain of Mlh1 (21). Consistent with this observation is the finding that Complex #5 displayed an increased ATPase and nicking activity in the presence of rapamycin, suggesting that it had been activated in the absence of forming a stable complex on DNA. The idea of Mlh1 serving as a trigger is intriguing because Mlh1 serves as a common subunit for three MutL complexes in baker's yeast, Mlh1–Pms1, Mlh1-Mlh3 and Mlh1-Mlh2, where Mlh1-Mlh3 plays a minor role in MMR and a major role in the resolution of double-Holliday junctions in meiosis to form crossovers, and Mlh1-Mlh2 regulates gene conversion tract lengths in meiosis (reviewed in 59). In such a model, recruitment of various MLHs is accomplished through the initial interactions of Mlh1 with a particular repair pathway, followed by clamp formation by the specificity subunit (Mlh2, Mlh3, or Pms1) that activates the complex for its specific role. Thus, our studies provide mechanistic support for the idea that IDRs license Mlh1–Pms1 to interact stably interact with DNA during MMR. It complements previous studies showing that IDRs regulate how a DNA repair enzyme scans chromatin for DNA lesions and how repair functions (for example, nicking of the newly replicated strand during MMR) are activated (6,9,19,27,29).
How can we explain what we believe is an inappropriate activation of Complex #5 in the presence of rapamycin? As outlined in the Introduction, the MLH proteins undergo conformational changes throughout the ATP hydrolysis cycle. Studies on Bacillus MutL (31,60) have suggested that ATP-dependent conformational rearrangements bring the DNA strand to be nicked by MLH proteins close to the nuclease active site, and structural and bulk and single molecule analyses of Mlh1–Pms1 have led to a model where ATP hydrolysis by Mlh1–Pms1 returns the complex to an open state where it dissociates from DNA (11,21,30,60). Lastly, studies have suggested in eukaryotes the presence of an alternative Exo1-independent MMR pathway that involves iterative nicking through Mlh1–Pms1 complexes activated via interactions with MSH complexes and PCNA. These observation and work from Kim et al. (9) showing that the Mlh1–Pms1 ATPase activity is disrupted when the IDRs are shortened, suggest a mechanism in which disrupting the MLH conformational cycle through the IDRs impacts MLH ATPase activity. Why is Complex #5 inappropriately activated in the presence of rapamycin? We hypothesize that the IDRs in Complex #5 in the presence of rapamycin are forced into an inappropriate conformational state that promotes complex dissociation and reiterative nicking of DNA in the absence of a stable clamp state required in MMR (27). Such an explanation, which is consistent with the MMR defect seen in strains containing Complex #5 grown in the presence of rapamycin, will need to be tested in single molecule studies (6,27).
Modulation of MMR using a small molecule
We used an inducible dimerization approach to modulate MMR functions through the addition and removal of the small molecule rapamycin (33). The reversibility of this method can provide a valuable means to understand how an increased reversion rate can provide beneficial mutations to an organism adapting to changing environments (reviewed in 61,62). Elevated mutation rates, while providing a source of beneficial mutations for adaptation, are associated with long-term fitness costs due to the accumulation of deleterious mutations (63–65). In the lys2-A14 reversion assay where the difference between wild-type and MMR defective is roughly 5000-fold, we identified complexes that showed wild-type or near wild-type phenotypes in the absence of rapamycin, but a wide-range of elevated reversion rates in its presence (Table 1). For example, in the presence of rapamycin, Complex #2 conferred a 79.5-fold elevated rate compared to wild-type, Complex #3, a 984-fold higher rate, Complex #5, a 1440-fold higher rate, and Complex #1, a rate indistinguishable from mlh1 null (5190-fold). Most informative was that the null phenotype in Complex #1 could be reversed to the level observed in the absence of rapamycin. This resource can thus allow one to grow cells in stressed environments (such as high salt) and then pulse them with rapamycin for different time intervals under a variety of mutation supply conditions. Such experiments would allow one to determine the impact of cellular fitness as a function of mutational load and would be relevant to understand the progression of disease states accelerated by increased mutation rate.
Mlh1-Mlh3 has been shown in meiosis in both lower and higher eukaryotes to facilitate the resolution of double-Holliday junction intermediates into crossovers. These crossovers facilitate the segregation of homologs in the first meiotic division (reviewed in 66). The use of a small molecule to potentially modulate the MMR and crossover resolution functions of Mlh1-Mlh3 at different stages in meiosis could thus be valuable in teasing apart proposed separable functions for MLH proteins in meiosis (67).
An application of the FRB-FKBP dimerization system
IDRs are characterized as being highly dynamic and without well-defined structures. However, many IDRs have been shown to undergo disorder to order transitions, and in some cases form different structures when complexed with different partners (reviewed in 2,3). Interestingly a length distribution analysis of human proteins obtained from the SwissProt data base indicated that very long IDRs (>500 amino acids) were found in higher numbers than predicted (68). Furthermore, gene ontology analysis indicated that IDRs greater than 500 amino acids in length are overrepresented in transcription functions and those between 300 and 500 amino acids in length are enriched in kinase and phosphatase functions (69). Thus, our strategy to introduce FRB and FKBP domains into the IDRs of the MLH proteins could be applied to reversibly block or lock in specific conformational states of IDRs that regulate a variety of cellular processes.
DATA AVAILABILITY
This study includes no data deposited in external repositories.
Supplementary Material
ACKNOWLEDGEMENTS
We are grateful to Eric Greene for suggesting the use of the FRB-FKBP dimerization to probe Mlh1–Pms1 functions, and Ilya Finkelstein, Carol Manhart, Joshua Chappie, Philip Cole, Sy Redding, Myfanwy Adams, Fred Dyda, Alison Hickman, and Jeff Jorgensen for providing their expertise, advice, and use of equipment. C.M.F. performed the experiments described in Figures 3, 4, Supplementary Figures S1-S4, and Tables 1–3. C.M.F. performed the DSSO cross linking for the MLH complexes presented in Figure 2 and Supplementary Table S3, with the mass-spectrometry analyses performed by T.-Y.W., Q.Z. and K.Y.. C.M.F., T.-Y.W., Q.Z. and E.A. wrote the initial draft of the manuscript and all authors participated in preparing and revising the manuscript. The content of this study is solely the responsibility of the authors and does not necessarily represent the official views of the National Institutes of Health. The funders had no role in study design, data collection and analysis, decision to publish, or preparation of the manuscript.
Contributor Information
Christopher M Furman, Department of Molecular Biology and Genetics, Cornell University, Ithaca, NY 14853, USA.
Ting-Yi Wang, Department of Computational Biology, Cornell University, Ithaca, NY 14853, USA.
Qiuye Zhao, Department of Computational Biology, Cornell University, Ithaca, NY 14853, USA.
Kumar Yugandhar, Department of Computational Biology, Cornell University, Ithaca, NY 14853, USA.
Haiyuan Yu, Department of Computational Biology, Cornell University, Ithaca, NY 14853, USA.
Eric Alani, Department of Molecular Biology and Genetics, Cornell University, Ithaca, NY 14853, USA.
SUPPLEMENTARY DATA
Supplementary Data are available at NAR Online.
FUNDING
National Institute of General Medical Sciences of the National Institutes of Health (https://www.nih.gov/) [R35GM134872 to C.M.F. and E.A., R01GM124559 to T.-Y.W., Q.Z., K.Y., H.Y.]. Funding for open access charge: NIH.
Conflict of interest statement. None declared.
REFERENCES
- 1.Oldfield C.J., Dunker A.K.. Intrinsically disordered proteins and intrinsically disordered protein regions. Ann. Rev. Biochem. 2014; 83:553–584. [DOI] [PubMed] [Google Scholar]
- 2.Van Der Lee R., Buljan M., Lang B., Weatheritt R.J., Daughdrill G.W., Dunker A.K., Fuxreiter M., Gough J., Gsponer J., Jones D.T.et al.. Classification of intrinsically disordered regions and proteins. Chem. Rev. 2014; 114:6589–6631. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 3.Uversky V.N.Intrinsically disordered proteins and their “mysterious” (meta) physics. Front. Phys. 2019; 7:10. [Google Scholar]
- 4.Kunkel T.A., Erie D.A.. Eukaryotic mismatch repair in relation to DNA replication. Ann. Rev. Genet. 2015; 49:291–313. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 5.Gradia S., Subramanian D., Wilson T., Acharya S., Makhov A., Griffith J., Fishel R.. hMSH2–hMSH6 forms a hydrolysis-independent sliding clamp on mismatched DNA. Mol. Cell. 1999; 3:255–261. [DOI] [PubMed] [Google Scholar]
- 6.Gorman J., Wang F., Redding S., Plys A.J., Fazio T., Wind S., Alani E.E., Greene E.C.. Single-molecule imaging reveals target-search mechanisms during DNA mismatch repair. Proc. Natl. Acad. Sci. U.S.A. 2012; 109:E3074–E3083. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 7.Pluciennik A., Dzantiev L., Iyer R.R., Constantin N., Kadyrov F.A., Modrich P.. PCNA function in the activation and strand direction of MutLα endonuclease in mismatch repair. Proc. Natl. Acad. Sci. U.S.A. 2010; 107:16066–16071. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 8.Kawasoe Y., Tsurimoto T., Nakagawa T., Masukata H., Takahashi T.S.. MutSα maintains the mismatch repair capability by inhibiting PCNA unloading. Elife. 2016; 5:e15155. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 9.Kim Y., Furman C.M., Manhart C.M., Alani E., Finkelstein I.J.. Intrinsically disordered regions regulate both catalytic and non-catalytic activities of the MutLα mismatch repair complex. Nucleic Acids Res. 2019; 47:1823–1835. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 10.Kadyrov F.A., Dzantiev L., Constantin N., Modrich P.. Endonucleolytic function of MutLalpha in human mismatch repair. Cell. 2006; 126:297–308. [DOI] [PubMed] [Google Scholar]
- 11.Tran P.T., Liskay R.M.. Functional studies on the candidate ATPase domains of Saccharomyces cerevisiae. MutLα. Mol. Cell. Biol. 2000; 20:6390–6398. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 12.Räschle M., Dufner P., Marra G., Jiricny J.. Mutations within the hMLH1 and hPMS2 subunits of the human MutLα mismatch repair factor affect its ATPase activity, but not its ability to interact with hMutSα. J. Biol. Chem. 2002; 277:21810–21820. [DOI] [PubMed] [Google Scholar]
- 13.Genschel J., Kadyrova L.Y., Iyer R.R., Dahal B.K., Kadyrov F.A., Modrich P.. Interaction of proliferating cell nuclear antigen with PMS2 is required for MutLα activation and function in mismatch repair. Proc. Natl. Acad. Sci. U.S.A. 2017; 114:4930–4935. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 14.Bowen N., Kolodner R.D.. Reconstitution of Saccharomyces cerevisiae DNA polymerase ϵ-dependent mismatch repair with purified proteins. Proc. Natl. Acad. Sci. U.S.A. 2017; 114:3607–3612. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 15.Kadyrov F.A., Genschel J., Fang Y., Penland E., Edelmann W., Modrich P.. A possible mechanism for exonuclease 1-independent eukaryotic mismatch repair. Proc. Natl. Acad. Sci. U.S.A. 2009; 106:8495–8500. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 16.Goellner E.M., Smith C.E., Campbell C.S., Hombauer H., Desai A., Putnam C.D., Kolodner R.D.. PCNA and Msh2–Msh6 activate an Mlh1–Pms1 endonuclease pathway required for Exo1-independent mismatch repair. Mol. Cell. 2014; 55:291–304. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 17.Goellner E.M., Putnam C.D., Kolodner R.D.. Exonuclease 1-dependent and independent mismatch repair. DNA Repair (Amst.). 2015; 32:24–32. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 18.Hermans N., Laffeber C., Cristovao M., Artola-Borán M., Mardenborough Y., Ikpa P., Jaddoe A, Winterwerp H.H., Wyman C., Jiricny J.et al.. Dual daughter strand incision is processive and increases the efficiency of DNA mismatch repair. Nucleic Acids Res. 2016; 44:6770–6786. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 19.Gorman J., Plys A.J., Visnapuu M.L., Alani E., Greene E.C.. Visualizing one-dimensional diffusion of eukaryotic DNA repair factors along a chromatin lattice. Nat. Struct. Mol. Biol. 2010; 17:932–938. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 20.Hall M.C., Shcherbakova P.V., Fortune J.M., Borchers C.H., Dial J.M., Tomer K.B., Kunkel T.A.. DNA binding by yeast Mlh1 and Pms1: implications for DNA mismatch repair. Nucleic Acids Res. 2003; 31:2025–2034. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 21.Sacho E.J., Kadyrov F.A., Modrich P., Kunkel T.A., Erie D.A.. Direct visualization of asymmetric adenine nucleotide-induced conformational changes in MutLα. Mol. Cell. 2008; 29:112–121. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 22.Hall M.C., Wang H., Erie D.A., Kunkel T.A.. High affinity cooperative DNA binding by the yeast Mlh1–Pms1 heterodimer. J. Mol. Biol. 2001; 312:637–647. [DOI] [PubMed] [Google Scholar]
- 23.Plys A.J., Rogacheva M.V., Greene E.C., Alani E.. The unstructured linker arms of Mlh1–Pms1 are important for interactions with DNA during mismatch repair. J. Mol. Biol. 2012; 422:192–203. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 24.Prolla T.A., Christie D.M., Liskay R.M.. Dual requirement in yeast DNA mismatch repair for MLH1 and PMS1, two homologs of the bacterial mutL gene. Mol. Cell. Biol. 1994; 14:407–415. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 25.Argueso J.L., Kijas A.W., Sarin S., Heck J., Waase M., Alani E.. Systematic mutagenesis of the Saccharomyces cerevisiae MLH1 gene reveals distinct roles for Mlh1p in meiotic crossing over and in vegetative and meiotic mismatch repair. Mol. Cell. Biol. 2003; 23:873–886. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 26.Guarné A., Ramon-Maiques S., Wolff E.M., Ghirlando R., Hu X., Miller J.H., Yang W.. Structure of the MutL C-terminal domain: a model of intact MutL and its roles in mismatch repair. EMBO J. 2004; 23:4134–4145. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 27.Liu J., Hanne J., Britton B.M., Bennett J., Kim D., Lee J.B., Fishel R.. Cascading MutS and MutL sliding clamps control DNA diffusion to activate mismatch repair. Nature. 2016; 539:583–587. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 28.Groothuizen F.S., Winkler I., Cristóvão M., Fish A., Winterwerp H.H., Reumer A., Marx A.D., Hermans N., Nicholls R.A., Murshudov G.N.et al.. MutS/MutL crystal structure reveals that the MutS sliding clamp loads MutL onto DNA. eLife. 2015; 4:e06744. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 29.Mardenborough Y.S., Nitsenko K., Laffeber C., Duboc C., Sahin E., Quessada-Vial A., Winterwerp H.H., Sixma T.K., Kanaar R., Friedhoff P.et al.. The unstructured linker arms of MutL enable GATC site incision beyond roadblocks during initiation of DNA mismatch repair. Nucleic Acids Res. 2019; 47:11667–11680. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 30.Ban C, Junop M., Yang W.. Transformation of MutL by ATP binding and hydrolysis, a switch in DNA mismatch repair. Cell. 1999; 97:85–97. [DOI] [PubMed] [Google Scholar]
- 31.Pillon M.C., Lorenowicz J.J., Uckelmann M., Klocko A.D., Mitchell R.R., Chung Y.S., Modrich P, Walker G.C., Simmons L.A., Friedhoff P.et al.. Structure of the endonuclease domain of MutL, Unlicensed to cut. Mol. Cell. 2010; 39:145–151. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 32.Gueneau E., Dherin C., Legrand P., Tellier-Lebegue C., Gilquin B., Bonnesoeur P., Londino F., Quemener C., Le Du M.H., Márquez J.A.et al.. Structure of the MutLα C-terminal domain reveals how Mlh1 contributes to Pms1 endonuclease site. Nat. Struct. Mol. Biol. 2013; 20:461–468. [DOI] [PubMed] [Google Scholar]
- 33.Spencer D.M., Wandless T.J., Schreiber S.L., Crabtree G.R.. Controlling signal transduction with synthetic ligands. Science. 1993; 262:1019–1024. [DOI] [PubMed] [Google Scholar]
- 34.Rose M.D., Winston F., Hieter P.. Laboratory Course Manual for Methods in Yeast Genetics. 1990; NY: Cold Spring Harbor Laboratory Press. [Google Scholar]
- 35.Goldstein A.L., McCusker J.H.. Three new dominant drug resistance cassettes for gene disruption in Saccharomyces cerevisiae. Yeast. 1999; 15:1541–1553. [DOI] [PubMed] [Google Scholar]
- 36.Zhu L., Jorgensen J.R., Li M., Chuang Y.S., Emr S.D.. ESCRTs function directly on the lysosome membrane to downregulate ubiquitinated lysosomal membrane proteins. eLife. 2017; 6:e26403. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 37.Gietz R.D., Schiestl R.H., Willems A.R., Woods R.A.. Studies on the transformation of intact yeast cells by the LiAc/SS-DNA/PEG procedure. Yeast. 1995; 11:355–360. [DOI] [PubMed] [Google Scholar]
- 38.Xu T., Johnson C.A., Gestwicki J.E., Kumar A.. Conditionally controlling nuclear trafficking in yeast by chemical-induced protein dimerization. Nat. Protoc. 2010; 5:1831–1843. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 39.Geda P., Patury S., Ma J., Bharucha N., Dobry C.J., Lawson S.K., Gestwicki J.E., Kumar A.. A small molecule-directed approach to control protein localization and function. Yeast. 2008; 25:577–594. [DOI] [PubMed] [Google Scholar]
- 40.Christianson T.W., Sikorski R.S., Dante M., Shero J.H., Hieter P.. Multifunctional yeast high-copy-number shuttle vectors. Gene. 1992; 110:119–122. [DOI] [PubMed] [Google Scholar]
- 41.Hall M.C., Kunkel T.A.. Purification of eukaryotic MutL homologs from Saccharomyces cerevisiae using self-cleaving affinity technology. Prot. Exp. Purif. 2001; 21:333–342. [DOI] [PubMed] [Google Scholar]
- 42.Tran H.T., Keen J.D., Kricker M., Resnick M.A., Gordenin D.A.. Hypermutability of homonucleotide runs in mismatch repair and DNA polymerase proofreading yeast mutants. Mol. Cell. Biol. 1997; 17:2859–2865. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 43.Dixon W.J., Massey F.J.. Introduction to Statistical Analysis. 1969; NY: McGraw-Hill. [Google Scholar]
- 44.Yugandhar K., Wang T.Y., Leung A.K.Y., Lanz M.C., Motorykin I., Liang J., Shayhidin E.E., Smolka M.B., Zhang S., Yu H.. MaXLinker, proteome-wide cross-link identifications with high specificity and sensitivity. Mol. Cell Proteomics. 2020; 19:554–568. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 45.Cooper M.P., Balajee A.S., Bohr V.A.. The C-terminal domain of p21 inhibits nucleotide excision repair in vitro and in vivo. Mol. Biol. Cell. 1999; 10:2119–2129. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 46.Finkelstein J., Antony E., Hingorani M.M., O’Donnell M. Overproduction and analysis of eukaryotic multiprotein complexes in Escherichia coli using a dual-vector strategy. Anal. Biochem. 2003; 319:78–87. [DOI] [PubMed] [Google Scholar]
- 47.Rogacheva M.V., Manhart C.M., Chen C., Guarne A., Surtees J., Alani E.. Mlh1-Mlh3, a meiotic crossover and DNA mismatch repair factor, is a Msh2-Msh3-stimulated endonuclease. J. Biol. Chem. 2014; 289:5664–5673. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 48.Hosford C.J., Adams M.C., Niu Y., Chappie J.S.. The N-terminal domain of Staphylothermus marinus McrB shares structural homology with PUA-like RNA binding proteins. J. Struct. Biol. 2020; 211:107572. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 49.Yu C., Huang L.. Cross-linking mass spectrometry: an emerging technology for interactomics and structural biology. Anal. Chem. 2018; 90:144–165. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 50.Smith C.E., Mendillo M.L., Bowen N., Hombauer H., Campbell C.S., Desai A., Putnam C.D., Kolodner R.D.. Dominant mutations in S cerevisiae PMS1 identify the Mlh1–Pms1 endonuclease active site and an exonuclease 1-independent mismatch repair pathway. PLos Genet. 2013; 9:e1003869. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 51.Voß S., Klewer L., Wu Y.W.. Chemically induced dimerization: reversible and spatiotemporal control of protein function in cells. Curr. Opin. Chem. Biol. 2015; 28:194–201. [DOI] [PubMed] [Google Scholar]
- 52.Inobe T., Nukina N.. Rapamycin-induced oligomer formation system of FRB–FKBP fusion proteins. J. Biosci. Bioeng. 2016; 122:40–46. [DOI] [PubMed] [Google Scholar]
- 53.Gruber S., Arumugam P., Katou Y., Kuglitsch D., Helmhart W., Shirahige K., Nasmyth K.. Evidence that loading of cohesion onto chromosomes involves opening of its SMC hinge. Cell. 2006; 127:523–537. [DOI] [PubMed] [Google Scholar]
- 54.Banaszynski L.A., Liu C.W., Wandless T.J.. Characterization of the FKBP⊙ Rapamycin⊙ FRB ternary complex. J. Am. Chem. Soc. 2005; 127:4715–4721. [DOI] [PubMed] [Google Scholar]
- 55.Fegan A., White B., Carlson J.C., Wagner C.R.. Chemically controlled protein assembly, techniques and applications. Chem, Rev. 2010; 110:3315–3336. [DOI] [PubMed] [Google Scholar]
- 56.Ho B., Baryshnikova A., Brown G.W.. Unification of protein abundance datasets yields a quantitative Saccharomyces cerevisiae proteome. Cell Syst. 2018; 6:192–205. [DOI] [PubMed] [Google Scholar]
- 57.Jorgensen P., Edgington N.P., Schneider B.L., Rupes I., Tyers M., Futcher B.. The size of the nucleus increases as yeast cells grow. Mol. Biol. Cell. 2007; 18:3225–3709. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 58.Kadyrov F.A., Holmes S.F., Arana M.E., Lukianova O.A., O’Donnell M., Kunkel T.A., Modrich P.. Saccharomyces cerevisiae MutLα is a mismatch repair endonuclease. J. Biol. Chem. 2007; 282:37181–37190. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 59.Furman C.M., Elbashir R., Alani E.. Expanded roles for the MutL family of DNA mismatch repair proteins. Yeast. 2021; 38:39–53. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 60.Ban C., Yang W. Crystal structure and ATPase activity of MutL: implications for DNA repair and mutagenesis. Cell. 1998; 95:541–552. [DOI] [PubMed] [Google Scholar]
- 61.Raghavan V., Aquadro C.F., Alani E.. Baker's yeast clinical isolates provide a model for how pathogenic yeasts adapt to stress. Trends Genet. 2019; 35:804–817. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 62.Raghavan V., Bui D.T., Al-Sweel N., Friedrich A., Schacherer J., Aquadro C.F., Alani E.. Incompatibilities in mismatch repair genes MLH1-PMS1 contribute to a wide range of mutation rates in human isolates of baker's yeast. Genetics. 2018; 210:1253–1266. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 63.Lynch M., Ackerman M.S., Gout J.F., Long H., Sung W., Thomas W.K., Foster P.L.. Genetic drift, selection and the evolution of the mutation rate. Nat. Rev. Genet. 2016; 17:704. [DOI] [PubMed] [Google Scholar]
- 64.Bui D.T., Dine E., Anderson J.B., Aquadro C.F., Alani E.E.. A genetic incompatibility accelerates adaptation in yeast. PLoS Genet. 2015; 11:e1005407. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 65.Bui D.T., Friedrich A., Al-Sweel N., Liti G., Schacherer J., Aquadro C.F., Alani E.. Mismatch repair incompatibilities in diverse yeast populations. Genetics. 2017; 205:1459–1471. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 66.Manhart C.M., Alani E.. Roles for mismatch repair family proteins in promoting meiotic crossing over. DNA Repair (Amst.). 2016; 38:84–93. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 67.Claeys Bouuaert C., Keeney S.. Distinct DNA-binding surfaces in the ATPase and linker domains of MutLγ determine its substrate specificities and exert separable functions in meiotic recombination and mismatch repair. PLos Genet. 2017; 13:e1006722. [DOI] [PMC free article] [PubMed] [Google Scholar]
- 68.Tompa P., Kalmar L.. Power law distribution defines structural disorder as a structural element directly linked with function. J. Mol. Biol. 2010; 403:346–350. [DOI] [PubMed] [Google Scholar]
- 69.Lobley A., Swindells M.B., Orengo C.A., Jones D.T.. Inferring function using patterns of native disorder in proteins. PLoS Comp. Biol. 2007; 3:e162. [DOI] [PMC free article] [PubMed] [Google Scholar]
Associated Data
This section collects any data citations, data availability statements, or supplementary materials included in this article.
Supplementary Materials
Data Availability Statement
This study includes no data deposited in external repositories.